(data stored in ACNUC10043 zone)

EMBL: AP011532.PE596

AP011532.PE596       Location/Qualifiers
FT   CDS_pept        complement(579375..580454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60668"
FT                   /db_xref="GOA:D1YW46"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW46"
FT                   /protein_id="BAI60668.1"
FT                   /translation="MEMENNNDLNRMINEMIRGIFSDALGVSLKDPAMAAFFVRAALAQ
FT                   KKAAAVRQYNEEHGVHVPPVMILSITNKCNLHCAGCYSRLVPRERKPELDEAGLRNVLK
FT                   QASELGISIVLVVGGEPLTRPEIFNVTKDFPDMIFTLFTNGTLIDDAVIQKFKEQKHVI
FT                   PILSMEGHENITDLRRGSGTYDRLMRDMTKLCERGVFFGSSLTVTRMNYDEVTGEPFVK
FT                   RMREHGCKAFIYVEYNPVKKGTEDWVVTDAQRDEILAKMAAYRKSQPGVYIGFPGDEKL
FT                   FGGCLSSGRGFIHVSASGDLEPCPFAPFSDSSILDMPLKEALNSKLFRALRANRDQLME
FT                   SNGGCALWKKPEWVKSLTE"
     atggaaatgg aaaataacaa tgaccttaac cggatgatca atgagatgat acgggggatt        60
     ttctccgatg cgctgggcgt atcgctcaag gaccctgcca tggcggcgtt cttcgtccgg       120
     gcggcgctcg cgcagaaaaa ggcggccgct gtccggcagt acaatgaaga acatggggtc       180
     catgtgccgc ccgtcatgat attgagtatc acgaacaagt gcaacctgca ctgcgccggg       240
     tgctattcca ggctcgtccc ccgggagagg aagccggaac tcgacgaggc aggattgagg       300
     aacgtcctga agcaggccag cgagcttggc atatccatcg tactggtcgt aggcggcgag       360
     ccgctgacca ggcccgagat cttcaacgtc accaaagact tccctgacat gatcttcacg       420
     ctgttcacga acggcacgct catcgacgac gcggtcattc aaaagttcaa ggagcagaag       480
     cacgtcatac ccatccttag catggagggc cacgagaaca tcaccgacct gcgcaggggc       540
     tccggcacat atgaccggct catgcgggac atgacgaagc tctgcgagcg cggcgtattc       600
     ttcggctcgt cgctcaccgt tacccggatg aactatgatg aagtcaccgg cgagccgttc       660
     gtgaagcgta tgcgggagca cggctgcaag gcgttcatct acgtggagta caacccggtc       720
     aagaagggca ccgaggactg ggtcgtgacc gacgcgcaga gggacgagat cctggctaag       780
     atggccgcat acaggaagag tcagcctggc gtctatatcg ggttcccggg cgacgaaaag       840
     ctgttcggcg ggtgcctgtc ctccggcagg ggcttcatcc acgtcagcgc ttccggcgac       900
     ctcgagccct gccccttcgc gccgttctcg gacagctcga tcctggacat gccgctgaag       960
     gaagcgctga actcgaagct cttccgggca ctgagggcga accgggacca gctcatggaa      1020
     tcgaacggcg gctgtgccct ctggaagaag cccgagtggg tgaaatcgct gacagagtaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page