(data stored in ACNUC10043 zone)

EMBL: AP011532.PE92

AP011532.PE92        Location/Qualifiers
FT   CDS_pept        complement(82630..83109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60164"
FT                   /db_xref="GOA:D1YUP2"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP2"
FT                   /protein_id="BAI60164.1"
FT                   /translation="MNNKLVLIIGVVVIIGLIIGLCYYKFDNNFVTNNNSTINTITPIP
FT                   TENPVENDTLTILPNDYVINNINWTQYPNLQQGYIYKVYIAGPTDTVPYKFMEVQILTE
FT                   VKDTNDRELIRSQLSGVAYEVRKIYGPNSDIHILGTKNGAATWDISLYPNQNDAH"
     atgaataata aattagtatt aattataggc gtagtagtaa ttattggttt aattatcggt        60
     ttatgctatt ataaatttga taataatttt gtaactaata ataactcaac aatcaatact       120
     attacaccta tacctacaga gaatcctgtt gaaaatgata ccctgacgat tctaccaaat       180
     gactatgtaa taaataacat aaattggaca caatatccaa atcttcaaca aggttatatt       240
     tataaagtat atattgccgg gccaactgat actgttcctt ataaatttat ggaagtgcaa       300
     atactaactg aagtaaaaga tacaaatgat agagaattaa tccgttctca attatccggt       360
     gttgcatacg aagttaggaa aatatatggg ccaaattcag atatccacat tcttggcaca       420
     aaaaatggtg ctgctacttg ggatataagt ttatatccaa atcaaaatga tgctcattaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page