(data stored in ACNUC10043 zone)

EMBL: AP011532.PE604

AP011532.PE604       Location/Qualifiers
FT   CDS_pept        complement(585879..586091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60676"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW54"
FT                   /protein_id="BAI60676.1"
FT                   /translation="MPGFFMPTPRALYIGDKNMCISCGCGQPNDNHGKSELITMDELQK
FT                   AAKAANQSVDDAAKNIAESVGLSCK"
     ttgccaggat tctttatgcc tacgccccgc gctctttata tcggtgataa aaacatgtgc        60
     ataagttgcg gatgcgggca gcctaacgac aatcatggca agtccgagct catcacgatg       120
     gacgagctcc agaaagcggc gaaggccgcc aatcagtcgg tagacgacgc tgcaaagaac       180
     atcgcagaat cggtcgggct gagctgcaaa tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page