(data stored in ACNUC10043 zone)

EMBL: AP011532.PE648

AP011532.PE648       Location/Qualifiers
FT   CDS_pept        630914..631741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60720"
FT                   /db_xref="GOA:D1YW98"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW98"
FT                   /protein_id="BAI60720.1"
FT                   /translation="MTLRDTLVGLGYAIAYRAALLFFSLSKLPVAGRLFEAPVAARRFT
FT                   VVTVPMNAKLRETSAILPFDMIRQLVDSAAYVAIADNCVCREAHNCKDYPASPGCVYLG
FT                   DGARSIKYRTRQATKQEALEWLERARSLGLVTNVVWSSVEFEAIGANPSRTVEICSCCP
FT                   CCCLMFKTRDASKAYLDNILGFGTARVTSADSCTRCTNCEAACPFKAIKVDMHEGPAVD
FT                   MTRCKGCGRCVDACRAGVLKVFPDEDPAAITDTCDHSTPNARDLVERFLGMVK"
     atgacactgc gcgatacgct ggtcggcctg ggttatgcta tagcgtatcg tgcggctcta        60
     ctcttcttca gcctctcgaa gctgcccgtc gcgggcaggc ttttcgaggc cccggtcgcc       120
     gcccggcggt tcacggtcgt gacggtgccc atgaacgcga agctccggga gacgtcggcc       180
     atactaccct tcgacatgat aaggcagctg gtcgattcag cagcttacgt ggcgatcgcc       240
     gataactgcg tctgcaggga ggcgcacaac tgcaaggact acccggccag ccccggctgc       300
     gtgtacctgg gcgatggggc ccggtccatt aaataccgga caaggcaggc gacgaaacag       360
     gaggccctgg agtggctcga aagggcccgg tccctgggtc tcgtcaccaa cgtggtctgg       420
     tcgtccgtcg agttcgaggc catcggcgcg aacccgtccc gcacggtgga gatatgctcc       480
     tgctgcccgt gctgctgcct gatgttcaag acgagggacg cctctaaggc gtacctggac       540
     aatatcctgg gtttcggcac ggcccgcgtc acgagcgccg actcctgcac ccgctgcacg       600
     aactgcgagg ccgcctgtcc cttcaaggcg ataaaggtgg atatgcacga gggcccggcg       660
     gtcgatatga cacgctgcaa aggatgcggc cggtgcgtgg acgcctgccg tgccggagtg       720
     ttgaaagtat ttccggatga agatcccgcc gccattaccg atacatgcga ccatagcacg       780
     ccgaatgccc gcgatcttgt ggagcgcttc ctcggcatgg tcaaataa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page