(data stored in ACNUC10043 zone)

EMBL: AP011532.PE61

AP011532.PE61        Location/Qualifiers
FT   CDS_pept        complement(53768..54058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60133"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL1"
FT                   /protein_id="BAI60133.1"
FT                   /translation="MYSIDSRVHMTYVDDDDIDDMEAGDTDEISRDEAGRCDECGLKVK
FT                   KEDALQCHMCSAVYHRWCAGAECNVCKTPMEVKAVTKAAPRSEKPRKRTKR"
     ttgtatagca ttgattcaag ggttcatatg acatacgtag acgatgacga cattgacgac        60
     atggaagccg gcgacactga cgagataagc agagacgagg cgggcaggtg cgacgagtgc       120
     ggcctcaagg tgaagaagga ggacgccctg cagtgccaca tgtgctcagc agtctaccac       180
     cggtggtgcg ccggagccga atgcaacgtc tgcaagacgc ccatggaggt taaggccgtt       240
     acgaaggccg cccccaggag cgagaagccc cggaagagaa caaagagata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page