(data stored in ACNUC10043 zone)

EMBL: AP011532.PHOU-1

AP011532.PHOU-1      Location/Qualifiers
FT   CDS_pept        complement(672894..673571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU-1"
FT                   /locus_tag="MCP_0695"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60767"
FT                   /db_xref="GOA:D1YWE5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE5"
FT                   /protein_id="BAI60767.1"
FT                   /translation="MATVVSSRVDGIKADVLLMMGYVGLSIDEAVRSLDDRDVDTAKCV
FT                   IGRDRQINEYLRRIEAECLDMLAKKLEGEELRTVAASYKLVSDVERIGDYCTAIANVTL
FT                   AVANKPVTTTALDIIKMGRTALQMLNICMEAYKGRSEVNVEEVFDLDKSIDNLYNDSFV
FT                   GSITSILREPNTITNVIYLTMASRALERIGDHLTDIAERIIFIRSGKIVERSEPMHVPE
FT                   FPE"
     atggctacgg tagtcagcag ccgtgtggat ggtataaagg cggatgtatt gctcatgatg        60
     ggctacgtcg gcctgtcgat cgatgaggcc gtgcggtcgc tggacgaccg ggatgtggac       120
     acggccaagt gcgtcatcgg cagggacagg cagattaacg agtacctgag gcggatcgag       180
     gctgaatgcc tggacatgct ggcgaaaaag ctggagggcg aggagctcag gaccgtcgcg       240
     gcatcgtaca agctggtgag cgacgtcgag cggatcggcg actattgtac ggccatcgcc       300
     aacgtgacgc tggccgtcgc gaacaagccg gtcacgacaa cagctctgga catcattaaa       360
     atgggaagga cggcgctcca gatgctgaat atctgtatgg aggcctacaa agggagatct       420
     gaagtaaacg tcgaagaggt attcgacctc gataagtcga tagacaacct ttataacgat       480
     tcctttgtcg gctctatcac atccattttg cgggagccga acaccatcac gaatgtcatc       540
     tatctcacga tggcctcccg ggcgctcgag aggatcggag accacctgac cgatattgct       600
     gagcggatca ttttcatccg gtccggaaag atcgtcgagc gcagcgagcc catgcacgtc       660
     cccgagttcc ccgagtga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page