(data stored in ACNUC10043 zone)

EMBL: AP011532.PE589

AP011532.PE589       Location/Qualifiers
FT   CDS_pept        573890..574783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60661"
FT                   /db_xref="GOA:D1YW39"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW39"
FT                   /protein_id="BAI60661.1"
FT                   /translation="MSDMKKGARKPKDSPEAGRQIKPELVTSALIAALYALFLIETIWE
FT                   GSLAALAFSVLLFAIMVLMSYFVDRGKLHKKELFKSLIYVFAGLSALSMIVELLRYLNV
FT                   PGMAGVYWAAVLGIASAIASVAIIAGLIYLEKDELKRLYVGLGDKKAAGLGVIGLVLCV
FT                   AAALVGAYFMFGGNAIGQEKFIQIAASAIVFGILAGIVEELWFRGLLLSRILPLLGESQ
FT                   GNIYQAAVFGVFEAVIFYTITGLIAYLPVIFIIGAFTGFYWGRATLKAGSMAAPVLLHV
FT                   GLYILLLLPIMTGLMS"
     atgagcgata tgaaaaaagg cgcaagaaag ccgaaagaca gcccggaggc gggccggcag        60
     atcaagccgg agctcgtcac gtcggcgctg atcgcggccc tttatgccct gttccttatc       120
     gagacgatct gggagggcag cctggctgcg ctggccttct ccgtcctgtt attcgccatc       180
     atggtactga tgtcctattt tgtagacagg ggcaagcttc ataaaaaaga gctgttcaag       240
     tcgctcatct acgtcttcgc cggactctcg gccctgtcaa tgatcgttga gctgctgcgg       300
     tacctgaacg ttcccggcat ggccggagta tactgggccg ctgtcctggg cattgccagc       360
     gccatcgcgt ccgttgcgat catcgccggc ctgatctacc tggaaaagga cgagcttaaa       420
     aggctatacg ttggccttgg cgacaagaaa gcggccgggc tcggcgtcat cgggcttgtg       480
     ctgtgcgtag cggccgccct cgtgggcgca tactttatgt tcggcggcaa cgccatcggc       540
     caggaaaagt tcattcagat cgcggcatcc gccatcgtgt tcggcatcct ggcgggcatt       600
     gtcgaggagc tctggttccg cgggctgctc ctgtccagga tattgccgct cctgggcgaa       660
     tctcagggca acatatatca ggccgcggtc ttcggcgttt tcgaggcggt catattctac       720
     acgatcaccg gcctcatcgc ttacctgccg gtcatcttca tcatcggggc gttcacgggc       780
     ttctactggg gcagggcgac gctcaaagcc ggtagcatgg ccgcccccgt cctgctgcat       840
     gtcggcctct acattttgct gctactaccc attatgacag ggctcatgtc ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page