(data stored in ACNUC10043 zone)

EMBL: AP011532.PE582

AP011532.PE582       Location/Qualifiers
FT   CDS_pept        complement(566140..567018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60654"
FT                   /db_xref="GOA:D1YW32"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW32"
FT                   /protein_id="BAI60654.1"
FT                   /translation="MARDRFNQRVFLNVAAVAFLLMVVLAIGVFIGRTLTMNDGSDDPT
FT                   VVPSVAVSPTILPTASPSSDVTVTSTPAASATATPTVTATPTATATPTPTVTVTATPTV
FT                   TPTATPTPTPTATPTPTPTPTVTPTPTATPIDLPADTPFYESITPLKDKDQFSLAPVEN
FT                   SYIAGDGPLYLDLGNSYMGSGWAYPGDTIGVKLKMYNDGPALNTNARVTLNLSRMVITP
FT                   YGSFWLDDIIPGQQFTTQIAVGEKGSFTKNLSYAVPNVTGYKGFYKITVKFYVNDQFNC
FT                   GFVKELNILDP"
     ttggctagag atcgttttaa ccagagggtg ttcctgaacg tggccgccgt cgcgtttttg        60
     ctgatggtgg tgctcgctat aggcgtgttc atcggaagga cgcttacgat gaatgacggg       120
     tctgatgacc ctacggttgt cccgtccgtt gcagtttcgc ctacgatcct gcccacggct       180
     tcgccgtcct ctgatgtgac cgttacttcg actcctgccg cttctgctac ggcgacccct       240
     acggtgacgg ctacgcctac ggcgaccgcc actccgacgc cgaccgtgac tgttacggcg       300
     acccccacgg taacgcctac tgccacgccc acgccgaccc cgacagcgac acctaccccc       360
     acgcccacac ctactgttac tccgacgcct actgcgacac ctatcgattt accggcggat       420
     acgcccttct acgagagcat cacgcccctg aaggataagg accagttcag cctggccccg       480
     gtggagaaca gctacattgc cggcgacggc ccgctatacc tggacctcgg taactcctac       540
     atgggctcgg gctgggcata ccccggtgat acgatcggcg ttaagctgaa gatgtacaat       600
     gacggccccg cgttgaacac gaacgcccgc gtgacgctta atctatcgag gatggtcatc       660
     acgccctatg gttcgttctg gctcgacgat atcatccctg gccagcagtt caccacgcag       720
     atcgctgtcg gtgagaaggg atctttcact aagaatctga gctatgctgt cccgaatgtg       780
     accggctaca aggggttcta taagatcacc gtgaagttct acgtgaacga ccagtttaac       840
     tgcgggttcg ttaaagagct gaatattctg gacccgtag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page