(data stored in ACNUC10043 zone)

EMBL: AP011532.RPL10E

AP011532.RPL10E      Location/Qualifiers
FT   CDS_pept        375020..375538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10e"
FT                   /locus_tag="MCP_0368"
FT                   /product="50S ribosomal protein L10e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60440"
FT                   /db_xref="GOA:D1YVG8"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG8"
FT                   /protein_id="BAI60440.1"
FT                   /translation="MARKPGRMYKNFSGPAYTRRKYMGGVPGVKVTQFDMGNLTDELPI
FT                   AVTLVVNETCQIRHDALEAARISANRYLMSDVGKQDYRFKVRVYPHQVLRENKQATGAG
FT                   ADRVSDGMRRAFGKAIGTAARVYSGQGIFTIYTNRPNFEKAKEALRRAGHKLPSPHRLV
FT                   VEKGAELVK"
     atggcgagaa aaccaggaag gatgtataag aacttctcag gcccggccta caccaggaga        60
     aagtacatgg gcggtgtgcc aggcgttaag gtcacccagt tcgatatggg caacctcacg       120
     gacgagttgc caattgctgt cacgttagtc gtcaacgaga cctgccagat aaggcacgac       180
     gcccttgagg cagcccgtat ttcggctaac aggtacctga tgagcgatgt aggcaagcag       240
     gattaccggt tcaaggtaag agtttacccc caccaggtcc tcagagagaa caagcaggct       300
     accggcgcag gcgcagaccg tgtctcggat ggcatgaggc gtgctttcgg caaggccatc       360
     ggcaccgcag cccgcgtcta cagcggccag ggtatcttta ctatctacac caacaggccg       420
     aacttcgaga aggccaagga agcgctgcgc agggccggcc acaagctgcc gtcgccgcac       480
     aggctggtcg tcgagaaggg cgccgagctg gtaaagtaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page