(data stored in ACNUC10043 zone)

EMBL: AP011532.QUEC

AP011532.QUEC        Location/Qualifiers
FT   CDS_pept        complement(676061..676747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="MCP_0700"
FT                   /product="archaeosine biosynthesis protein QueC"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60772"
FT                   /db_xref="GOA:D1YWF0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF0"
FT                   /protein_id="BAI60772.1"
FT                   /translation="MMGSIVLLSSGLDSAVAFKMALDAFGVDLALTFDYGQRAADMEIE
FT                   SAKMICERFGVRHEVIEAPWLEDVTLTALVNRGESVPTPSETELDEIKGKARETAHAVW
FT                   VPNRNGAFINIAACFADALKVDHIVCGFNAEEGATFPDNTPAFVEAINKSLYYSTENHA
FT                   KVIAPVIDMDKVEIIKKGMSIDAPLDLSWSCYVSGEKPCGKCESCVRRARAFKRAGVAD
FT                   PSLVVK"
     gtgatgggct ccatcgtgct tttgtcgagc ggacttgact ctgccgtggc ctttaagatg        60
     gcgctggacg cctttggcgt cgaccttgcg ctgacttttg actatgggca aagggcggct       120
     gacatggaaa tagagagcgc caaaatgatc tgtgagcgtt tcggggtccg gcatgaagtc       180
     atcgaggcgc cctggctgga agatgtgact ttgacagcgc tcgtcaaccg gggcgagtcg       240
     gttcccacgc ctagcgagac agagctggat gagataaaag ggaaagcgcg ggagacagcg       300
     catgccgtct gggtgcctaa caggaacgga gcgttcatca acatcgccgc ctgcttcgcc       360
     gacgccctga aggtggatca tatcgtctgc ggcttcaacg ccgaggaagg tgccactttc       420
     ccggataaca cgccggcctt cgtggaagcc atcaataaga gcctgtatta ttcgacggaa       480
     aatcatgcaa aagtaatcgc tcctgtcatc gatatggata aggtcgagat cataaaaaag       540
     ggcatgagca tcgacgcccc gctggacttg agctggagct gctacgtttc gggcgagaag       600
     ccctgtggaa agtgcgagag ctgcgtgcgc cgggcccgag ctttcaagcg ggccggtgtc       660
     gccgacccat cgctggtggt aaagtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page