(data stored in ACNUC10043 zone)

EMBL: AP011532.PE684

AP011532.PE684       Location/Qualifiers
FT   CDS_pept        complement(665089..665850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0684"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60756"
FT                   /db_xref="GOA:D1YWD4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD4"
FT                   /protein_id="BAI60756.1"
FT                   /translation="MLSLQMLVEQLKRSFSIARKDIKIYYLKGPVITFGLIFPFFLIVA
FT                   YTLGRNVPIKDLYPGIMGMTVFFTATSVGPAIMPWEVRSQTFERLVSMPVALWAMLFGD
FT                   IQASFYFGLVISLLTAMIAPLIGVSILHVMVFGLALLLATLCFAALSVLLSAYPPTDTP
FT                   GNTMMLASMIKFPLVFISGVFLPIGQMPEWGRLVAYFSPLTYYTDLVRYTTDGISYFPI
FT                   LVDFTAIAVFTLIFIVAAIKIHEKVLTQRLT"
     atgctttccc ttcaaatgct cgtggaacag ttaaagcggt ctttctcaat agcccggaag        60
     gacataaaga tctattacct gaaagggccc gtgatcacct tcgggctgat attcccgttc       120
     ttcctgatcg ttgcctacac gctggggagg aacgttccca taaaagacct ttaccctggc       180
     attatgggca tgacagtgtt cttcaccgca acgtcggtgg gtccggccat catgccctgg       240
     gaggtgcgct cccagacctt cgagcgattg gtgtccatgc ctgtcgcatt gtgggcaatg       300
     cttttcgggg atatacaggc atcgttctac ttcggcctgg tgatatccct gctgacggcg       360
     atgatcgccc cccttatagg agtctccata ctgcacgtca tggtgttcgg gctcgccctc       420
     ctgctcgcga ccctgtgctt tgccgcgttg agcgtcctgc tctccgcata tccgccgacg       480
     gacacgccgg gcaacacgat gatgctggcc tcgatgatca agttcccgct ggtgttcatc       540
     agcggcgtat tcctgccgat cgggcaaatg ccggaatggg gccggctggt cgcgtatttt       600
     tcgccactaa catactacac ggatctggtg aggtacacga ccgacggcat cagctacttc       660
     ccgatcctgg tggatttcac ggcgatagcg gtctttacgc tcatcttcat agtcgccgct       720
     ataaagatcc acgaaaaagt gctgacgcag agactgacct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page