(data stored in ACNUC10043 zone)

EMBL: AP011532.PE665

AP011532.PE665       Location/Qualifiers
FT   CDS_pept        650478..650780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60737"
FT                   /db_xref="GOA:D1YWB5"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB5"
FT                   /protein_id="BAI60737.1"
FT                   /translation="MDGMVTYIGLLVISLAAGVAAGLVRGKFSDSQKKYVSAAITCLVF
FT                   LLILLMGLKTGSNEAVISNLGLYGLQALLITVGAVLGSIAFAILFERLFFRDGVR"
     atggacggga tggtcactta catagggctg cttgttattt cgcttgccgc gggcgtagct        60
     gccggcctgg tccggggcaa gttctccgat agccagaaaa agtacgtatc ggcggcaata       120
     acgtgcctcg tgttcctgct catcctcctc atgggcctga agacgggctc gaacgaggcc       180
     gtcatctcga acctgggcct ttacggccta caggcgctgc tcatcacggt gggcgccgtc       240
     cttggcagca tcgccttcgc gatcctcttc gagaggctgt ttttcaggga cggtgtccgg       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page