(data stored in ACNUC10043 zone)

EMBL: AP011532.PE578

AP011532.PE578       Location/Qualifiers
FT   CDS_pept        560053..562071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0578"
FT                   /product="putative histidine kinase"
FT                   /note="Contains two PAS domains (IPR000014).; Contains two
FT                   PAS-associated, C-terminal domains (IPR000700).; Contains
FT                   one GAF domain (IPR003018).; Contains one ATP-binding
FT                   region, ATPase-like domain (IPR003594).; Contains two PAC
FT                   motif repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60650"
FT                   /db_xref="GOA:D1YW28"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW28"
FT                   /protein_id="BAI60650.1"
FT                   /translation="MLRGEEARRSRAEQMAHIGSWCMDIKLDIMACSDEFYRILGYQPG
FT                   ESTITVEQFKKNVHHEDIQYVDEVFNRSIREKKPYEADFRILRKDGSACDVHAITEFEY
FT                   GESGDVRFIYGTVQDITGRKRTDEALKYRSELEALITTLSTRFIKLAPEELDPALNDAL
FT                   RKIGEFAGVDRSYIHQTTKDGKMTGITHEWCREGVGPSMEFGKQLDIMETYPWVSGFLR
FT                   KLEVLHVPSVEDLPPEAEVEKRLLSASRVLSLVAVPMVCNREFIGVLGFDSVRNRKAWT
FT                   EDDIAILRIVGEIFANAIVRSETERALRDSEERFRATFEQAAVGIAHVSPGGRYLRVNR
FT                   RYCNIVGYSHGELLSRNFQSITHPDDLEEDLGNLASLISGRIDTASMEKRYIRKDGSII
FT                   WVTLTTTAVRGPEGIPKYVISVIEDITARKRAEAEMQEARMRAELYVDLMGHDIGNMNQ
FT                   AIMGYLEMAQDTVKLKDDEREFIEKPLELVKGSSALIDNVKRLQRARSGEAPVQVVDIV
FT                   PLIMSLAACYSNSSGKSAGLDFNTGAVYRVVANEFIKDLFSNIIENAVKYSRSDVRIGI
FT                   SPVERNGKPFYRVSVEDNGPGVPDEQKAGIFSELAGREKYARRRGLGLQIVKTLVKAYG
FT                   GKVWVEDRVPGDHEQGARFVVMLPALDQVAAMNAGEK"
     atgctgaggg gcgaggaggc ccgccggtcc cgggcagagc agatggccca catcggaagc        60
     tggtgcatgg acatcaagct ggatatcatg gcgtgctccg acgagtttta ccgcatctta       120
     ggctaccagc ccggcgaatc gacgataacg gtcgaacagt tcaagaagaa cgtccaccac       180
     gaggatatcc aatacgtcga tgaggtcttt aaccgttcca tccgtgaaaa gaagccctac       240
     gaggccgact tccgtatcct ccgtaaggac ggctccgcgt gcgacgtcca cgccattacg       300
     gagttcgagt atggtgagag cggcgatgtg agattcatct atggtacggt gcaggacatt       360
     accgggcgca agcgcaccga cgaggccctg aagtacaggt ccgagctcga ggcgctgatc       420
     accacgctgt cgacacgatt cattaaactg gcaccggaag agcttgaccc ggcgctgaac       480
     gatgcgctca ggaagatagg cgaattcgcc ggagtcgacc ggagctacat ccaccagacg       540
     acgaaggacg gtaagatgac cggcatcacc cacgagtggt gccgggaggg cgtcgggccc       600
     agcatggagt tcggtaagca gctcgatatt atggaaacct atccctgggt atccgggttc       660
     ttgcggaagc tggaggtgct gcatgtgccg tctgttgagg atcttccccc cgaggcggag       720
     gtggaaaagc gcttattatc ggcatcccgg gtcctgtccc tggtcgccgt gcccatggtc       780
     tgtaacaggg agttcatcgg ggtgctgggc ttcgactcgg tccgtaacag gaaggcctgg       840
     acggaggacg atatcgcgat cctgaggatc gttggcgaga tcttcgcgaa cgccatcgtg       900
     cgcagcgaaa cggagcgggc gctgcgcgat agcgaggagc gtttccgggc cacgttcgag       960
     caggccgccg tcggcatcgc ccacgtctcg cctggcgggc gatacctgag ggtcaaccgg      1020
     cgctactgta atatcgtcgg ctattcgcat ggcgagctcc tatcccgcaa cttccagagt      1080
     ataacccatc cggacgacct ggaggaggat ctgggaaatc tggcgagcct gatctcgggc      1140
     cggatcgata cggcgtccat ggaaaagcgt tacatccgca aggacggctc cataatctgg      1200
     gtcacgctga ccacgaccgc cgtaagaggg cctgaaggca taccgaagta cgtgatatcg      1260
     gtcatcgagg acatcacggc ccgcaagcgc gccgaggccg agatgcagga ggcccggatg      1320
     agggccgagc tttacgttga cctgatgggc cacgatatcg gtaacatgaa ccaggccatc      1380
     atgggctacc tggagatggc acaggatacg gtgaagctca aggatgacga gagggagttc      1440
     atcgagaaac cgcttgagct ggtgaagggc agctctgctt tgatagataa tgtgaagcgt      1500
     ctgcaaaggg cccgctccgg agaggcgccc gtgcaggttg tggatatcgt cccgctcatc      1560
     atgtcgctcg ctgcctgcta ctcgaattcg agcggcaaat cggccggcct ggatttcaat      1620
     accggggccg tttaccgggt cgtcgcgaac gagttcatca aggacctgtt cagtaatatc      1680
     atcgagaacg ccgtgaaata ttcgcggtcc gacgtgcgta tcggcatctc ccctgtggag      1740
     cggaacggga agcctttcta ccgcgtctcc gtggaggata acggccccgg cgtgcccgac      1800
     gagcagaagg cgggcatctt ttcagagctt gcgggccggg agaagtacgc acggcggagg      1860
     ggtctcgggc tccagatcgt caagacgctg gtcaaggctt atggcggtaa agtgtgggtg      1920
     gaggaccgtg tgccgggcga ccacgagcag ggcgcacgtt tcgtcgtcat gctaccggca      1980
     cttgatcaag tagctgccat gaacgccggt gaaaaatga                             2019
//

If you have problems or comments...

PBIL Back to PBIL home page