(data stored in ACNUC10043 zone)

EMBL: AP011532.PE741

AP011532.PE741       Location/Qualifiers
FT   CDS_pept        712905..713249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0741"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60813"
FT                   /db_xref="GOA:D1YWJ1"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ1"
FT                   /protein_id="BAI60813.1"
FT                   /translation="MSWVESISSYIGASLPPGRVQPMYGVPIVKYGPPPSPVPYEPGST
FT                   GLPVSGMPDFDWARIWQPPAFSMPDFGHLGLSFPKLIAGIALVAYVALMAMAVLGLALR
FT                   GGTWYLKNRK"
     atgtcgtggg tggagagtat cagcagctat attggcgcaa gcctgccccc ggggagggtg        60
     cagccgatgt atggcgtgcc catcgtaaaa tacggcccgc ctccgtcccc cgtgccatat       120
     gaacccggct ctacgggcct gccagtatcc ggaatgccgg atttcgactg ggcccggata       180
     tggcagccgc cggcgttcag catgccggac ttcgggcacc tgggcctgtc ctttccaaag       240
     ctgatcgcag gcatcgccct cgtggcctac gttgcgctga tggccatggc cgtcctcggc       300
     ctggcactgc gcgggggcac atggtacctg aaaaacagga aatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page