(data stored in ACNUC10043 zone)

EMBL: AP011532.PE77

AP011532.PE77        Location/Qualifiers
FT   CDS_pept        complement(68294..68884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60149"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM7"
FT                   /protein_id="BAI60149.1"
FT                   /translation="MEADINDNARSLESGGVTSLKPCLAQVDDSGIGSPVGGAAIGVLD
FT                   TGTGVFKYKLVGVEYFQDGYKNEYQDRVVEIIRELFAEMGITRDVYRIEICSGHIFDHV
FT                   RPWMDEAGYEWKSVKIIDPLQSLIENAFSDFLISLGVPERIRTIEVGRDQFMYLFNWVK
FT                   QDPERRVKYCKTNGSKWKTKWSHKLYDRQSRYH"
     gtggaagcgg acattaacga taacgcacgg agcctcgaat cgggcggcgt cacgagcctc        60
     aagccatgcc tggcgcaggt cgacgacagc ggcatcggct ctcccgtcgg cggcgccgca       120
     ataggcgtcc tcgatacggg cacgggcgtg ttcaagtata agctcgtggg cgtcgagtac       180
     ttccaggacg gctacaagaa cgagtaccag gacagggtcg tcgagatcat ccgggagctg       240
     ttcgccgaga tgggcatcac ccgcgacgtc taccgcatcg agatatgctc cggccacata       300
     ttcgaccacg tcaggccctg gatggacgag gccgggtacg agtggaagtc cgtcaagatc       360
     atcgacccgc ttcaaagctt aattgagaac gcgttcagcg atttccttat tagtctgggc       420
     gtgcccgagc gcatccggac catcgaggtg ggccgggacc agttcatgta cctctttaac       480
     tgggtgaagc aggacccgga gcgccgcgtg aagtactgta agacgaacgg cagtaagtgg       540
     aagacgaagt ggtctcataa gctgtatgat agacagtccc gctatcattg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page