(data stored in ACNUC10043 zone)

EMBL: AP011532.RPL21E

AP011532.RPL21E      Location/Qualifiers
FT   CDS_pept        696988..697296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl21e"
FT                   /locus_tag="MCP_0723"
FT                   /product="50S ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60795"
FT                   /db_xref="GOA:D1YWH3"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH3"
FT                   /protein_id="BAI60795.1"
FT                   /translation="MARSHGERKKTRYKFTKALRERGFSPVSRAVQEFTVGQKVHIDID
FT                   PSVHKGMPYRRFQGKTCTVTGTRGRAYLLEMYDGGLRKEIIARPQHLRPQKDQPAEQ"
     atggcaagat cacatggtga aagaaaaaag accaggtaca agttcacaaa ggcgctaaga        60
     gagaggggct tctcgcccgt cagccgcgcc gttcaggaat tcactgtcgg gcaaaaggtc       120
     cacatcgaca tcgacccgag cgtccacaag ggcatgccgt accgcaggtt ccagggcaag       180
     acgtgcaccg tcaccggtac ccgcggcagg gcttacctgt tagagatgta cgacggcggc       240
     ctccggaagg agatcatcgc ccgcccgcag cacctcaggc cccagaagga ccagcccgct       300
     gagcagtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page