(data stored in ACNUC10043 zone)

EMBL: AP011532.PE716

AP011532.PE716       Location/Qualifiers
FT   CDS_pept        692833..693255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60788"
FT                   /db_xref="GOA:D1YWG6"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG6"
FT                   /protein_id="BAI60788.1"
FT                   /translation="MTGKLTDSLPLALSGLVIAGILVAFIASVMLPSRGIEASYGAADN
FT                   GKEISIGEGTTFKIILDENPTTGYSWNTTVTSGLRVENSEFIQGGNAGLAGAGGTHEWT
FT                   IKATGKGEQQFTAIYKRPWEPTTGSESAFTLKILVN"
     atgactggaa aactgaccga ttcgttgccg ctggccctgt ccgggctggt catcgccggt        60
     attctcgtcg ctttcattgc gagcgttatg ctgccgtccc ggggcatcga ggcctcgtac       120
     ggcgcagcgg ataatggtaa ggaaatctct ataggcgaag gcacgacttt caagatcatc       180
     ctggacgaga acccgaccac ggggtactcg tggaacacga ccgtgacgtc gggcctgagg       240
     gtagagaaca gcgaattcat acagggcggt aatgccgggc tggcaggcgc cgggggcact       300
     cacgagtgga ccatcaaggc gaccggcaag ggcgagcagc aattcacggc catatacaag       360
     cgcccctggg agcccacgac cggcagcgag agcgccttca cgctcaagat actggtaaat       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page