(data stored in ACNUC10043 zone)

EMBL: AP011532.TRKA-1

AP011532.TRKA-1      Location/Qualifiers
FT   CDS_pept        complement(533271..533939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA-1"
FT                   /locus_tag="MCP_0549"
FT                   /product="Trk system potassium uptake protein TrkA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60621"
FT                   /db_xref="GOA:D1YVZ9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ9"
FT                   /protein_id="BAI60621.1"
FT                   /translation="MHIIIIGLGGIGQNLARIAVAEKHNVVVIDNNAKKCNDIVTKYDL
FT                   ISVNGDATSATILDEAGVSETDAVIATTSSDAVNLLALLQAKDKGVKNLRSIVNEFEHE
FT                   DIFQREGITIHKNPSAIVAEDIYNNMLRPGINDFVTIGAGKAEIVDILIKEGTKAAGRS
FT                   IKDIGLPSNVLVIAVERGDDVIIPDGNTVVLPGDSVFVFIRKNLADKVFNTFSVGNLVR
FT                   "
     atgcacatca tcatcatagg gctcgggggc atagggcaga acctggcgcg catcgccgtc        60
     gctgaaaagc acaacgtggt ggtcatcgac aataatgcca agaaatgcaa cgacatcgtc       120
     acgaagtacg acctcatcag cgtgaacggg gacgcgacat cggccactat tctcgacgag       180
     gccggggttt cagagacgga tgcggtgata gcgacgacga gcagcgacgc cgtgaacctc       240
     ctggctctgc tccaggcgaa ggataaaggg gtgaagaacc tccggtccat cgtgaacgag       300
     ttcgagcacg aggacatatt ccagagggag ggcatcacga tccataaaaa cccgagcgct       360
     attgtggccg aagacatata caacaatatg ctcaggcccg gcatcaatga cttcgttacc       420
     ataggcgccg gcaaggcgga gatcgtggac atcctcatca aggaaggcac gaaggcggcc       480
     ggcaggtcca tcaaggacat cggcctcccc agcaacgtac tcgtcatagc cgtcgagagg       540
     ggggacgatg tcatcatacc ggacggcaac acggtcgtcc tgccgggaga ctccgtgttc       600
     gtctttatca ggaaaaacct cgccgacaag gtctttaata cgttctcagt tggcaacctg       660
     gtgagatga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page