(data stored in ACNUC10043 zone)

EMBL: AP011532.RPL31E

AP011532.RPL31E      Location/Qualifiers
FT   CDS_pept        complement(9633..9890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl31e"
FT                   /locus_tag="MCP_0012"
FT                   /product="50S ribosomal protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60084"
FT                   /db_xref="GOA:D1YUG2"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG2"
FT                   /protein_id="BAI60084.1"
FT                   /translation="MADEQIYTIPLDTEGYPHWKKGNLAVKKVREYLSRHMKVDEDKIK
FT                   INAPLNETIWEHGIRKPPRKIRVKATRVEDGGVEADIVGE"
     atggcagacg agcagatata caccattcct ctggacactg agggataccc ccactggaag        60
     aagggcaacc tggccgtaaa gaaagtcagg gagtacctgt ccaggcacat gaaggtggac       120
     gaggataaga tcaagatcaa cgcccctctc aacgagacca tctgggagca cggcatcagg       180
     aagccgcccc gcaagatcag ggtcaaggcg acccgggtcg aggacggcgg cgtagaagcc       240
     gacatagtcg gcgagtaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page