(data stored in ACNUC10043 zone)

EMBL: AP011532.PE606

AP011532.PE606       Location/Qualifiers
FT   CDS_pept        586651..587313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60678"
FT                   /db_xref="GOA:D1YW56"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW56"
FT                   /protein_id="BAI60678.1"
FT                   /translation="MFLVMRLDRDLLSAEAERKLFHIAWAIDPLLYYFGYPRDGMLLLI
FT                   GCQLLIWIGFEAARGMGYSAFSTSYMRPEEARGAPMGTLFQVASLFLAVLLFDKSIAII
FT                   AMVFNCVGDSAVGLAGAVLYPYIGREKAAIREQGVRGLWNMLKSHKAPVLMAVMFLACV
FT                   VPGFILFPRASPLLMGVGALGAVIADAFAWKLFGYTLNDDLTITLAAGSAMAIAASF"
     atgtttctgg taatgcgcct ggaccgggac ctgttatctg ccgaggccga gcgtaagctc        60
     tttcatatcg cctgggcgat agacccgctt ctttattatt tcggataccc ccgggatggc       120
     atgcttctcc tcatcggctg ccagcttctc atctggatcg gcttcgaggc cgcccgcggg       180
     atgggctatt cggcgttctc cacttcctac atgcggcccg aggaggcccg gggggctcca       240
     atgggcacgc tttttcaggt tgcctcgctc ttcctggccg tgctgctctt cgacaagtcg       300
     atcgcgatca tagccatggt gttcaactgt gtgggcgatt cagcggtggg ccttgcaggt       360
     gcagtcctgt acccttacat cggcagggag aaggcggcta ttcgtgagca gggggtccga       420
     gggctgtgga atatgctgaa gagccataaa gcgcctgtcc tgatggccgt gatgttcctg       480
     gcgtgtgtag tacccggctt tatcctcttc ccgcgggcgt ctcccctgct aatgggcgtg       540
     ggcgcgctcg gcgcggtcat tgccgacgcg ttcgcatgga agctgttcgg ctacacgctg       600
     aacgatgacc tgacgatcac gcttgccgcc ggcagcgcta tggcgatagc agcttctttt       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page