(data stored in ACNUC10043 zone)

EMBL: AP011532.PE671

AP011532.PE671       Location/Qualifiers
FT   CDS_pept        complement(655209..656000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0671"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF81
FT                   family (IPR002781)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60743"
FT                   /db_xref="GOA:D1YWC1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC1"
FT                   /protein_id="BAI60743.1"
FT                   /translation="MELGLSLALFFITGIISGLFGGMLGIGGATILVPALTLIFGLPVY
FT                   LAIGVSLLNNVAVSTSATMRYKKRGLLNRRVILVMNLGSILGIIIGTFIATRSPEAAIK
FT                   VFFGAFLLFMVANGLLRRNAVDSVGMVELTPKTEVGLSGLGFVMGLLGALLGLGGGTVA
FT                   VPTLNNVFKMPLKQAIANSLATVILASALGAVIYFYLSAGALFSAEEALLTAFTIVPGS
FT                   IIGASLGARISERIDTKYIKYIFYAMLLYIAYNMIKSGLGW"
     atggaactag ggctcagcct ggcattgttc tttatcacgg gcattatctc cggcctcttc        60
     ggcggcatgc tgggcatcgg cggcgcgacc attctcgtgc ccgccctcac gctcatcttc       120
     ggcctccccg tgtacctggc catcggcgta tcgctcctga acaacgtggc cgtttccact       180
     tctgcaacga tgcgctacaa gaagcggggc ctgctcaacc ggagggtcat cctggtcatg       240
     aacctgggct ccatactggg cattatcatc ggcacgttca tcgccacgag aagcccggag       300
     gcggcgatca aagtcttttt cggcgccttt ctgctgttca tggtagcgaa cgggctgctg       360
     cgaagaaatg ccgtcgactc cgtcgggatg gtggagctca cgccgaagac cgaggtgggc       420
     ctctcggggc ttggcttcgt catggggctc ctcggcgcgc tcctggggct gggcggaggc       480
     accgtggcag tgcccacgct taacaatgtt ttcaaaatgc cgctgaagca ggccatcgcc       540
     aactcgctcg ccaccgtcat cctggcctcg gccctcggcg ccgtcatcta tttttacctc       600
     agcgcgggcg ccctgttctc cgcagaggag gccctgttga ccgcgttcac catcgtccct       660
     ggctctatca taggtgcctc tttaggcgcc cggatctcgg agcgcatcga cacgaaatac       720
     attaaatata tcttttacgc catgctactg tacatcgcct ataacatgat caagagcggc       780
     ctggggtggt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page