(data stored in ACNUC10043 zone)

EMBL: AP011532.PE586

AP011532.PE586       Location/Qualifiers
FT   CDS_pept        571677..571997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0586"
FT                   /product="putative nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60658"
FT                   /db_xref="GOA:D1YW36"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW36"
FT                   /protein_id="BAI60658.1"
FT                   /translation="MKMVQAIIRPEKMEAVKKALEEKGFIAMTIIEVRGRGEQKGITLE
FT                   FRGKKVDVDTIPKMKLEIVVKDEDVEIIIDTIRASARTGKVGDGKIFVLPVERMCKVRI
FT                   DD"
     atgaagatgg tacaggcgat catccgtccg gaaaagatgg aggcggtgaa aaaggccctg        60
     gaggagaagg gcttcatcgc catgacgatc atcgaggtcc ggggccgggg tgagcaaaag       120
     ggcatcaccc tggaatttag gggaaaaaag gtcgatgtcg atacgatccc gaagatgaag       180
     ctcgagatcg tcgtgaagga cgaggacgtc gagatcatca ttgataccat ccgggccagc       240
     gcccgcacgg gcaaggtcgg ggacggcaag attttcgtgc tgcccgtgga gaggatgtgt       300
     aaagtgcgca tcgacgatta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page