(data stored in ACNUC10043 zone)

EMBL: AP011532.PE584

AP011532.PE584       Location/Qualifiers
FT   CDS_pept        complement(569609..570172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CopG-like DNA-binding domain
FT                   (IPR002145)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60656"
FT                   /db_xref="GOA:D1YW34"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW34"
FT                   /protein_id="BAI60656.1"
FT                   /translation="MNAPIRVTISFDEKSYRNFEALRGEIDVSQSELIRRAINYYYENR
FT                   SSLDSPPDERVSGYKDMLGNGEHIILDVDHWLLFLKTVESSSNQSEFWNTHRDIARSHA
FT                   EQLAKKVTSPEALLKRLETCNLFKISRSDSAPNEYTLLTGSGTQRRFVREFLEETFAGM
FT                   GFDANIKEDYSKLRVTLNGEKEIQ"
     atgaacgctc ccatccgggt aacgatctct ttcgacgaga agtcttaccg taacttcgag        60
     gctctgaggg gcgagataga cgtctcccag agcgagctga tccggcgcgc cattaactat       120
     tattacgaga accgctcttc gctggatagc ccgcccgacg agcgcgtctc cgggtataag       180
     gatatgctcg ggaacgggga gcatatcatc ctggacgtcg accactggct gctattcctt       240
     aagactgtgg agagctcttc gaatcagtcg gagttctgga acacgcaccg ggacatcgcc       300
     aggtcccacg ccgagcagct cgccaaaaag gtcacgtccc cggaggcgct cctgaagcgg       360
     ctggagacgt gcaacctgtt caagatcagc cgctccgata gcgccccgaa cgagtatacg       420
     cttttgaccg gctcgggcac ccagcggcgt ttcgtgcgcg agttcctgga agagactttc       480
     gccggaatgg ggttcgatgc caacatcaag gaagactatt ctaagctacg cgttacgctg       540
     aacggcgaga aggaaattca atag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page