(data stored in ACNUC10043 zone)

EMBL: AP011532.PE97

AP011532.PE97        Location/Qualifiers
FT   CDS_pept        complement(86521..87009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CMP/dCMP deaminase, zinc-binding domain
FT                   (IPR002125)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60169"
FT                   /db_xref="GOA:D1YUP7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP7"
FT                   /protein_id="BAI60169.1"
FT                   /translation="MNHERPTHDEYFMEIANVVAKRSTCLRIHVGAVIVKGGQILSTGY
FT                   NGAPHGFEHCLDIGCIREKENVAHGTRHELCRAVHAEQNAIIQAAIHGVSIEGATVYCT
FT                   HQPCILCTKMIINCKINRVVFQNGYPDEMSLKFLKQAGIDVLRMPSKEEPPEERPLSV"
     atgaaccacg agaggcccac ccacgacgag tacttcatgg agatcgccaa cgtagtggcc        60
     aagcggtcta cctgcctgcg catccacgtg ggcgcagtca ttgtgaaagg cggccagatc       120
     ctctccacgg gctacaacgg cgccccccac gggttcgagc actgcctgga catcgggtgc       180
     atccgggaga aggagaacgt cgcccacggc acccgccacg agctgtgcag ggccgtccac       240
     gcggagcaga acgccatcat ccaggccgcc atccacggcg tgtccatcga gggcgccacc       300
     gtttactgca cccaccagcc atgcatcctc tgcaccaaga tgatcatcaa ctgcaaaatt       360
     aatagggtcg tgttccagaa cggttacccg gacgagatgt cgcttaaatt tttaaagcag       420
     gccggcatcg atgtcctgcg gatgccctcg aaagaggagc cccctgagga aaggccccta       480
     agcgtctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page