(data stored in ACNUC10043 zone)

EMBL: AP011532.PE76

AP011532.PE76        Location/Qualifiers
FT   CDS_pept        67755..68267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60148"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM6"
FT                   /protein_id="BAI60148.1"
FT                   /translation="MKLRNIVVPVLIGLFLASAALLTASAQYARPASDQILVNQPYGSM
FT                   QDNILPPASFEQQQYPFAASPLAAPYGALEAPPVAPCAAPLAAPCAAPVATYGPFTSGF
FT                   TYSATRSSAFGPFAPPVAEATEQFYQYPGISPYGAYPGAGYAAASGVGFDPATGYYGPY
FT                   GAYTPLI"
     atgaaattga gaaatatcgt cgttcctgta ctcatagggc tctttctcgc aagcgcggca        60
     ttgcttaccg cgagcgccca gtatgcccgg cctgcaagcg accagatact ggtcaatcag       120
     ccttacggct cgatgcagga taacatattg cctcctgcca gctttgagca gcagcagtac       180
     ccgttcgcgg cctcgcctct ggctgcgcct tacggcgccc tggaggcccc gcctgtagcg       240
     ccttgtgcag cgcccctggc agcgccgtgc gccgctccgg tcgccacata cgggccattt       300
     accagcggct tcacgtatag cgccacccgg tcctcggcct tcggcccgtt cgcgccgccc       360
     gtggccgagg ccaccgagca gttctaccag tacccgggca tttcgcctta cggcgcctac       420
     cctggtgcag gatatgcagc tgccagcggc gttggctttg acccggcgac gggatattac       480
     gggccatacg gcgcgtacac gccactaata tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page