(data stored in ACNUC10043 zone)

EMBL: AP011532.PE626

AP011532.PE626       Location/Qualifiers
FT   CDS_pept        complement(608064..608651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0626"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60698"
FT                   /db_xref="GOA:D1YW76"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW76"
FT                   /protein_id="BAI60698.1"
FT                   /translation="MDEKSLMEAALFSAGKPVSEQQLKSLLNRSSTYINSLAQKLMEEY
FT                   RERNSPLEIVRLEGKYAMQLRPEYAERVVGFSPGELRAPALRTLSVIAYYQPIQQSDLV
FT                   DIRGQAAYDHVAMLLEKDLIEKKRVGRSYELTTTEAFCDYFGLTKGDVESIKTQIMKKA
FT                   KLKKESLTKWVDSKVPDVDAFDAVSKLMPKVK"
     atggatgaga agagcctgat ggaggccgcg ctgttttcgg ccggtaagcc cgtgagcgag        60
     cagcaattga aaagcctgct gaaccggtcg agcacctaca tcaattcgct ggcgcagaag       120
     ctcatggagg agtatcgtga gcgtaactcg cctctggaga tcgtgaggct tgagggaaaa       180
     tacgccatgc agctcaggcc ggagtacgcc gagcgcgttg tgggcttttc gccgggcgag       240
     ctccgggccc ccgcgctgcg cacgttatcg gtcatcgcct attaccagcc catccagcag       300
     tcagacctgg tggacatccg gggccaggcc gcctacgatc acgtggccat gctcctggaa       360
     aaggacctta tcgagaagaa gcgcgtcggg cgttcgtacg agctcacgac gaccgaggcg       420
     ttttgcgatt acttcgggct cacgaagggc gacgtcgagt ccatcaagac ccagatcatg       480
     aagaaggcga agctcaagaa agagtcgctg acgaagtggg tggactcgaa ggtgcccgat       540
     gtggacgcct tcgatgccgt tagcaagctg atgcccaagg taaagtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page