(data stored in ACNUC10043 zone)

EMBL: AP011532.PE79

AP011532.PE79        Location/Qualifiers
FT   CDS_pept        69763..70689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function DUF362
FT                   domain (IPR007160)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60151"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM9"
FT                   /protein_id="BAI60151.1"
FT                   /translation="MSRRSFLKAAVAAAAVAVTGCVSASEPSITPVPSIIPSPTSTATQ
FT                   SRLVVTTDPDPARLVDRALDAFGALPIKKDDRVFVKANFSFSRTVDQAASNHPQVLVRL
FT                   MERCREAGASEVIAFDHTIDSSKLCLERSGIKAAVEKAGFTAIAVNSSSEYEERQIDGP
FT                   TLKKTRIARILKDADVLINAPVVKSHGNTRLTAGMKNLMGVIDNRGAFHSSDLDGCIAD
FT                   LSYVIRPTLTVADAYRVLKSGGPNGGSPEDITHPQQLIVGYDPVAVDSYAATLLGLTGN
FT                   DIEHVVRAYQRGLGEIDLGKVNVQKVV"
     atgagcaggc gcagcttcct gaaggccgcc gtcgccgcgg ccgccgtcgc cgtcaccggc        60
     tgcgtgagcg cgagcgagcc ttcgatcacg ccagtcccat cgatcattcc atcgccgact       120
     tcgaccgcaa cacagagccg gctggtcgtg accaccgacc ccgaccccgc caggctggtc       180
     gacagggcgc tggacgcctt cggcgcgctc cctataaaaa aggacgaccg cgtattcgtc       240
     aaggccaact tctccttctc aaggacggtc gaccaggcgg catcgaacca ccctcaggtg       300
     ctggtacgcc tgatggagcg ctgcagggag gcgggagcct ccgaggtcat agccttcgac       360
     cacaccatcg acagctcgaa gctctgcctg gagcggagcg gcattaaggc cgccgtcgaa       420
     aaggccggct tcacggccat cgctgtaaac agcagcagcg agtatgagga aaggcagatc       480
     gacgggccca cgctgaagaa gacccggata gcgagaatcc tcaaggatgc ggacgtgctc       540
     atcaacgcgc ccgtggtcaa gagccatggc aatacccgcc tcacggcggg catgaagaac       600
     ctcatgggcg tcatcgataa ccgcggggcg ttccacagca gcgacctgga tggctgcatc       660
     gccgacctct catacgtcat ccggcccacg ctcacagtgg ccgacgccta ccgggtgctc       720
     aagtccgggg gtcccaacgg ggggagcccg gaggacataa cgcatcccca gcagcttatc       780
     gtgggatacg atcccgtggc ggtggactcc tacgcggcca cactactggg gctgaccggt       840
     aacgacatcg agcatgtggt cagggcgtat cagcggggcc tgggcgagat cgacctgggc       900
     aaggtcaacg tgcaaaaggt ggtctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page