(data stored in ACNUC10043 zone)

EMBL: AP011532.PE662

AP011532.PE662       Location/Qualifiers
FT   CDS_pept        complement(646294..647124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60734"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB2"
FT                   /protein_id="BAI60734.1"
FT                   /translation="MLKRDPLGGYMGIYEHDGEKIAYHVEGEGRPVLMTMGLSARGGSY
FT                   DWRFIFDCLAGTFKVYALDVLGLEDERPRLSYGTGHYQKLVEGFMESVVGERMSIISGP
FT                   IDAQYALKAAFEHTSLVEKILIVSPDGVRRIATHDTIGRSVTYRILRIPKIESVMYGNI
FT                   SSKRSMLIFLRKVYGRLEEKKARPLIESRMRQKYPPLSTLSERRFMEYSWSRSLMQAPM
FT                   RLSKMIRKSRRIVGEMDDFRILRNSRLIVFQRSGELPMRKDALRFCDDAIKFLG"
     atgctgaaaa gggaccctct cggcggctat atgggcatat acgagcacga cggggaaaag        60
     atcgcctatc acgtggaagg cgaaggcagg ccggtgctca tgaccatggg actatcggcc       120
     agaggaggct cttatgactg gcgctttatc ttcgactgcc tggcgggcac attcaaggta       180
     tatgcgctcg acgtcctcgg gctggaggac gaaagacccc ggctcagcta tgggacgggc       240
     cattatcaga aactggtcga gggcttcatg gagtccgtag tcggcgagag gatgtccatc       300
     atatcggggc ccatcgacgc gcagtacgcg ctgaaggcgg cattcgagca cacgagcctc       360
     gtcgagaaga tcctcatcgt cagcccggac ggggtgaggc gtatcgccac ccacgacacg       420
     attggccgct ccgtcacata tcgcatactt cgcataccca agatcgagag cgtcatgtac       480
     ggcaatatat cctctaagcg gagcatgctc attttcttaa ggaaggtcta tgggcggctc       540
     gaggagaaaa aggcccggcc gctcatagag agccgcatga ggcaaaaata tccgccgctt       600
     tcgacgctct cggagcgcag gttcatggaa tactcctgga gccggtcact gatgcaggcg       660
     cccatgaggc tctcgaaaat gatccggaag tcgaggcgca tcgtgggcga gatggatgac       720
     ttccgcattc tcaggaattc caggctcatc gtcttccaga ggtcagggga gctgcccatg       780
     aggaaggacg ccctgcggtt ctgcgacgac gccatcaagt tcctcggcta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page