(data stored in ACNUC8465 zone)

HOGENOMDNA: ARTAR_1

ID   ARTAR_1; SV 1; empty ; DNA; empty ; PRO; 8528 BP.
XX
AC   NC_014548;
XX
PR   Project: 53509;
XX
DE   Arthrobacter arilaitensis Re117 plasmid pRE117-2, complete sequence.
XX
OS   Arthrobacter arilaitensis Re117
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Micrococcineae; Micrococcaceae; Arthrobacter.
XX
RN   [1]
RP   1-8528
RX   PUBMED; 21124797.
RA   Monnet,C., Loux,V., Gibrat,J.F., Spinnler,E., Barbe,V., Vacherie,B.,
RA   Gavory,F., Gourbeyre,E., Siguier,P., Chandler,M., Elleuch,R., Irlinger,F.
RA   and Vallaeys,T.;
RT   "The arthrobacter arilaitensis Re117 genome sequence reveals its genetic
RT   adaptation to the surface of cheese";
RL   PLoS ONE 5 (11), E15489 (2010)
XX
RN   [2]
RP   1-8528
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (04-OCT-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-8528
RA   Genoscope -,C.E.A.;
RT   "Direct Submission";
RL   Submitted (05-JUL-2010) Genoscope - Centre National de Sequencage : BP 191
RL   91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr - Web :
RL   www.genoscope.cns.fr)
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to FQ311476.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..8528
FT                   /strain="Re117"
FT                   /mol_type="genomic DNA"
FT                   /organism="Arthrobacter arilaitensis Re117"
FT                   /plasmid="pRE117-2"
FT                   /db_xref="taxon:861360"
FT   gene            86..532
FT                   /db_xref="GeneID:9777833"
FT                   /locus_tag="AARI_pII00010"
FT   CDS_pept        86..532
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00010"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="2 transmembrane helices predicted by TMHMM2.0"
FT                   /db_xref="GI:308151710"
FT                   /db_xref="GeneID:9777833"
FT                   /translation="MNTEENAVQKSSAPTWLGWIGAVTTALGLFLLLRPINNCGSVFAP
FT                   DLGTARVVDAFAGTTYSTRRCIEQLDAATVPAWVIACAGLLLIIAAIIVSVMTNRQPTL
FT                   AAVPAAGEPSLAEELEKLAALMNSGAITEAEFERSKASILGRKG"
FT                   /protein_id="YP_003915161.1"
FT   gene            complement(676..1659)
FT                   /db_xref="GeneID:9777821"
FT                   /locus_tag="AARI_pII00020"
FT   CDS_pept        complement(676..1659)
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00020"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:308151711"
FT                   /db_xref="GeneID:9777821"
FT                   /translation="MKDNDIAVDNSIAANSAASAEMGPLASLLAPEYPEYQGSVALAKE
FT                   IFEAAPARTNIPIRRAFVRNGDGGSPAPLAEIVSRGGRGGAVAAKLYVALIWRCSAKPF
FT                   NTSIAPRKWAALLGLSDPDRKGARRITNALNLLEDLKLVKLTRSRGDSSLITLLDESGD
FT                   GSKYLPPSEASMIGGKERDRYFKMPVTLWTDHRAYAQRMSSGALVMLFLLLDSGSGVPT
FT                   TLAEGTEQWWSVEIFQKWYAVSGPMRTRGTKELIEMGLLYVRKEAVPSYKGQGSFAKER
FT                   VRNVYRLQNAALIRSNKSLDRPDLPDATTFAEKIAQLPNSMRSRPS"
FT                   /protein_id="YP_003915162.1"
FT   gene            complement(2057..2260)
FT                   /db_xref="GeneID:9777822"
FT                   /locus_tag="AARI_pII00030"
FT   CDS_pept        complement(2057..2260)
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00030"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:308151712"
FT                   /db_xref="GeneID:9777822"
FT                   /translation="MWSVARSPGERMWVTVTHRKGDQLIGILDNYAVFAFLKPDEKMKF
FT                   HIDDIIDCIFEEDDVEEAELAA"
FT                   /protein_id="YP_003915163.1"
FT   gene            2372..2518
FT                   /db_xref="GeneID:9777823"
FT                   /locus_tag="AARI_pII00040"
FT   CDS_pept        2372..2518
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00040"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:308151713"
FT                   /db_xref="GeneID:9777823"
FT                   /translation="MPDISSPEPLDMHWESSSKCDLELLSYPEKTIPTWYLVELCLKFP
FT                   AAV"
FT                   /protein_id="YP_003915164.1"
FT   gene            complement(2632..2946)
FT                   /db_xref="GeneID:9777824"
FT                   /locus_tag="AARI_pII00050"
FT   CDS_pept        complement(2632..2946)
FT                   /function="3.5.2 Transcription regulation"
FT                   /gene_family="HOG000246980" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pII00050"
FT                   /codon_start="1"
FT                   /product="PadR-like family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family PF03551"
FT                   /db_xref="GI:308151714"
FT                   /db_xref="GeneID:9777824"
FT                   /translation="MKITHSLVMVAMAILEMDRENDGQVWGYALSKRSGVRSGVLYPQL
FT                   DRLMNEGWLDDHWEERVEGQKRPPRRYYTLTEQGRSNLGTLARKAAAEQRFKGIGVAFA
FT                   "
FT                   /protein_id="YP_003915165.1"
FT   misc_feature    complement(2698..2922)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="AARI_pII00050"
FT   gene            complement(2997..3743)
FT                   /db_xref="GeneID:9777825"
FT                   /locus_tag="AARI_pII00060"
FT   CDS_pept        complement(2997..3743)
FT                   /function="3.1 DNA replication"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pII00060"
FT                   /codon_start="1"
FT                   /product="mobilisation protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family PF03432:
FT                   Relaxase/Mobilisation nuclease domain.
FT                   Relaxases/mobilisation proteins are required for the
FT                   horizontal transfer of genetic information contained on
FT                   plasmids that occurs during bacterial conjugation"
FT                   /db_xref="GI:308151715"
FT                   /db_xref="GeneID:9777825"
FT                   /translation="MIAKITRGKNPGDIGAYLHGPGKANEHTYTAAGQRVSGGVVVGSN
FT                   IGAEGQTDPRWWAGELRKALNTRPEIKNPVWHASLRNTKADRTLTNEEWADVGQSFAEG
FT                   MGYAEHPWVMVRHGDDHVHIVVSRVSDVGDVWHGRNDRRAAQSACTRLEQENGLEKAPR
FT                   RRIQPKLAVTAEREEARGKAHALGSHRAVKEAERRELEAHRARIREMREANFPNPPTTR
FT                   SPSKGIVPVVRPYTPLQPSRDEGRER"
FT                   /protein_id="YP_003915166.1"
FT   misc_feature    complement(<3198..3593)
FT                   /note="Relaxase/Mobilisation nuclease domain; Region:
FT                   Relaxase; cl01584"
FT                   /db_xref="CDD:174650"
FT                   /locus_tag="AARI_pII00060"
FT   gene            complement(3740..4222)
FT                   /db_xref="GeneID:9777826"
FT                   /locus_tag="AARI_pII00070"
FT   CDS_pept        complement(3740..4222)
FT                   /function="3.1 DNA replication"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pII00070"
FT                   /codon_start="1"
FT                   /product="mobilisation protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family PF05713:
FT                   bacterial mobilisation protein (MobC). This family consists
FT                   of several bacterial MobC-like, mobilisation proteins. MobC
FT                   proteins belong to the group of relaxases. Together with
FT                   MobA and MobB they bind to a single cis-active site of a
FT                   mobilising plasmid, the origin of transfer (oriT) region"
FT                   /db_xref="GI:308151716"
FT                   /db_xref="GeneID:9777826"
FT                   /translation="MALFSRKKTPPASPPNPFVRTPEQEAAWREREAVEAAAAEAARVV
FT                   YEPRKGGRPTVEHPRTKRVSLSLSDEEHETLATAAGGRRVSVWARERLLESLATEPTPG
FT                   AGAEVARLRADLGRVGSNLNQLMRAVNSGQTVPSTELLDAVQATREELARVRGELP"
FT                   /protein_id="YP_003915167.1"
FT   misc_feature    complement(3755..3880)
FT                   /note="Bacterial mobilisation protein (MobC); Region: MobC;
FT                   pfam05713"
FT                   /db_xref="CDD:114439"
FT                   /locus_tag="AARI_pII00070"
FT   gene            4384..4587
FT                   /db_xref="GeneID:9777827"
FT                   /locus_tag="AARI_pII00080"
FT   CDS_pept        4384..4587
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00080"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:308151717"
FT                   /db_xref="GeneID:9777827"
FT                   /translation="MEDNAARKQGAGHGTDDPQVHTRRARGRPIDRSAAEVDSRAPAKR
FT                   ALGSVEVLEPWVHGEGKVNGWE"
FT                   /protein_id="YP_003915168.1"
FT   gene            4775..5320
FT                   /db_xref="GeneID:9777828"
FT                   /locus_tag="AARI_pII00090"
FT   CDS_pept        4775..5320
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00090"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="signal peptide predicted by SignalP 3.0 HMM
FT                   (probability: 1.000) with cleavage site probability 0.621
FT                   between position 22 and 23. 2 transmembrane helices
FT                   predicted by TMHMM2.0 after the signal peptide"
FT                   /db_xref="GI:308151718"
FT                   /db_xref="GeneID:9777828"
FT                   /translation="MNASIAAVLACGLTFTVLPASASTPAQLNPGAATVANESVTDAEV
FT                   DKLAKDLEALFTHGITQNEDGSFRVDEKSIIKHFGEVKGKQIIAQFRAQVPQTHIGNIP
FT                   VASAASYGQCVLNFTGFGALFGASEGTILGYINRKDWNKAAQTMVKFLGKQAVKGGVVG
FT                   LAASLAAAGAWCATPWAK"
FT                   /protein_id="YP_003915169.1"
FT   gene            5450..5713
FT                   /db_xref="GeneID:9777829"
FT                   /locus_tag="AARI_pII00100"
FT   CDS_pept        5450..5713
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00100"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="signal peptide predicted by SignalP 3.0 HMM
FT                   (probability: 0.879) with cleavage site probability 0.323
FT                   between position 19 and 20. 2 transmembrane helices
FT                   predicted by TMHMM2.0 after the signal peptide"
FT                   /db_xref="GI:308151719"
FT                   /db_xref="GeneID:9777829"
FT                   /translation="MVSLIAALAAVVSGVLAVAEVSRESNKAGFILGIVASVISVMGTA
FT                   FVLTASAALPLAVTAGIALVPVLLWIALAVVHSKAGEAKALS"
FT                   /protein_id="YP_003915170.1"
FT   gene            6483..7031
FT                   /db_xref="GeneID:9777830"
FT                   /locus_tag="AARI_pII00110"
FT   CDS_pept        6483..7031
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00110"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:308151720"
FT                   /db_xref="GeneID:9777830"
FT                   /translation="MGLTQAAKACGVSVSTLRRRKDQLVAAGTKITDKGWQIPIPALVS
FT                   LGYLSGTTPASDTPPQKPMTPPVEHPLISPVMPPVEIPSNELETLRLKLVEAETRAQVA
FT                   EAISAERERIIQVQATALRMLERGTSDTPTKKPAEGVPDTPSDTPLDTPVTPPENPHIP
FT                   APKPPSRGIFKKLFGFGRN"
FT                   /protein_id="YP_003915171.1"
FT   gene            complement(7028..7726)
FT                   /db_xref="GeneID:9777831"
FT                   /locus_tag="AARI_pII00120"
FT   CDS_pept        complement(7028..7726)
FT                   /function="3.3 DNA recombination, and repair"
FT                   /gene_family="HOG000275580" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pII00120"
FT                   /codon_start="1"
FT                   /product="putative resolvase"
FT                   /transl_table="11"
FT                   /note="match to PF00239. Possibly involved in site-specific
FT                   recombination of DNA"
FT                   /db_xref="GI:308151721"
FT                   /db_xref="GeneID:9777831"
FT                   /translation="MKDAQSGPLKIAGYVRVSTDKQDISPEMQRAALEREALLKGYELT
FT                   LVEELAVSAATMTKRPLMQQLLAALKDGSFDGLMVAKLDRLSRSMEDGTRILADSQRQG
FT                   WRIICLDLGVDTATVMGAGLFNMALNFAEIERKLIGKRTSEAMQQKAADGQHMGRVSVL
FT                   PHAVMLRIHDLHRGGLSLRQIVERLEAEQVPTAKGVRWHASTVRSVLSSVTLQRLLNDS
FT                   SIAPREAIEA"
FT                   /protein_id="YP_003915172.1"
FT   misc_feature    complement(7289..7687)
FT                   /note="Serine Recombinase family, catalytic domain; a DNA
FT                   binding domain may be present either N- or C-terminal to
FT                   the catalytic domain. These enzymes perform site-specific
FT                   recombination of DNA molecules by a concerted, four-strand
FT                   cleavage and rejoining...; Region: Ser_Recombinase;
FT                   cd00338"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="AARI_pII00120"
FT   misc_feature    complement(order(7463..7465,7472..7477,7673..7675,
FT                   7679..7681))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="AARI_pII00120"
FT   misc_feature    complement(7673..7675)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="AARI_pII00120"
FT   gene            7842..8390
FT                   /db_xref="GeneID:9777832"
FT                   /locus_tag="AARI_pII00130"
FT   CDS_pept        7842..8390
FT                   /function="6 Protein of unknown function, without
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   similarity to other proteins"
FT                   /locus_tag="AARI_pII00130"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="signal peptide predicted by SignalP 3.0 HMM
FT                   (probability: 0.983) with cleavage site probability 0.615
FT                   between position 21 and 22"
FT                   /db_xref="GI:308151722"
FT                   /db_xref="GeneID:9777832"
FT                   /translation="MKRTYAVITALAAALSLASCSAKTTDPLSELRSAINAGKECPELF
FT                   PLLKAIPNSDEAQGEMRNIGCYTVSSTRTDAERSKTAPNSDWIGVPDGKRVEVSNECLD
FT                   ASKQAANEVNSDAAEPLIRRTLEACQSTNEWLSALAKYPGVMGMVEGYIPSVTDIEVAC
FT                   GVHPDTAVCKDYGMLETAG"
FT                   /protein_id="YP_003915173.1"
SQ   Sequence 8528 BP; 1877 A; 2402 C; 2334 G; 1915 T; 0 other;
     AAAAAATGTT TCGCAGGTAG ACAGCCCCGC TATGGTTGAT GAAATCTGGA GATTCCCCAG        60
     ACACATCACT TGCGAAAGAT CGTTCATGAA TACTGAAGAA AATGCAGTAC AAAAAAGTTC       120
     CGCTCCCACA TGGCTCGGGT GGATCGGTGC GGTGACTACG GCGCTTGGTC TTTTCCTCCT       180
     CCTGCGCCCC ATTAATAACT GTGGGTCAGT TTTTGCACCT GATTTGGGCA CCGCTAGAGT       240
     TGTTGATGCT TTTGCTGGAA CGACTTATTC AACACGTCGG TGCATTGAGC AGTTGGACGC       300
     GGCCACAGTC CCCGCCTGGG TTATTGCGTG TGCTGGGCTC TTGCTCATTA TTGCTGCGAT       360
     CATCGTGTCG GTCATGACCA ATCGTCAGCC AACATTGGCA GCCGTACCTG CAGCTGGTGA       420
     ACCGTCGTTG GCAGAAGAAT TAGAGAAGCT TGCCGCCCTG ATGAACAGTG GTGCAATCAC       480
     TGAGGCAGAG TTCGAGCGTT CTAAGGCTTC CATCTTGGGC AGAAAGGGAT AGATTCCTTT       540
     CCCGCTGGTC GGGCTATGCC TCGGGGCTGA TGGCTAGTTC ATTCCCCGAG GCATACATCA       600
     AGGATTCCCT TTGAGTACAA AAGGAACCCT CATTCTTCAA CGCCAGATGT GGCTGCCTTG       660
     AAGTAGCCGA AGGCATTAGC TGGGACGTGA TCTCATGCTG TTTGGGAGTT GGGCGATCTT       720
     CTCTGCAAAA GTGGTGGCAT CGGGGAGGTC TGGACGGTCG AGCGACTTAT TGCTCCGGAT       780
     AAGCGCCGCG TTCTGCAGGC GATATACATT GCGAACTCGC TCCTTGGCGA AGCTGCCTTG       840
     GCCTTTGTAG CTGGGGACGG CTTCTTTACG CACATAAAGG AGGCCCATCT CTATGAGTTC       900
     CTTTGTGCCG CGTGTGCGCA TGGGTCCGCT GACGGCGTAC CACTTCTGGA AAATTTCCAC       960
     GCTCCACCAT TGCTCTGTTC CCTCCGCAAG GGTGGTGGGG ACACCTGACC CGGAATCCAG      1020
     GAGAAGAAAG AGCATGACGA GAGCTCCGGA GGACATCCGT TGAGCGTAGG CCCTGTGATC      1080
     GGTCCAGAGA GTCACCGGCA TCTTGAAGTA GCGGTCTCTT TCCTTGCCTC CAATCATGGA      1140
     AGCCTCCGAC GGGGGAAGAT ACTTCGAACC GTCGCCTGAC TCATCGAGCA GGGTGATCAA      1200
     GGAGGAATCG CCTCTGGAGC GGGTGAGCTT GACGAGCTTC AAATCCTCCA GAAGATTCAG      1260
     AGCGTTGGTG ATCCGACGAG CCCCTTTGCG ATCAGGATCA GACAAGCCAA GTAATGCCGC      1320
     CCACTTCCTG GGTGCGATGC TCGTGTTGAA CGGCTTCGCA GAACAACGCC AGATCAATGC      1380
     GACGTACAAC TTGGCTGCCA CTGCCCCACC ACGGCCACCA CGGCTAACAA TCTCGGCTAG      1440
     GGGGGCTGGA GATCCCCCGT CGCCGTTTCG TACGAAGGCA CGGCGGATGG GGATGTTGGT      1500
     CCGTGCCGGC GCAGCCTCGA AAATCTCCTT CGCCAGAGCG ACGGATCCTT GGTATTCGGG      1560
     GTATTCGGGG GCGAGGAGGG AGGCCAATGG GCCCATTTCA GCACTTGCTG CCGAGTTGGC      1620
     TGCTATTGAG TTATCTACGG CAATATCATT GTCCTTCATA CTTCCAATGT AATCGACTGA      1680
     CCAAGTAATC AACAAACGTT GCGGCGTAGA AACAACTAAA TCTAAGTAAC TAGGTGGATA      1740
     ATTTTCACTG ATCCTCTAAA TCCCGCGGAT TACTAGGGCA AACGGAGGAT TCGTGCTAGG      1800
     CTGGTTGAAC ACGAGGCCGA CCAAGGTGTC TGATCGGCAA ACGAACTGCG TTTGCTAAAG      1860
     GAGACGTTCG GCTTCGTGAG TTAGAAGAAG AGCAGAAGAA TCACGGCATT CTCGCTCCTG      1920
     TGAGAGAAGC GCTCCGATCG TTTGGATCGG GAAGCGACCT TGTTGTAGCG GAGCTTCTAA      1980
     TGAGCGAGGG CCCCAGGTGG AACTGGGGCC CTCGCTTTTT AAGATCGATC AGCGGAAGCT      2040
     GTTCCGCATC CACGACCTAG GCGGCAAGCT CGGCCTCTTC AACATCATCT TCCTCGAAGA      2100
     TGCAGTCGAT GATGTCGTCG ATGTGAAACT TCATCTTTTC ATCGGGCTTC AAGAAGGCAA      2160
     AGACGGCGTA GTTATCGAGG ATTCCAATCA GTTGGTCCCC TTTTCGATGA GTAACAGTCA      2220
     CCCACATTCG CTCCCCGGGG GAGCGTGCTA CCGACCACAT GAGTTTCACC CTGTCTCCTG      2280
     GGCGAATGGC TGATTTGGAT TCTCTATCCG GGATTTCGAA GGTGTGTGGC GACTCGCGAT      2340
     GGGATTTTAG TCCAGATTCT AGGGTGCATC GATGCCAGAC ATATCTTCCC CAGAACCACT      2400
     CGATATGCAC TGGGAGTCCA GTTCGAAGTG CGACCTCGAA TTGCTGAGCT ACCCAGAAAA      2460
     GACGATCCCA ACGTGGTACC TCGTAGAGCT CTGCTTGAAG TTCCCTGCGG CGGTCTAAAT      2520
     CAGGGATCAG GCGAACAATT AACGCCAGAA CCATTCCGGG AGCAAACCCG AAAACAGCGA      2580
     TTGCCACCAT AAAGGTGCCA ATCGCTCCCT GTGCGATGAG AAGATCACTA ATCACGCGAA      2640
     AGCCACCCCA ATTCCCTTGA ATCGCTGCTC TGCCGCGGCT TTGCGCGCGA GGGTGCCAAG      2700
     ATTCGAGCGT CCTTGCTCCG TAAGGGTGTA GTAACGGCGG GGTGGCCTCT TTTGACCCTC      2760
     CACCCTTTCC TCCCAATGGT CATCAAGCCA TCCTTCGTTC ATCAACCGAT CCAACTGTGG      2820
     ATACAGGACG CCCGAACGGA CCCCCGAACG CTTTGAAAGC GCATAGCCCC ATACTTGACC      2880
     GTCGTTCTCC CGGTCCATTT CAAGGATCGC CATGGCGACC ATAACTAACG AATGGGTGAT      2940
     CTTCATAGGT CTTACTATAC CTATGTAGAC TTGAGTTTTC CACCCTCCCC GATGCGCTAC      3000
     CGTTCTCGAC CTTCATCGCG GCTAGGCTGT AGCGGTGTGT ACGGACGCAC CACAGGCACA      3060
     ATGCCCTTTG ACGGGCTGCG GGTCGTGGGT GGGTTCGGGA AGTTCGCCTC GCGCATCTCC      3120
     CGAATCCGCG CCCTATGTGC TTCCAGTTCG CGCCGTTCGG CCTCTTTCAC CGCCCTGTGT      3180
     GAACCCAGGG CGTGGGCTTT GCCTCTGGCT TCTTCGCGCT CCGCCGTGAC GGCCAGTTTC      3240
     GGCTGGATAC GCCTTCGTGG AGCCTTCTCC AGGCCGTTCT CTTGTTCCAG GCGCGTGCAG      3300
     GCGCTCTGCG CGGCCCGGCG GTCGTTCCGG CCGTGCCAGA CATCCCCCAC ATCACTCACG      3360
     CGTGAGACCA CGATATGCAC GTGGTCATCC CCATGACGCA CCATCACCCA CGGATGCTCC      3420
     GCATAGCCCA TGCCTTCAGC GAACGACTGC CCAACATCAG CCCATTCTTC ATTAGTCAGC      3480
     GTCCTATCAG CCTTGGTATT GCGTAAGGAA GCATGCCAGA CCGGGTTCTT GATCTCCGGG      3540
     CGCGTGTTCA ACGCCTTACG CAGCTCACCA GCCCACCACC GCGGATCAGT CTGCCCCTCG      3600
     GCACCAATAT TTGACCCGAC CACCACACCG CCAGAGACCC GCTGCCCTGC CGCTGTATAG      3660
     GTGTGTTCAT TCGCTTTGCC TGGACCGTGC AAATACGCTC CAATATCCCC AGGGTTCTTA      3720
     CCCCGCGTGA TTTTCGCGAT CACGGCAGCT CACCGCGCAC CCGCGCCAAT TCCTCCCGCG      3780
     TTGCCTGCAC AGCGTCCAGC AGCTCAGTAC TGGGCACGGT CTGCCCAGAG TTCACCGCTC      3840
     GCATCAACTG GTTCAAGTTC GACCCAACCC GGCCCAGATC CGCGCGCAAC CGCGCCACTT      3900
     CCGCCCCAGC GCCCGGGGTG GGTTCGGTGG CCAGTGACTC GAGCAGTCGT TCCCGCGCCC      3960
     ACACTGACAC CCGCCGGCCC CCAGCCGCAG TGGCCAGGGT TTCATGTTCC TCATCCGACA      4020
     AAGACAGGGA AACACGCTTC GTGCGCGGGT GCTCCACCGT AGGCCGGCCA CCCTTACGCG      4080
     GCTCATAAAC CACCCGCGCA GCCTCGGCCG CAGCAGCCTC CACGGCTTCC CGTTCCCGCC      4140
     AAGCAGCTTC CTGCTCCGGC GTGCGCACGA ACGGGTTAGG CGGTGAAGCC GGGGGTGTTT      4200
     TCTTCCGAGA AAACAGAGCC ATGTGAACCG TCCTTTACGA AGACCGCGAA GCGGTCGAGA      4260
     ACAAGCCCTC CGCAGGAGCA AGGGGCGATT AGCCGGAACG AAAACTGTCA GCGAGGCACG      4320
     AGCGGTACGA CAGTTTTCCG TTACGGATAA TCATACCTTG CATCTGTTTG CGCGCGTCCG      4380
     ACCGTGGAGG ATAACGCCGC GCGCAAACAG GGGGCCGGAC ACGGGACCGA CGACCCCCAA      4440
     GTGCACACGC GGAGGGCGCG GGGCCGGCCC ATCGACCGCA GCGCAGCGGA GGTTGATTCC      4500
     AGGGCACCTG CGAAGCGTGC CCTGGGTTCC GTCGAGGTGC TTGAGCCTTG GGTCCATGGC      4560
     GAGGGCAAGG TGAACGGGTG GGAGTGAAGG TGCCTGGATA ACACATTTTT ATGGAAGTCG      4620
     CCATACTACT TTAGTAGGAG GTAAATTTAT AATAGGGTGT TTCATCAGGG GTAGCTTAAA      4680
     CTAATTGGAT TAGATATGTT TTAAGGAAAG ATGCCCCAGA GACCAGCTGG GGCAGTTCAC      4740
     GCTCATTTGG AGAGCAAAAA TGAAGAATAA GTTTGTGAAC GCTTCTATCG CTGCGGTCCT      4800
     GGCCTGTGGA CTGACCTTCA CAGTACTTCC CGCATCAGCG TCGACGCCTG CCCAGCTCAA      4860
     TCCAGGGGCG GCGACAGTGG CAAATGAATC GGTCACTGAT GCTGAAGTCG ACAAGTTGGC      4920
     CAAGGATCTC GAAGCGCTTT TCACGCATGG AATCACTCAA AATGAAGACG GTTCGTTCCG      4980
     TGTTGATGAA AAGAGCATCA TCAAGCATTT TGGTGAAGTG AAAGGCAAGC AGATCATTGC      5040
     CCAGTTCCGT GCCCAGGTGC CGCAGACTCA CATCGGCAAT ATTCCCGTTG CGTCAGCTGC      5100
     AAGCTATGGC CAGTGCGTTT TGAACTTCAC TGGATTCGGA GCCCTCTTCG GAGCTTCTGA      5160
     AGGAACGATT CTGGGCTACA TCAACCGCAA GGATTGGAAT AAGGCTGCTC AAACTATGGT      5220
     GAAGTTCTTG GGCAAGCAGG CAGTTAAGGG CGGTGTAGTC GGTCTGGCCG CGTCGCTCGC      5280
     CGCAGCGGGG GCCTGGTGCG CGACCCCTTG GGCAAAATAA TCCGCTCTTT TCCGGAAGGT      5340
     GATCTCAATG CAAAATGAAG GAATGTTCGG GATGTCCGCA GGACTGAAAA TCACTGTATC      5400
     GGCGTGTTTT ACCGTCGGAT CAATTTTTAC CGGGGCGAAT GGGTTAACAG TGGTTTCCCT      5460
     GATCGCGGCC CTCGCTGCTG TTGTGTCAGG TGTCCTGGCT GTGGCCGAGG TAAGCCGAGA      5520
     ATCCAACAAA GCAGGATTTA TTCTCGGGAT CGTCGCTAGC GTGATCTCCG TGATGGGTAC      5580
     CGCGTTCGTC TTGACCGCAA GCGCAGCGTT GCCTTTGGCA GTTACTGCTG GAATTGCCCT      5640
     AGTGCCTGTG TTGTTGTGGA TTGCTCTAGC TGTGGTTCAT AGCAAAGCAG GAGAAGCGAA      5700
     AGCTTTAAGC TAGTTCGAAT AAAGGGTCGG GGTTGAGAAG CCTATAAGAA ATTCTCAACC      5760
     CCGACCCTTG TTTTAACCTA GGGGCATTAA AGGCCTTCAC TTCGTTCAGA CTCTTTTTTA      5820
     TTACTGCCCA GCCCCGTTTC TGACGTTGAC AGTAAGCCGG AGGGGTGCAA CCGCAGAGGG      5880
     AGCAGAGGGA GGGCTGAGGG CAGAGTCTTG CCTTGATAGT CCAACTAAGG GTTGGACAGT      5940
     CAAGACAAGC AAAGGTGATG GGTTACCGCG TCGGTCGCGT CGGTCGGTTC ATCGGTTGGC      6000
     AGGATAGTGC TCCTGCACGC TTGGCATGGG GCATTACTTC CATGCAGTGG CGGCGTGTTC      6060
     CGTAAGCTCT TGATGTGTTG CCCTCTTGTC ATCGAGGGGC TTCATAACCG TGATTCCAGA      6120
     TTCGGCACTT CTTCGCGCTC ATGGATCACT CAACATGAGC AGCATCTGGC TGGTTTACGG      6180
     ATCGAAAGGG AGAACTGGCT CTAACCCAGG AAGGTGGCCG TGTGAGGGCC TTAGCGTGTT      6240
     TGTTTTAGTC GGTATTCTCG ACACGCGGGT GGCGCTTACT CCGCGTACGT CTGGAAGTCG      6300
     TTGGCGCGAC TTTGGTAGAC TGACTCTATA GTTATTTTGA CAAACTTAAT GATCCCCGAT      6360
     TGGTTGGCGC CGATCGGGGA TTTCCCTTTT AACGGCGTGG CGCTGACCAC TGCAGACCCT      6420
     GATCCAGGGG CTCACGGTAA TTTGGAGATA TGGCTCAACG TCCTGCACAT AAACCACCCA      6480
     CGATGGGTCT AACTCAAGCA GCAAAGGCTT GCGGAGTATC GGTCTCCACT TTGCGCCGGC      6540
     GCAAAGATCA ACTGGTGGCA GCAGGCACAA AAATCACCGA TAAAGGGTGG CAAATCCCTA      6600
     TCCCCGCCTT GGTATCCCTC GGCTACTTAT CCGGTACCAC CCCTGCCAGT GACACCCCTC      6660
     CACAAAAACC AATGACACCC CCCGTGGAAC ACCCTCTGAT ATCCCCAGTG ATGCCCCCTG      6720
     TTGAGATCCC CTCAAACGAG CTGGAAACGC TCAGGTTGAA ACTGGTGGAA GCAGAGACTC      6780
     GCGCCCAAGT CGCAGAAGCA ATATCAGCCG AAAGAGAGCG CATCATCCAG GTCCAGGCAA      6840
     CAGCTCTCAG GATGTTGGAA AGGGGTACCA GTGATACCCC TACCAAGAAA CCAGCTGAAG      6900
     GGGTACCAGA TACCCCCTCT GACACCCCCC TTGATACCCC AGTGACACCC CCTGAAAATC      6960
     CTCACATTCC AGCTCCAAAA CCACCTTCAC GAGGGATCTT CAAAAAGCTC TTTGGATTCG      7020
     GTCGGAACTA GGCTTCGATA GCTTCGCGTG GAGCAATTGA AGAGTCATTG AGCAGTCGCT      7080
     GCAGCGTCAC CGAGCTAAGA ACAGATCGCA CTGTAGAGGC ATGCCAGCGC ACGCCCTTGG      7140
     CTGTTGGCAC TTGCTCGGCT TCCAGGCGCT CAACGATTTG CCGCAGCGAA AGCCCTCCCC      7200
     GATGTAAATC ATGAATGCGC AGCATGACAG CATGTGGCAA CACCGAGACC CGGCCCATGT      7260
     GCTGACCATC CGCTGCCTTC TGTTGCATGG CTTCAGATGT TCGCTTCCCA ATCAGCTTTC      7320
     GCTCGATCTC GGCGAAGTTC AATGCCATAT TGAACAACCC AGCACCCATC ACTGTCGCGG      7380
     TATCAACTCC CAGATCTAGG CAGATGATCC TCCATCCCTG GCGCTGAGAA TCAGCCAGAA      7440
     TCCGTGTACC GTCCTCCATG CTGCGCGAAA GCCGGTCGAG CTTCGCCACC ATCAGCCCGT      7500
     CAAATGACCC ATCTTTCAAT GCTGCGAGTA GCTGCTGCAT CAAAGGCCTT TTCGTCATGG      7560
     TCGCCGCTGA GACCGCAAGC TCTTCAACCA GGGTCAGCTC ATACCCCTTT AGAAGAGCCT      7620
     CCCGTTCAAG TGCAGCCCGC TGCATTTCTG GACTGATGTC TTGCTTGTCC GTAGAAACTC      7680
     GAACGTATCC CGCGATCTTG AGTGGTCCAC TCTGTGCATC CTTCATGAGC TAACCGTACA      7740
     AAAAGGGGGC CCTTTATCTA CAGCTTTCAA TGGTTTCGAG TGCGAACTTT GCCGAACTTC      7800
     ACTGCGTAAG CCCAAACGGA CGTTTGGTAT AACGTGTGGT CATGAAGAGA ACCTACGCCG      7860
     TAATCACGGC GCTTGCTGCT GCGCTTAGCC TTGCCTCGTG CTCTGCCAAA ACTACGGACC      7920
     CGCTATCGGA GCTGCGCAGC GCGATCAACG CAGGAAAAGA ATGCCCCGAG CTGTTCCCGC      7980
     TCTTGAAAGC AATCCCTAAC TCCGATGAAG CGCAAGGAGA AATGCGCAAC ATCGGCTGCT      8040
     ACACCGTGTC ATCTACACGA ACCGATGCTG AACGATCTAA AACTGCTCCA AATAGCGATT      8100
     GGATTGGTGT CCCCGATGGC AAGCGCGTTG AGGTCTCGAA CGAATGTCTG GATGCATCAA      8160
     AGCAAGCCGC AAACGAAGTG AACTCCGACG CAGCAGAGCC GCTGATCCGG CGAACACTGG      8220
     AAGCGTGCCA GAGCACGAAC GAATGGTTGA GCGCGCTAGC GAAATACCCG GGCGTCATGG      8280
     GCATGGTTGA AGGGTACATT CCATCAGTAA CAGACATTGA AGTCGCATGT GGGGTTCATC      8340
     CGGATACTGC TGTTTGCAAG GATTACGGAA TGCTCGAAAC CGCTGGTTAA TTAGTGGCAC      8400
     ACTGTAGATC CTGGAATTCG GTATGAGCTG TGTCTGGTTA TCCTTCATCG TCCGCAGCGA      8460
     GGGGGATCTA GGATCTGTCG GCTAGGAGGA TTTGCAGGCC ATGCAACAAA TACGGCGGTA      8520
     CGAAGGCC                                                               8528
//

If you have problems or comments...

PBIL Back to PBIL home page