(data stored in ACNUC10043 zone)

EMBL: AP011532.PE628

AP011532.PE628       Location/Qualifiers
FT   CDS_pept        complement(609329..612850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0628"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60700"
FT                   /db_xref="GOA:D1YW78"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW78"
FT                   /protein_id="BAI60700.1"
FT                   /translation="MHIKEIELNNFKSFGRKAKIPFFDDFTTISGPNGSGKSNVIDSIL
FT                   FCLGLSNSRSMRAEKLTDLIYSVNGKSPGSADVTIRFDNTDREMPIDQDEVTITRRIKS
FT                   SDSGYYSYYYFNEKPVSLSEIHEHLLKAKISPDGYNVVMQGDVTRIIEVSNFERRKMID
FT                   EIAGTAEFDEKTDKALSELDIVRDRIDRVAIIISEVEARLAQLKDERDHALLYQSYRDE
FT                   KVKNEGYLVLSELKEAQQLLDSLLEDIRDKTDKRAAITADVEKKSAAVQKLKDDIKALN
FT                   ATITEKGEGEQILIRRQIEEARAGIKACISIIDFSKSEIANRDSEKQKLFLETEKAKGQ
FT                   IEEYDGKIAEEEKRKLSLTNELNFRQASLDEVQKKISAIDEKFIGVRTRLVEVKAALEA
FT                   SRNLRNEKLREKDRILDAARRKQDEEQDASTEITSSRSRIEEARVESKNLEKDVAELQR
FT                   RSQALTADINDMEGARSRTRAEQHGIEEKLRKLQEEFAKAEARVRAYEDLDGYSEAVGT
FT                   IIGARNSHELPGIYGTIAELGKVDQEYATALEVAAGNRMQNIVVDNDEDAARCIYYLKG
FT                   QRKGTATFLPLNKMRQRVQLRNIREPGVIDYAINLVQFDGRFDPAFWYVFGDTLVVDTL
FT                   ETARRLIGTGRMVTLDGDLVEKSGAMTGGYRSRTKLKFKASEEEHIKELAEQITILESS
FT                   RDSVLKKVESIDGHIYGLKKDRSDMETQASKLTARKEELAGRLTRLEAVIKEKEASIES
FT                   LREDRRKLRDELIAAEEAISKADSEITTIGAEAGKLEEELKGSEVPALTEESGRIEDEM
FT                   KRLDGRLRDTESAIASLKIEQNYVRARVEENKGRGEKVDENIASLREKISQNEAAIGEF
FT                   NGKIEDLTKREKAIESELAGMKKQRDEMSDALTAADHDLYDARRSLERLTGMLNSLEIA
FT                   REESLDKIKVFEKVVQERGVMPSEDVPPVDKVRASISQLEKKMQALEPVNMLSITEYDG
FT                   VQARLAELTGKRDTLQKERENILEKIEHYKTMKMETFLTTFNAINEQFKVIFNELSDGF
FT                   GELVLESPEDPFSGGLTIRAQPYGKSLYRLEAMSGGEKSLTALAFIFAIQRYKPAPFYA
FT                   FDEIDMFLDGANAERVARMIKKLSTNAQFIVVSLRKPMIESANRTIGIAMQENNISSIT
FT                   GVKLRAD"
     atgcacatca aagagatcga gcttaacaat ttcaaatcgt tcggccgtaa ggccaaaata        60
     cccttctttg acgactttac caccatcagc ggccccaacg gctccggtaa aagcaacgtc       120
     atcgatagca tactcttttg cctgggcctg tcgaactccc gctctatgag ggccgaaaag       180
     ctgacggacc tcatctacag cgtgaacggc aagagccccg ggtccgcgga cgtcaccatc       240
     cggttcgata acacggaccg ggagatgccc atcgaccagg acgaggtcac gataacgaga       300
     cgcatcaagt ccagcgacag cggctactac tcatactatt actttaacga gaagcccgtc       360
     tccctctcgg agatccacga gcacctcttg aaggcgaaaa tatcccccga cggctataac       420
     gtggtaatgc agggggacgt tacgcgcatc atcgaggtga gtaacttcga gcgccgcaag       480
     atgatcgacg agatcgccgg cacggcggag tttgacgaaa agaccgacaa agcattgtca       540
     gagctggata tcgtacgtga ccggatcgac cgggtcgcca taattatttc cgaagtcgag       600
     gcccgcctcg cccagctaaa ggacgagcgc gaccacgcgc tcctgtacca gtcgtacagg       660
     gacgagaagg tcaagaacga aggttatctt gttttgtccg agctgaagga agctcagcag       720
     ctgctcgatt ctctgctcga ggacatcagg gacaagaccg ataagagggc cgcgataacg       780
     gcagacgttg agaagaaaag cgcggccgta caaaagctca aggacgacat caaggcgctc       840
     aacgccacca taacggaaaa gggcgagggc gagcagatac tcatccgcag gcagatcgag       900
     gaggcccgcg ccgggatcaa ggcctgcatc agcatcatcg atttctcgaa gtccgagatc       960
     gcgaacagag actcggagaa gcaaaagctc ttcctggaga cggaaaaggc gaagggccag      1020
     atcgaggagt acgacggcaa gatcgccgaa gaggagaagc gcaagcttag cctcactaac      1080
     gagctgaact tccgccaggc cagcctggac gaggtgcaga agaaaatatc ggccatcgac      1140
     gagaagttca tcggcgtgcg gacccggctc gtcgaggtga aggcggccct ggaggcctcc      1200
     cggaatctgc ggaacgagaa attacgtgaa aaggaccgta tcctggacgc ggcccgccgc      1260
     aagcaggacg aggagcagga cgcctcgact gaaattacat cgagccggag ccgcatcgag      1320
     gaggcccggg tcgagtcgaa gaacctggag aaggacgttg ccgagctgca gcgccgcagc      1380
     caggccctga cggccgacat caacgacatg gaaggggccc ggtcgaggac gagggcagag      1440
     cagcacggca tcgaggagaa gctgcgcaag ctgcaggaag agttcgcgaa ggccgaggcc      1500
     agggtcaggg cttacgagga cctggacggg tacagcgagg ccgtcgggac catcatcggc      1560
     gcccggaact cgcacgaatt accgggcatc tacggcacca tcgccgaatt aggcaaggtc      1620
     gaccaggagt atgcgaccgc gctcgaagtg gctgcgggca atcgcatgca gaacatcgtg      1680
     gtggacaacg acgaggacgc cgcccggtgc atttactact taaaaggcca gcggaagggc      1740
     acggccacgt tcctgccgct caacaagatg cgccagcggg tccagctgcg caatatcagg      1800
     gagcctggcg tcatcgacta tgccattaac ctcgtacagt tcgacgggag gttcgacccg      1860
     gccttctggt acgtgttcgg cgacaccctg gtcgtggaca cgctggagac cgcccgccgc      1920
     ctcatcggca ccggcaggat ggtcacgctg gacggcgatc tcgtcgagaa gagcggcgcc      1980
     atgaccggcg gctaccgctc ccgcacgaag ctcaagttca aggcctccga agaggaacac      2040
     atcaaggaat tagccgagca gatcacgata ctggagtcga gccgcgactc agtcctcaag      2100
     aaggtcgagt ccatcgacgg ccacatctac ggcctcaaga aggaccggtc ggacatggag      2160
     acgcaggcct cgaagctcac ggcccgtaag gaggagctgg ccgggcgtct tacccggctg      2220
     gaagccgtta tcaaggagaa ggaggcctct atcgagtctc tccgggaaga ccgcaggaag      2280
     ctcagggacg agctcatagc cgccgaggag gccatatcga aggcggacag cgagatcacc      2340
     acgatcggcg ccgaagccgg caagctcgaa gaggagctaa agggctccga ggtacccgcc      2400
     cttacggaag agtcggggcg catcgaggat gagatgaagc gcctcgacgg gcggctcagg      2460
     gacacggaat cggccatcgc gtcattaaaa attgaacaga actacgtgag ggcccgcgtc      2520
     gaggagaaca agggcagggg cgagaaggtc gacgagaaca tcgcctcgct gagggagaag      2580
     atctcgcaga acgaggcggc catcggcgag ttcaacggga agatcgagga tctcacgaaa      2640
     cgcgagaagg ccatcgagtc ggagctcgcc gggatgaaaa agcagcgcga cgagatgtcc      2700
     gacgccctga cggcggccga tcacgacctg tacgacgccc gccgctcact ggaaaggctc      2760
     acgggcatgc tcaactcgct cgaaatagcg agagaggaga gcctggacaa gatcaaggtg      2820
     ttcgagaagg tggtgcagga gcggggcgtt atgccgtccg aggacgtgcc gccggtcgat      2880
     aaggtccggg ccagcatatc ccagctcgaa aagaagatgc aggcgctgga gccggtcaac      2940
     atgctctcca tcacggagta cgacggcgtc caggccaggc tggccgagct cacgggcaag      3000
     agggacacgc tgcaaaagga aagagagaac atcctggaga agatcgagca ctataagacc      3060
     atgaagatgg agacgttcct cactacgttc aacgccatca acgagcagtt caaggtgatt      3120
     ttcaacgagc tgtccgacgg gttcggcgag ctggtcctgg agagcccgga ggacccgttc      3180
     tccggcggcc tgaccatccg cgcccagccc tacggcaagt cgttgtatcg gctggaagcc      3240
     atgtcgggag gagaaaagag ccttactgct ttagctttca tatttgccat ccagcgctac      3300
     aagccagcgc cgttctacgc gttcgacgag atcgacatgt tcctggacgg cgccaacgct      3360
     gaaagagtcg caagaatgat aaagaaatta tccacgaatg cgcagttcat agtcgtctcc      3420
     ctgaggaagc ccatgatcga gtcggccaac cgcaccatcg gcatcgccat gcaggaaaat      3480
     aacatctcga gcatcacggg ggtgaagctc cgtgcagact ga                         3522
//

If you have problems or comments...

PBIL Back to PBIL home page