(data stored in ACNUC10043 zone)

EMBL: AP011532.PYCB

AP011532.PYCB        Location/Qualifiers
FT   CDS_pept        175963..177705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycB"
FT                   /locus_tag="MCP_0183"
FT                   /product="pyruvate carboxylase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60255"
FT                   /db_xref="GOA:D1YUY3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY3"
FT                   /protein_id="BAI60255.1"
FT                   /translation="MVRITETILRDAHQSLAATRMRTADMVPIIEKLDQVGFYSLEAWG
FT                   GATFDTCIRYLNEDPWERLRIIKKAAKTTPIQMLLRGQNLVGYRHYSDDVVEKFVTLAS
FT                   KNGVDIFRVFDAVNDIRNMEASIKAARKCGARVQGTICYTLSPVHSNDKFVEMAKELAA
FT                   LDCDSICIKDMAGLIMPEPAADLVSRLKKEVGLPVDLHCHCTNGIAPMSYYAAAGSGVD
FT                   ILDTAMSPFGFGTSQPATESIVGALQGTPYDTGLDLKLLAEIAEYFWKVKEKYGAIIDP
FT                   ILERIDVNVLVYQIPGGMLSNLVSQLKQQNKMELYDAVLKEVPVVRRELGYPPLVTPTS
FT                   QIVGTQAVLNVVMGERYKVVPKEVKDYVKGFYGRSPAPVDPEIQKKVIGDEQPITVRPA
FT                   DLLKPEMPGVIAAVNGLGLKNVKDEDYITYALYPPVAEKFLKGEIKPEALEPKAAPAKK
FT                   SKLGPSARRFLIEMDGQVKEIRIEALDAPLPPIGVAVTAQPQAEAVVEEASSNGAVTSP
FT                   MQGTILKVNVKVGDSVKKGDVIAVLEAMKMENDIVAHSSGTVKAVYAQKGKNVDANAVL
FT                   AVIE"
     atggtacgga taacggaaac gatcctgaga gacgcccacc agtccctggc ggcgacgagg        60
     atgaggaccg cggacatggt ccccatcatc gagaagctgg accaggtagg cttctactct       120
     ttagaggcat ggggcggcgc gaccttcgac acgtgcatac ggtacctcaa cgaggacccg       180
     tgggaacggc tgagaattat taaaaaggcc gcgaagacca ctccgatcca gatgctcctg       240
     aggggccaga acctcgtagg ataccggcac tactccgacg acgtcgtcga gaagttcgtc       300
     accctcgcat cgaagaacgg cgtggacatc tttagagtct tcgacgccgt gaacgacatc       360
     cggaacatgg aggcctccat caaggccgcc aggaagtgcg gcgcccgcgt ccagggcacg       420
     atctgctata cgctcagccc ggtccactcg aacgacaagt tcgtggagat ggcgaaggag       480
     cttgccgccc tggactgcga ttccatatgt atcaaggaca tggcggggct catcatgccc       540
     gagccggccg ccgacctggt gtcccggctc aagaaggagg tcgggcttcc ggtggatctg       600
     cactgccact gcaccaacgg catcgccccc atgagctatt acgcggccgc cgggtcggga       660
     gtcgacatac tcgacacggc catgtcgccc ttcgggttcg gcacctctca gcccgccacc       720
     gagtccatcg tgggcgccct gcagggcacg ccttacgaca cgggcctcga cttaaaacta       780
     ctggcggaga tcgccgagta cttctggaag gtcaaggaga agtatggagc catcatcgac       840
     cccatcctgg agaggatcga cgtcaacgtc ctggtatacc agataccggg aggaatgctc       900
     tccaacctcg tctcacaatt aaaacagcag aacaagatgg agctgtacga cgccgtgctg       960
     aaagaggtgc ccgtcgtgcg cagggaatta ggatacccgc cccttgtcac gccgacctcg      1020
     cagatcgtgg gcacccaggc ggtgctcaac gtggtcatgg gcgagcgcta caaggtcgtc      1080
     cccaaagagg tcaaggacta cgtgaagggc ttttacggca ggtcgcccgc gcccgtggac      1140
     cctgagatcc agaagaaggt catcggcgac gagcagccca tcaccgtccg ccccgcggac      1200
     ctcctgaaac ccgagatgcc cggcgtcata gccgccgtta acgggctagg cctcaagaat      1260
     gtgaaggacg aggactatat cacttatgcc ttatacccgc ccgtcgcgga gaagttcctg      1320
     aagggcgaga tcaagcccga ggcgctggag cccaaagcgg cgccggcgaa gaagtcgaag      1380
     ctcgggccca gcgcgaggcg cttcctgatc gagatggacg gccaggtcaa ggagatcagg      1440
     atcgaggcgc tggacgcgcc cctgccgccc attggcgtag ccgttactgc acagccgcag      1500
     gcggaggccg tggtcgagga ggcgtcgtcg aacggcgccg tgaccagccc catgcagggc      1560
     accatactga aggtcaacgt caaggtgggc gacagcgtga agaagggcga cgtcatcgcc      1620
     gtcctggagg ccatgaagat ggagaacgac atcgtggccc atagctccgg caccgtcaag      1680
     gccgtgtatg cccagaaggg caagaacgtg gacgcgaacg ccgtgctggc cgtcatcgag      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page