(data stored in ACNUC10043 zone)

EMBL: AP011532.PURE

AP011532.PURE        Location/Qualifiers
FT   CDS_pept        119927..120316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="MCP_0125"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60197"
FT                   /db_xref="GOA:D1YUS5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS5"
FT                   /protein_id="BAI60197.1"
FT                   /translation="MADVAVILGSASDRAIADRAVEVLSKNNISFDLQVLSAHRNPDEL
FT                   DVYVKRSDAKVYITIAGLSAALPGVVASKTSRPVIGVPVSAKLGGLDALLSIVQMPKGV
FT                   PVACVGIDNGDNAAHLAIRILGVGQ"
     atggcagatg tggcagtcat cctcggctcc gcctcggacc gcgccatcgc ggacagggcg        60
     gtcgaggttt tatcgaagaa taacatctct tttgacctgc aggtcttatc ggctcaccgc       120
     aacccggacg agctggacgt gtacgtgaag cggagcgacg ctaaggtgta tatcaccatc       180
     gccggcctct cggccgccct tccgggcgtc gtggcgtcga agacctcccg gcccgtcatc       240
     ggcgtgcccg tatcggcgaa gctgggcggc ctggacgcgt tactatcgat cgtgcagatg       300
     ccgaagggcg tccccgtggc ctgcgtgggc atcgacaacg gcgacaacgc cgcgcacctg       360
     gcgatacgga tcctcggggt gggacagtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page