(data stored in ACNUC10043 zone)

EMBL: AP011532.PE608

AP011532.PE608       Location/Qualifiers
FT   CDS_pept        587955..588647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60680"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW58"
FT                   /protein_id="BAI60680.1"
FT                   /translation="MEKRGMRLNHLLTALLIVAVVAALSGCICCFGQDGFFSKLKKPVS
FT                   AIQFPSALKIGQKTYNKAYSNEYLDRDSAKSGLKAFARKLGYGSGDMQGLVDKAIELSG
FT                   INQYKSFKYTDGSAKGIVGGLVAKTDAPSTVTGGYEAIKQSATAGQSAINDPSQNTGDV
FT                   RNVVSGGSSSLGDGGDRYTMTVNGETCYVVVVKYSNMYISAYSFESYDACDAAIAMAIE
FT                   QVDIAASS"
     atggagaagc ggggtatgag gttaaaccac ttactgacgg cgttactcat cgtagcggtc        60
     gtggcggcgc tgagcggctg tatctgctgc ttcgggcagg acggcttttt cagcaagctc       120
     aagaagccag tgagcgcgat acagttccca tcggcgctca agatcggcca gaagacgtac       180
     aataaggctt actcgaacga atacctggac agggactcag cgaagtccgg cctcaaggca       240
     tttgccagaa agctgggcta cggctcgggc gacatgcagg gcctggtcga taaggccatc       300
     gagctatccg gcatcaacca gtacaagtcg ttcaagtata ccgacggctc tgctaagggc       360
     atcgtcgggg gcctcgtggc gaagacggac gcgccgtcga cggtcaccgg gggatatgag       420
     gccatcaagc agagcgccac tgccggccag tcggccatca acgacccgtc ccagaacacg       480
     ggcgacgtcc ggaatgtcgt gagcggcggt agctccagcc tcggcgatgg tggggacagg       540
     tacacgatga ccgtgaacgg cgagacgtgc tacgtcgtgg tcgtcaagta cagtaacatg       600
     tacatcagcg cctactcctt cgagtcgtac gatgcctgcg atgccgccat cgccatggcg       660
     atcgagcagg tggacatagc cgcatcatcg taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page