(data stored in ACNUC10043 zone)

EMBL: AP011532.PE594

AP011532.PE594       Location/Qualifiers
FT   CDS_pept        complement(577967..578545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Flavodoxin/nitric oxide synthase domain
FT                   (IPR008254)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60666"
FT                   /db_xref="GOA:D1YW44"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW44"
FT                   /protein_id="BAI60666.1"
FT                   /translation="MNALMIIGLVVVGIILLVAAIGIAMGALFCGDIMSYTDTGSKVLS
FT                   PAGASSGKALVVYNPGLSGASKNAANEIAGDLQSKGYTVTLAGIKSTAAANTTGYDVVI
FT                   AGGPMYWGRVSNSVDAYLKALKPQKGMAVGVFGTTGAPQFNDGDIATFGEQVTIDLGGV
FT                   VLDKKAATKTIRSGDAANRDCSDFVSAVV"
     atgaatgcat taatgatcat aggattggtc gtcgtcggca tcatattact ggtcgcggcg        60
     atcgggattg ccatgggggc gctcttctgc ggagacatca tgagctacac ggacacgggc       120
     agcaaggtct tgagcccggc cggggcatcg agtggaaaag cgctcgtcgt atataacccg       180
     ggcctctcgg gcgcctcgaa gaatgctgcg aacgagatag ccggtgacct gcagtcaaag       240
     ggatataccg ttacactggc gggcataaag agcacggccg cggctaacac cacgggctat       300
     gacgtggtca tcgcgggcgg gccgatgtac tggggtcggg tgagcaactc ggtcgatgca       360
     tacctgaaag cgctaaagcc gcaaaagggc atggcggtgg gagtatttgg gacgaccggc       420
     gcaccgcagt tcaatgacgg cgatatcgct acgttcgggg aacaggtcac gatcgacctg       480
     ggcggcgtcg tgctcgataa gaaggccgcc acgaagacga tccgctcggg cgacgccgct       540
     aatagggact gctctgactt cgtatcggct gtcgtgtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page