(data stored in ACNUC8465 zone)

HOGENOMDNA: ARTAR_2

ID   ARTAR_2; SV 1; empty ; DNA; empty ; PRO; 50407 BP.
XX
AC   NC_014549;
XX
PR   Project: 53509;
XX
DE   Arthrobacter arilaitensis Re117 plasmid pRE117-1, complete sequence.
XX
OS   Arthrobacter arilaitensis Re117
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Micrococcineae; Micrococcaceae; Arthrobacter.
XX
RN   [1]
RP   1-50407
RX   PUBMED; 21124797.
RA   Monnet,C., Loux,V., Gibrat,J.F., Spinnler,E., Barbe,V., Vacherie,B.,
RA   Gavory,F., Gourbeyre,E., Siguier,P., Chandler,M., Elleuch,R., Irlinger,F.
RA   and Vallaeys,T.;
RT   "The arthrobacter arilaitensis Re117 genome sequence reveals its genetic
RT   adaptation to the surface of cheese";
RL   PLoS ONE 5 (11), E15489 (2010)
XX
RN   [2]
RP   1-50407
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (04-OCT-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-50407
RA   Genoscope -,C.E.A.;
RT   "Direct Submission";
RL   Submitted (05-JUL-2010) Genoscope - Centre National de Sequencage : BP 191
RL   91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr - Web :
RL   www.genoscope.cns.fr)
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to FQ311475.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..50407
FT                   /strain="Re117"
FT                   /mol_type="genomic DNA"
FT                   /organism="Arthrobacter arilaitensis Re117"
FT                   /plasmid="pRE117-1"
FT                   /db_xref="taxon:861360"
FT   gene            128..508
FT                   /db_xref="GeneID:9795859"
FT                   /locus_tag="AARI_pI00010"
FT   CDS_pept        128..508
FT                   /function="3 Information pathways"
FT                   /gene_family="HOG000273054" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pI00010"
FT                   /codon_start="1"
FT                   /product="single-stranded DNA-binding protein"
FT                   /transl_table="11"
FT                   /note="identified by match to PF00436. The Escherichia coli
FT                   single-strand binding protein binds tightly to
FT                   single-stranded DNA (ss-DNA) and plays an important role in
FT                   DNA replication, recombination and repair. Closely related
FT                   variants of SSB are encoded in the genome of a variety of
FT                   large self-transmissible plasmids"
FT                   /db_xref="GI:308171844"
FT                   /db_xref="GeneID:9795859"
FT                   /translation="MKEKTMSHITRTGNLAATPELRQGERGAYTYARVIVTDRLRQEDG
FT                   SYADGPAIAYEVAVSGDQATNLVAAAQESGNIRVMFSGRYRVTEYKGQQGTRIKHEVNA
FT                   DEVAVSLRGQTVTAARNSRSSD"
FT                   /protein_id="YP_003915174.1"
FT   misc_feature    143..448
FT                   /note="Replication protein A, class 2b aminoacyl-tRNA
FT                   synthetases, and related proteins with
FT                   oligonucleotide/oligosaccharide (OB) fold; Region:
FT                   RPA_2b-aaRSs_OBF_like; cl09930"
FT                   /db_xref="CDD:186873"
FT                   /locus_tag="AARI_pI00010"
FT   gene            898..1395
FT                   /db_xref="GeneID:9795848"
FT                   /locus_tag="AARI_pI00020"
FT                   /pseudo
FT   misc_feature    898..1395
FT                   /note="C-terminal section of a putative plasmid partition
FT                   protein"
FT                   /db_xref="PSEUDO:CBQ74039.1"
FT                   /locus_tag="AARI_pI00020"
FT                   /pseudo
FT   gene            1392..1793
FT                   /db_xref="GeneID:9795830"
FT                   /locus_tag="AARI_pI00030"
FT   CDS_pept        1392..1793
FT                   /function="5.2 Protein of unknown function similar to
FT                   /gene_family="HOG000162247" [ FAMILY / ALN / TREE ]
FT                   proteins from other organisms"
FT                   /locus_tag="AARI_pI00030"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to protein SP:Q9X550 (Corynebacterium
FT                   glutamicum plasmid R-plasmid pAG1). Signal peptide
FT                   predicted by SignalP 3.0 HMM (probability: 1.000) with
FT                   cleavage site probability 0.700 between position 26 and 27"
FT                   /db_xref="GI:308171845"
FT                   /db_xref="GeneID:9795830"
FT                   /translation="MTRPTPRKSSLAGSSPVTPPQPAAQADPVPAASVPAAPATATRAV
FT                   APKPTDGKKKYPHKVSFYQDPEDTARVRGAILYTMTTEGNRNLSQFVNRAVMAEVERLE
FT                   AKYNNGEPFPSVGAREMPQGGAAAAGSED"
FT                   /protein_id="YP_003915175.1"
FT   gene            1797..2246
FT                   /db_xref="GeneID:9795855"
FT                   /locus_tag="AARI_pI00040"
FT   CDS_pept        1797..2246
FT                   /function="5.2 Protein of unknown function similar to
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   proteins from other organisms"
FT                   /locus_tag="AARI_pI00040"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to protein SP:Q9X549 (Corynebacterium
FT                   glutamicum plasmid R-plasmid pAG1). Match to PS51257:
FT                   prokaryotic membrane lipoprotein lipid attachment site
FT                   profile"
FT                   /db_xref="GI:308171846"
FT                   /db_xref="GeneID:9795855"
FT                   /translation="MRAHAAAAVALAGLLAGCASTPPEPATALVALGSGLEFQVEHART
FT                   ADEQRTGLAGRSELSEDQGILFSFASQSERQVWMAGMKFPLDVAWIADHRVIAVQTLEP
FT                   CTEVEQDRCPRWTSPNYVDALLEVRAGALAGIDAGTVVTIREENP"
FT                   /protein_id="YP_003915176.1"
FT   misc_feature    1908..2234
FT                   /note="Uncharacterized ACR, COG1430; Region: DUF192;
FT                   cl00627"
FT                   /db_xref="CDD:186112"
FT                   /locus_tag="AARI_pI00040"
FT   gene            2243..2995
FT                   /db_xref="GeneID:9795838"
FT                   /locus_tag="AARI_pI00050"
FT   CDS_pept        2243..2995
FT                   /function="5.2 Protein of unknown function similar to
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   proteins from other organisms"
FT                   /locus_tag="AARI_pI00050"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to protein SP:Q9X548 (Corynebacterium
FT                   glutamicum plasmid R-plasmid pAG1)"
FT                   /db_xref="GI:308171847"
FT                   /db_xref="GeneID:9795838"
FT                   /translation="MSATDPALTPAQPDTRPDYIAQAIAALTAAARTTRTIGAGTDNEH
FT                   TEPADFGEIACHVITSVAANLGGVDTLLAGRPGSWEADYVRQIVHSTTPEDELLTWRTE
FT                   PVRMHLDIEGVFYDFGLEQLWDEESGQAIKHEQDDSLTEEQVARADAIAASIDRLWKQD
FT                   QAAYREAYLASIRHELTRRGLTVEVEAIDEPADTLTWEPFADELHELARKNTPLPMTGE
FT                   APDWTEGTPADALRRAGLTYTARAQDAI"
FT                   /protein_id="YP_003915177.1"
FT   gene            3031..3249
FT                   /db_xref="GeneID:9795820"
FT                   /locus_tag="AARI_pI00060"
FT   CDS_pept        3031..3249
FT                   /function="3.5.2 Transcription regulation"
FT                   /gene_family="HOG000165862" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pI00060"
FT                   /codon_start="1"
FT                   /product="putative DNA-binding protein"
FT                   /transl_table="11"
FT                   /note="match to PF00376: MerR family regulatory protein"
FT                   /db_xref="GI:308171848"
FT                   /db_xref="GeneID:9795820"
FT                   /translation="MNDPEAVDDLITDLPEWATTEEIADLMRVKPQTVLKWNKEYGLKA
FT                   VSIGARVRRYRKKDVRDFLLTSDDNDE"
FT                   /protein_id="YP_003915178.1"
FT   gene            complement(3252..4565)
FT                   /db_xref="GeneID:9795834"
FT                   /locus_tag="AARI_pI00070"
FT   CDS_pept        complement(3252..4565)
FT                   /function="3.3 DNA recombination, and repair"
FT                   /gene_family="HOG000252172" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pI00070"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family PF00817. In
FT                   Escherichia coli, the gene products of the umuDC operon
FT                   play important roles in the ability to tolerate damage to
FT                   its DNA"
FT                   /db_xref="GI:308171849"
FT                   /db_xref="GeneID:9795834"
FT                   /translation="MPPSPLDSPAPPQRGEYIAHVDVNSFYVSCERVFDPKLEVRPVIV
FT                   LSNNDGCAVARSAEAKALGIEMGAPWFKLAADADRLGLVAKSSNYELYGEMSARVMKLL
FT                   GRFSAWVEVYSIDEAFLGVSGTVDELQALGEQIKSEVFRLTGLPVCVGIATSKTMAKMA
FT                   NKTAKHIKELGGVCVWDRAPAQTTESLLARLPVVEVWGIGPRLTKRLRGLGIWTAKDLR
FT                   NANEVRIRDKFSIVQMRTVLELRGIPCIPMEEERAIKDQLIFSRSFSDPITDRVGMEQV
FT                   MGIYAQQASARLHKHQKQAKILSAWAMTSYYNQHQDHQPAITVKLPGPTADPVVLTRAA
FT                   KQLLPQILIGVKYARAGVVVMDLQPCAMQETFDPFISAHEAKQIGPLIQQIRSEHGVKS
FT                   IGLGRAGLQQGPAWEMRREMMSPRYTTHWRELLTVKAA"
FT                   /product="UmuC-like protein"
FT                   /protein_id="YP_003915179.1"
FT   misc_feature    complement(3261..4511)
FT                   /note="DNA polymerase V subunit UmuC; Reviewed; Region:
FT                   umuC; PRK03609"
FT                   /db_xref="CDD:179607"
FT                   /locus_tag="AARI_pI00070"
FT   misc_feature    complement(3480..4511)
FT                   /note="umuC subunit of DNA Polymerase V; Region:
FT                   PolY_Pol_V_umuC; cd01700"
FT                   /db_xref="CDD:176454"
FT                   /locus_tag="AARI_pI00070"
FT   misc_feature    complement(order(4062..4064,4212..4217,4383..4385,
FT                   4392..4394,4485..4490,4497..4502))
FT                   /note="active site"
FT                   /db_xref="CDD:176454"
FT                   /locus_tag="AARI_pI00070"
FT   misc_feature    complement(order(3612..3614,3618..3623,3627..3635,
FT                   3690..3692,3771..3788,3861..3863,3948..3968,4212..4214,
FT                   4221..4223))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176454"
FT                   /locus_tag="AARI_pI00070"
FT   gene            complement(4547..4978)
FT                   /db_xref="GeneID:9795864"
FT                   /locus_tag="AARI_pI00080"
FT   CDS_pept        complement(4547..4978)
FT                   /function="3.3 DNA recombination, and repair"
FT                   /gene_family="HOG000232166" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="AARI_pI00080"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="in Escherichia coli, the gene products of the umuDC
FT                   operon play important roles in the ability to tolerate
FT                   damage to its DNA"
FT                   /db_xref="GI:308171850"
FT                   /db_xref="GeneID:9795864"
FT                   /translation="MKVDRIQVCELVDPPQRVLAMALDRVPAGYPSPAQDYSDTKIDLS
FT                   EMLIRDQVSTFIVRVSGESMQGAGISDGDELIVDRSVQPRDGHVVIAVIDGEMTVKRLS
FT                   TGPAGVVLKAENPDYPDLRVAELSDFRIWGVATTCLHHL"
FT                   /product="UmuD-like protein"
FT                   /protein_id="YP_003915180.1"
FT   misc_feature    complement(4568..4813)
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA (...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="AARI_pI00080"
FT   misc_feature    complement(order(4676..4678,4787..4789))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="AARI_pI00080"
FT   gene            complement(7258..10341)
FT                   /db_xref="GeneID:9795861"
FT                   /locus_tag="AARI_pI00090"