(data stored in ACNUC10043 zone)

EMBL: AP011532.TOP6A-1

AP011532.TOP6A-1     Location/Qualifiers
FT   CDS_pept        complement(29386..30519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6A-1"
FT                   /locus_tag="MCP_0040"
FT                   /product="type II DNA topoisomerase VI subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60112"
FT                   /db_xref="GOA:D1YUJ0"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ0"
FT                   /protein_id="BAI60112.1"
FT                   /translation="MALARDILRDRRLTRDQEQAIMILSAYCLGSMVRVENALPYTFKA
FT                   LKVDRSSVEYDDVDGYNVTGDTVAMSTANIDQAATIAKLQFLVNHVIETVAANSVSTKR
FT                   DCYYMLKNQFQKYPWMDLSGQGESDRLIDTLERIIRMQRENLNIIADPKGLIYGDITLV
FT                   DEEGKEFNCHEREQGITGLAGQWEVKSHHVKAVIAIEKTGVFMDLKKLKVADELGIGLI
FT                   HLGGQPARGCRALINLLSEKGIPIGVLTDLSPWSGMIAKSVLSGSIAAAHLSGLHASKA
FT                   AFLGIESSDVDDWLKDVWKSVQEPLSGHDTARAQNNLSLPYMQDDYWKGENSWFVKSGK
FT                   KTELEALGTAAGSPLKRKEFYKKYLRAKLKEKLKVKV"
     atggcgctgg cccgggatat tctacgcgat aggcggctca cccgggacca ggagcaggcg        60
     atcatgatat tgtcggccta ctgcctgggg tcgatggtcc gggtggagaa cgcgctgccc       120
     tatacgttca aggccctgaa ggtcgaccgc agctcggtcg agtacgacga cgtggacggg       180
     tacaacgtca cgggggacac cgtggccatg agcaccgcca acatcgacca ggcggccacc       240
     atcgccaagc tccagttcct ggtgaaccac gtcatcgaga cggtggccgc caactccgtg       300
     tccacgaaga gggactgcta ctacatgcta aagaaccagt tccagaagta cccgtggatg       360
     gaccttagcg gccagggcga gagcgaccgg ctgatcgaca cgctggagcg catcatccgc       420
     atgcagcgcg agaacctgaa catcatcgcc gacccgaagg gccttattta tggcgacatc       480
     accctcgtgg acgaggaggg aaaggagttc aactgccatg agcgggagca gggcatcacg       540
     ggcctggccg ggcagtggga ggtgaagtcg caccacgtca aggcggtcat agcgatagag       600
     aagaccggcg tcttcatgga ccttaaaaag ctgaaggtgg ccgacgagct cggcatcggg       660
     ctgatccacc tgggcggcca gcccgcccgg gggtgcaggg ctttaataaa tctcctgtcc       720
     gagaagggca taccgatcgg agttttgacc gacctgtcgc cgtggtcggg aatgatcgca       780
     aagtccgtgc tcagcggaag catcgcggcc gcccacctga gcggcctcca cgcctcgaag       840
     gcggcattcc tgggcatcga gtcctccgac gtggacgact ggctcaagga cgtgtggaag       900
     agcgtgcagg agcctctgag cggacacgac acggccaggg cccagaacaa cctgtccctg       960
     ccctacatgc aggacgacta ctggaagggc gagaactcct ggttcgtgaa gtccggcaag      1020
     aagaccgagc tggaggcgct cgggaccgct gcgggctccc cgctaaagag aaaggagttc      1080
     tataagaagt acctgagggc gaagctaaag gaaaagttaa aagtgaaagt atag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page