(data stored in ACNUC10043 zone)

EMBL: AP011532.PE75

AP011532.PE75        Location/Qualifiers
FT   CDS_pept        complement(66622..67572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two Protein of unknown function DUF6,
FT                   transmembrane domains (IPR000620)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60147"
FT                   /db_xref="GOA:D1YUM5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM5"
FT                   /protein_id="BAI60147.1"
FT                   /translation="MLKNADLRDNAFFVMAGLILVNVFWGASSIAAREALLQLSSIEIV
FT                   TIRFTIALFIVFGMAIAMKKWDALRIHPKDIPTFILLSLSNVSIGFILQVESLNYTTVT
FT                   NFSLEFNLATFFIMLMGALLLGERLTRTKLAGAGIAFAGAFLIISGGRLDLSSAHLLGD
FT                   LMGVGSAIAFGIFTIASKKVSSKYSLTTILLYTFFFGVLELLPFYAFVTPMTPLASLSP
FT                   LSWSSLLFLAVLCSVFCFFVYTHGLSRLKASDVAMSIYVTPLAGILLAVLLLGETLTAV
FT                   TAVGAGLIMAGMYLTQRELEPDVPEKRYTPVALNE"
     atgctcaaaa acgccgatct cagggacaat gcctttttcg tgatggccgg cctcatcctg        60
     gtcaacgtgt tctggggcgc ctcgtccatc gcagccaggg aggcattatt acagttaagc       120
     tccatcgaga tcgtgaccat acggttcacc atcgccctct ttatcgtctt cggcatggct       180
     atcgccatga aaaagtggga tgccctcagg atccacccga aggacattcc cacgttcatc       240
     cttctctccc tgtccaacgt ctccatcggc ttcatcctcc aggtggagtc gcttaactac       300
     acgaccgtga ccaacttctc gctcgagttc aacctggcca cgttcttcat catgctcatg       360
     ggcgcgctgt tactgggcga gcgcctcacc cggacgaagc tcgcgggggc gggcatcgcg       420
     ttcgccgggg cattcctcat aatcagcgga ggccgcctcg acctctcgtc agcgcacctg       480
     ctgggggacc tcatgggcgt gggcagcgcc atcgccttcg ggatcttcac catcgcctcc       540
     aagaaggtct cctcgaagta cagcctcacc acgatactgc tctacacgtt cttcttcggc       600
     gtcctggagc tcctgccatt ctacgcgttc gttaccccga tgacgcccct ggccagcctg       660
     agcccgctct catggtcgtc gctgctattt ttagcggtgc tgtgctcggt gttctgcttc       720
     ttcgtgtaca cgcacggcct cagccggctc aaggcctcgg acgtggccat gtccatctac       780
     gtgacgcccc tggccgggat actgcttgcc gtacttttat taggagagac gctgacggcc       840
     gtgacggccg tcggggccgg gctcatcatg gcgggcatgt acctgaccca gcgggagctc       900
     gagcccgatg tgcccgagaa gcgatacacg ccggtcgccc tgaacgaata g                951
//

If you have problems or comments...

PBIL Back to PBIL home page