(data stored in ACNUC10043 zone)

EMBL: AP011532.PE627

AP011532.PE627       Location/Qualifiers
FT   CDS_pept        complement(608644..609339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0627"
FT                   /product="putative chromosome segregation and condensation
FT                   protein ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60699"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW77"
FT                   /protein_id="BAI60699.1"
FT                   /translation="MQTEAPAQHQEESIEILLEMARSGEIDPWNIDIIDVTDRFLARIV
FT                   EREKVDLPASARTLLYASILLRMKSDVLVNAPPPEPDDDYAFGPDFDLEPEDYPMLEPR
FT                   QRNAVARPVTLQELITELQRAVATKDASHMRKALKIEKPPRKTIEEVLGIAHNEDIEAS
FT                   ILEMTSALDREFAYRDFVMFSELIKDPTPHGIVDVYLPLLFLANRKYVMLTQEILFEDI
FT                   FIRRSVPNG"
     gtgcagactg aggcgccggc gcagcaccag gaagagtcca tcgagatact gctggagatg        60
     gccaggtcgg gcgagatcga cccgtggaac atcgacatca tcgacgtcac cgaccgtttc       120
     ctggccagga tcgtggagag ggaaaaggtc gacctccccg cctcggccag gacgctgctg       180
     tacgcttcca tcttattgcg catgaagtcc gacgtgctgg tcaacgcccc gccgcccgag       240
     cccgatgacg attacgcctt cgggcctgac ttcgacctgg agcccgagga ctacccgatg       300
     ctggagcccc ggcagcggaa cgccgtcgcc cgccccgtca ccctgcagga gctaatcacc       360
     gagctgcagc gggccgtggc cacgaaggac gcttcgcaca tgaggaaggc cctgaagatc       420
     gagaagccgc ccaggaagac catcgaggaa gtgctgggca tcgcccacaa cgaggacatc       480
     gaggcgagca tcctggagat gaccagcgcg ctggaccggg agttcgccta ccgggacttc       540
     gtcatgttct ccgaattaat caaggacccc acgccccacg gcatcgtgga cgtgtacctg       600
     cccctgctgt ttttggcgaa ccgcaagtac gttatgctca cgcaggagat attgttcgag       660
     gatattttca tcaggaggtc tgtgccgaat ggatga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page