(data stored in ACNUC10043 zone)

EMBL: AP011532.RFCL

AP011532.RFCL        Location/Qualifiers
FT   CDS_pept        complement(435698..437218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfcL"
FT                   /locus_tag="MCP_0435"
FT                   /product="replication factor C large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60507"
FT                   /db_xref="GOA:D1YVN5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR023935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN5"
FT                   /protein_id="BAI60507.1"
FT                   /translation="MSEERCMDWAEKYRPVSLSGVLGNDAAVKALRKWAETFGSGKKAA
FT                   ILYGGPGIGKTSAALALAHDMGWDYIEMNASDQRTKDAINKVAGSASKTGTFGGTNERR
FT                   LLILDEADNLHGNYDRGGEAAIINVIKNTNQPIILIANDFYALSKPLRDAAEPIQFRAL
FT                   LSTSIVKALKKICAAENIKCQPEALMKIAERTNDMRSAINDLQAAAMGREEVTLADVST
FT                   GERDVPESIFKVMGLIFRGDDPGKARRAVMDLDESPEDLIGWVDENLPREYHDGDLERG
FT                   FDALSKADLFLARVRRRMDYGMWRYASFMMVAGVNRARKRRYGGYSKYSAPTYWQKLGR
FT                   ARGTRAVRDSLAAKIGKYCHTSKREARAVFIPLLRVLFRDEGYAVGITARLKLEEDEIA
FT                   FLLDAEKSSKKVGKVYEKSRDLIEKEVEHEIDVFARFAPKEPSAHKVEETAAEPAAEPA
FT                   PKPKRKRKTARDGGEVPAPAIVVEPLVEEPKKEEAPSEPKRQRTLFDF"
     atgagcgaag agcgctgcat ggactgggcg gagaagtaca ggcccgtctc gctgtccggc        60
     gtgcttggca acgacgccgc cgtgaaggcc ctcaggaagt gggccgagac attcggctcc       120
     ggcaaaaagg ccgccatcct ctacggaggc ccgggcatcg gtaagacctc ggccgcatta       180
     gcgctcgctc acgacatggg ctgggactac atcgagatga acgcctcgga ccagcgaaca       240
     aaggacgcca tcaataaagt cgccggctcc gcctcgaaga cgggcacctt cgggggcact       300
     aacgagaggc gcctgctcat cctggacgag gccgataacc tccacggcaa ttacgaccgc       360
     ggcggagagg ctgccattat caatgtcatt aagaatacta atcagcctat tatcctgatc       420
     gcgaatgact tttatgcgct ctcgaaaccg ctcagggacg cggcagagcc catccagttc       480
     agggcattgc ttagcacctc tatcgtgaaa gccctaaaaa agatatgcgc ggccgagaac       540
     atcaagtgcc agcccgaggc gctcatgaag atcgcagagc gcacgaacga catgaggtcg       600
     gccatcaacg acctgcaggc cgcggccatg ggccgggaag aggtgacgct cgccgacgtt       660
     tccacgggcg agcgggacgt gccggaatcg atttttaagg tgatgggcct catcttccgg       720
     ggagacgacc ccgggaaggc ccggagagcg gtaatggacc tggacgagag ccccgaggac       780
     cttatcgggt gggtggacga gaacctcccg cgggagtacc atgacggcga cctcgagagg       840
     ggcttcgatg ccctttcgaa ggcggacctg ttccttgccc gggtcaggcg gcgcatggac       900
     tacggcatgt ggcgctacgc ctcgttcatg atggtggccg gcgtgaaccg cgccagaaag       960
     cgccgctacg ggggctactc gaagtacagc gccccgacgt actggcagaa gctcggcagg      1020
     gccaggggca ccagggccgt ccgggactcg ctcgccgcga agatcggcaa gtactgccac      1080
     acgtccaaaa gggaggcgcg ggctgtcttc ataccgcttt tacgcgtgct attcagggac      1140
     gagggctacg ccgtcggcat tacggcgagg ctcaagctgg aggaggacga gatagcgttc      1200
     ctcctggatg cggagaagtc ctcgaaaaag gtgggtaagg tatacgaaaa gtcccgggac      1260
     ctcatcgaga aggaggtcga gcacgagatc gatgttttcg cgcgttttgc accgaaggag      1320
     ccgtcagccc ataaggtgga agagacggca gcagagcccg cggcggagcc ggcccctaag      1380
     ccgaagcgga agcgcaagac ggcgagggac ggcggcgagg taccggcccc ggccatagtc      1440
     gtcgagcctc tagtggaaga gccaaaaaaa gaagaagcgc cttccgagcc aaaaagacag      1500
     cgcacactat tcgacttttg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page