(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_1

ID   ASFUM1_1; SV 1; linear; genomic DNA; GRV; FUN; 4918979 BP.
XX
AC   CM000169_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   1, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000169.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4918979
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 1"
FT                   /db_xref="taxon:330879"
FT   CDS_pept        <216..836
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751781"
FT                   /orf_name="AFUA_1G00100"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /protein_id="EBA27323.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000F51A7D"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9R7"
FT                   /transl_table=1
FT                   /translation="MSVRQVPKQRRTLIEFSAFKEVPCMLFCVAMFFGYIGFFNPIFYI
FT                   EAFAIQKHAMGETLAFHLISILNATSVPGRIVPGILGLRFGPLNILLGSAIISGILSLC
FT                   WIAIYNAGPLIVLAVLYGFSGAFVSLLAVALTTLNLNLQTLRTRMGMCSLLCGFGSLCR
FT                   APVAGAVLDNTRSYLGVQLYSGLTIGTTGVLLFFANHLKRRTN"
FT   CDS_pept        join(3952..4253,4774..4963)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267167"
FT                   /orf_name="AFUA_1G00110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87725.1"
FT                   /db_xref="HOGENOM:HBG050839"
FT                   /db_xref="UniParc:UPI000051EA25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL57"
FT                   /transl_table=1
FT                   /translation="MHSWIDIPLRDGKDADEWELTESKAIANIDQWYQEGRLLFPRDSL
FT                   QEVRDQLRKPLKKGDSIYVKGFDGSMYEWPVKTGNIKTHWEADNNTGEEKQVDWMLLVL
FT                   EKSDIKVLEDPEGFLEMDDASLVFSCSPNICVKEIVVDIARPLALIWCTVKDKDPEHAL
FT                   "
FT   CDS_pept        join(complement(7262..7472),complement(6900..7127),
FT                   complement(6805..6881))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751782"
FT                   /orf_name="AFUA_1G00120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87726.1"
FT                   /db_xref="HOGENOM:HBG051357"
FT                   /db_xref="UniParc:UPI000051F619"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL56"
FT                   /transl_table=1
FT                   /translation="MTAIHNKSQKQSWNLSWNLSWNLSWNLSWNQSWNQSWNLSWNLSW
FT                   NQSRKHNQEYKTMSGHRPAQKRKERNLLAHAKIYVFATIYLVDALREQCLKSLHRDLSN
FT                   FVLNRQTITNVLDLLEYTYDHTGRQEPGGRCSLRTLVIHYISFENTRFRRILDDHGGMA
FT                   SDLVGEAC"
FT   CDS_pept        join(10218..10605,10745..11106)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267168"
FT                   /orf_name="AFUA_1G00130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87727.1"
FT                   /db_xref="HOGENOM:HBG051436"
FT                   /db_xref="UniParc:UPI00005206B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL55"
FT                   /transl_table=1
FT                   /translation="MLCHGSKFGGGGRNDRWGTALQLLRVSCGIGDCVLRAYSRRDSTT
FT                   ASGRWTHTGYQRRAVGKAQDTRCLIITSHSADVDSNMGLSPVFSNMLRVELEYTTFRAA
FT                   YVWLEFSAGRRFFSSAGGTVCAITTALTGVFALFSEIASWFDAVLLASAGTTSCPVRLG
FT                   NGSAIIQVYGLTKGMSALGIGPVLTRFIYQRAAWTALVLLLASVSIASTIPTALWMGRE
FT                   VKRWPGGREGEKDVGEQEEDVTYASQF"
FT   mobile_element  13066..14640
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(25442..26442,26531..27017)
FT                   /codon_start=1
FT                   /gene_family="HOG000217829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267169"
FT                   /orf_name="AFUA_1G00150"
FT                   /product="IBR finger domain protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL87729.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG024130"
FT                   /db_xref="HOGENOM:HBG051585"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000051F87A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL53"
FT                   /transl_table=1
FT                   /translation="MAFVLAPEIDQPTADLLIQLQLQDAGLYFESSKGKSRDPTDEELA
FT                   FQLQNEELEIISQLLADRRMATSFAAAVQADGCIVAVNQMEEENACKDRDIARQWTENG
FT                   CLESSADLESNPATLDDETLAKLQILYVSGMEGYHNIGVMGGGDSETEQAESSAWAARR
FT                   TGQSLSPMRRCVACREQTEFVNVARVPCQHEYCRPCLEDLFKASLTDESLFPPRCCRQP
FT                   INMNIARIFLKSDLIEQYEKKKIEFETPNRTYCYYSECGAFINTSHINGEVATCPCCRH
FT                   TTCTNCKGRAHMGDCPNDTAMQQLLATAQENGWQRCYSCWRMVELDHGCNHMTCRCGAQ
FT                   FCYNCGAQWKNCRCEQWDERRLLARAYQLIDREEEQPLAANPPPDIDEPPLEDHLVPET
FT                   DESHLESQETQPEQSDEESHAALGASASPYFQTPRDILVARTIQELRENHECVHDRWKY
FT                   ISGPHRCEECSYFLREYIFECRQCRIQACNRCRRNRL"
FT   CDS_pept        29598..29981
FT                   /codon_start=1
FT                   /gene_family="HOG000048668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267170"
FT                   /orf_name="AFUA_1G00160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87730.1"
FT                   /db_xref="HOGENOM:HBG051663"
FT                   /db_xref="UniParc:UPI000051F8AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL52"
FT                   /transl_table=1
FT                   /translation="MDQYSPTSLYSIAEEVTPQDHGILCGGGTSSNLERLPSRLQRSKT
FT                   TSRSMKKQIEDLAYEVSYLKAELLWHSESKQALLQLQEQMYQLFHKMEDALIQVTTRLQ
FT                   EAEQRYLGLWGITPNANTEEGVI"
FT   CDS_pept        join(30280..30343,30401..30489,30540..30636,30664..30782)
FT                   /codon_start=1
FT                   /gene_family="HOG000048573" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751783"
FT                   /orf_name="AFUA_1G00170"
FT                   /product="DUF614 domain protein"
FT                   /protein_id="EAL87731.1"
FT                   /db_xref="HOGENOM:HBG051734"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI000052043F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL51"
FT                   /transl_table=1
FT                   /translation="MAQENVSWQRGVCDCSSSCDVCLCATFTPCCLFNRIGTQFKGHDA
FT                   QSCGWDCCMYFSVGCVLGLPCIPLGFRRYAIRNEYKIKAWCCSCCVLHQLDWETKHRPS
FT                   AQQEGYQRPSGMAYNTRK"
FT   CDS_pept        join(31560..31677,31712..32325)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267171"
FT                   /orf_name="AFUA_1G00180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87732.1"
FT                   /db_xref="HOGENOM:HBG051796"
FT                   /db_xref="UniParc:UPI000051FD68"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL50"
FT                   /transl_table=1
FT                   /translation="MSADYPPVCLFPAQSSVNFSLFHPFPIMLLAIVESHKGKSSWQPK
FT                   PQTSSPVATTATNPISSFTHSLIRTSSASTTRIVPQHTATTSSRSFTQMVLVEPADSHS
FT                   LKFHPGNIVKFSPRTLDVSVGDTVWFYSLNGSFILYNTTLEAPCTRLVRYGDDAYKRVI
FT                   FQVNSTEPLFLIGSQDHDIYSCCPSNYFALNPGAQKDQFFHSIGRICQVVSVTHPSNVY
FT                   PTMTGTIVVEPNGDVITTLGV"
FT   CDS_pept        complement(36279..37475)
FT                   /codon_start=1
FT                   /gene_family="HOG000048666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903881"
FT                   /orf_name="AFUA_1G00200"
FT                   /product="F-box domain and ankyrin repeat protein "
FT                   /protein_id="EAL87734.1"
FT                   /db_xref="HOGENOM:HBG050840"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000520684"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL48"
FT                   /transl_table=1
FT                   /translation="MCLLNLPPELFWCIVENLEEARHILSLARVNKQLHNKVYPCLYRF
FT                   NVKRQKSSAMIWAAEKENLHAIRSLLRYQADVNVRDDRGRTPIFYAIRSRNETVVKALL
FT                   EQNTIDIACQDPHGYSPLNYAASTNFLFATSMLLDKGANMNTANRHGWTPLNWAAEQGN
FT                   TAMVDVLLKKLSSTPPLPSAEIEQSNSWSLHIAAGAGNLGILKRLLAHGYDVNTKDSEQ
FT                   QTPLSLAVRKGYLKVVSLLLCQRDIDINVADTQGMTPIWLATRYRRDEIARRLLAIPDL
FT                   DVNAAATERIVGVGREMSTSLHHAVKRGCLWIARLLVANDQLDPNVTDHLLRTPLHWAA
FT                   DKGNLEMVNLLLSRQDVMLNAEDIDKSTPLMLAVIRDHTDVAKRLARASRRYQQSEWS"
FT   CDS_pept        join(42471..43081,43483..44125)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903882"
FT                   /orf_name="AFUA_1G00210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87735.1"
FT                   /db_xref="HOGENOM:HBG050915"
FT                   /db_xref="UniParc:UPI000051F3C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL47"
FT                   /transl_table=1
FT                   /translation="MASRRFLFEGDDAQYIRFLEDIVQRSGLVPPLAPSTQKDGNDPQP
FT                   CEHLRGIDTHTPPASEDERTASQELQIIQIDPSKNRSGSRTRPNTERWKKELDEFIGRV
FT                   CDINNLELRRKELGLGDNQAVITSLIKGFAFADDRLNTSDFSLSDSSLLRTLSNYAQFT
FT                   KKSTDVLSCLAHFRDLVFVSFCDVVLGCGEGKDKVHDAMRLLAVISDILGYDRNCTLEW
FT                   LRQYYAGRFSNHHITSFSFPSLNERNPKRKRDHMSKSQANKRNGTQRSPRQEEPDGGSN
FT                   RVPDNLVISYTRPSNHDARPADGTALVELTGGQQGESNSPDALFTTYSQDGDTQRTGVD
FT                   PVHDALPSAPCPGAEQFVDLAQHQTTEPHYPSVFLGDGNLPQVAHPLQTAYTYDFYNFL
FT                   STSPDWNSVGYDFSSNFR"
FT   CDS_pept        join(47313..49189,49208..49481)
FT                   /codon_start=1
FT                   /gene_family="HOG000169975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208462"
FT                   /orf_name="AFUA_1G00220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87736.1"
FT                   /db_xref="HOGENOM:HBG050992"
FT                   /db_xref="UniParc:UPI000051E7E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL46"
FT                   /transl_table=1
FT                   /translation="MSDIIRPSKETYDSVLCESYNLWLSYLDADDSGTLPFHCIELRNI
FT                   LSQTPSFLAHGIRPANESLSFDCVEKGTPPGPYDLLVKGKSKWETSNGLCDLEPKIAPH
FT                   QLLLATQTPLKVEFAEQTPFTEWPIVQGLYGHDEGNYVTVLFLAWAYILSVRWTELLSR
FT                   SSDHQCTVEYKMNGTIAKSRGKYDMKVAIGDDIEESEARWWRAILVGDKGWRITTDYKD
FT                   KTYISPWSVSIQNGTLSHSSPIMCNNNPAPPSSETALKYLAKFCAHHRLYGQCSAALAA
FT                   TLYIPLLGGRLATLPVPKPATTSITRIQNPASFAFPRTQPSHMELVGEYGKFLSAYMTL
FT                   SSDVWGMRSLLCSTFFNADIECNLVSAWLNPAFAVIDPILRNGDMAKLAAVLGRRQPRL
FT                   ATLWLGAIIMGMAKSELRDIKNGLTAVDLHAAAWTGTTQSFITLNPGASDGRTIRREDE
FT                   CRLLFLTSSNEHARAPTTPWKPFGESHLCDTELEVQKHALCNCHCFRYNAWYWCLTNGA
FT                   ELRDPGLGQVTADKTELNIGKARGSPPTLRYCHSSSQSLSEGATRGIFEWLRMTGYPPR
FT                   EKPLYQHPWLDIESSDESDLDSADSNCGQSAGSSTRSIQKWIEAIDSTPEDALLDCQVY
FT                   VLLETVWSTSRVILAFGTYSIFATILWAAMITSLTNFPLFPAVRLLADVSPMPVVPMIA
FT                   SAVPTGAAGTRTRRHRGWKVVF"
FT   CDS_pept        complement(55776..58055)
FT                   /codon_start=1
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057135"
FT                   /orf_name="AFUA_1G00230"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87737.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG051064"
FT                   /db_xref="HOGENOM:HBG332506"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051EEC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL45"
FT                   /transl_table=1
FT                   /translation="MSGSSSPDYKELFLKAEEERKWAEERQRQAEEREKQADEERRLAE
FT                   ERQRQAEERQRQAEERQRQAEEREWQERERNRPTTFSEFIRHCHDLLWRPLRAQTPSRS
FT                   TTGKIPSPTGKYCPIRLLPWTEREARQREIYESVCRYLQPTEEDAQQLFTPLVALEDHG
FT                   RRFARRPISSEQDLETYERLAVEDHVHDIVTELCKIPDAREEFRLGSGVWFDNHANALD
FT                   EDDETDASQPSTTKPSKPDQFCIHRVDGATSTLLTTVEYKPPHKLSVAVLREGLRPIDF
FT                   WHEIVEPDTVPTEEPEKSRYNAARLVGSAIVQEFHVMIQEGLEYSYLTNGLMDVQLWVP
FT                   YDDPTTLYYDLGDPSMYRTEGVGRLRAPMTRIERTLCLCLMSFRTPLRDQAWRNAAKAR
FT                   LPIWHTSFDSERSQIPAAELPQDASVDYAGSEYTTPEQTTSEYVPSSSPAGSPVTKGRR
FT                   VTTRAASGCAPSSDQHHQEDSSDSEVDPAASAGRKRGFSQVTSSPSTQRSAPRTDSQRY
FT                   QSGQSRPHVAQYCTQKCLLGLQQAGTLDADCPNTKLHTLGGSDVRHLISAEDLVKKLKA
FT                   QLDQDLDHNCTPIGHCGSYGAPFKITCATFGYTIVGKGTTSKRWKKVSREAEVYRVLQR
FT                   AQGSAVPVFLGAINLAQVYFLHAAGEIRHMLLMGWGGESVEHITLDKTIQRAISRSVRE
FT                   IRSLGVSHQDLRPENILWNAELKRALIIDFHRCTLDPRPMHKRPGSLKRLRCEPEERES
FT                   KRLRVA"
FT   CDS_pept        join(complement(61154..63246),complement(60909..61095))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267172"
FT                   /orf_name="AFUA_1G00250"
FT                   /product="Serine-rich protein, putative "
FT                   /protein_id="EAL87739.2"
FT                   /db_xref="HOGENOM:HBG051206"
FT                   /db_xref="UniParc:UPI0000F51A49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL43"
FT                   /transl_table=1
FT                   /translation="MATDLFSGSVSISTHAFASSSIPGPSMTLEDNAAFALPSPRIPGI
FT                   TRPTTVHSQDNYPASTFTVDSPTTSRRAIMESPFTEIRSVQIPISPSSPHATSTPPTMS
FT                   RSHSQRTDIMTNETLDTSATALSNRPFSVTDAANQELSRQSLDMTSAASRISRNDEMSL
FT                   TTYLPSAYYSSSASTASEIVVDSTLSLGQSSLDTENSQLNSELIISVTPTAQESVSHVE
FT                   SQYAKTSEMGSTGLGSLTVDSVNLSTLAASRPDERSDDFELPSSMAVSSMRAESSAQRI
FT                   TEQPITMSAPRINASQPGTRKMSSGTPSRGVDETASGSVSQEGTASGSSRSGFSRELSS
FT                   TTTLGGWNTGEITFSTRDESVAATRTRTSSIADTVSDGSAHQSLDGTSVASRISPTSEM
FT                   GSTTGLSSAYYRSPASSAHGTLGGSTLSQGQPSRSSAPPTSDDEPIISTTDIVRSEIPS
FT                   LVDSQLTTTSKLENNRVVAPIGNENEPTSMASKLSETSDFEEKSLSSVSTAAGSWTPGI
FT                   SVQLVTMGTSPDNISELFESANRSLSREGGAENGQTPKGTATSGASISASVGEESSVAT
FT                   LSHSSTTFENFVVTTVKHLNEENSEAISLQLATVSRPSRLDRGGRLTGGHPTGNTTHIQ
FT                   NDHPIVPTQPTQPSQSAEYEDFRVTVLLSPSSHNSIANLSPPSSLSMHLHALTKPIPTR
FT                   SDSTLLIPGDCQPHYHGNTATLETFNQSLPLKYRVTNHCPMLVLVPLGRLVGTQMLYIR
FT                   HHNRSV"
FT   CDS_pept        73193..73708
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208463"
FT                   /orf_name="AFUA_1G00270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87741.1"
FT                   /db_xref="HOGENOM:HBG051334"
FT                   /db_xref="UniParc:UPI000051FFBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL41"
FT                   /transl_table=1
FT                   /translation="MSHTDGQTILRNERHMLSKEATAALFAEINKKPDFVFDALELCDA
FT                   TASYVEATVKVPEDARFIDNWGIIGILFYQVMSKISGGEKIRNTNTYYRDIQNCVRPGA
FT                   VLVLMAHRVGESLLEARISSVEGSLIATTSATYSTSFATGDRRKLLAPPIDFDATSPRN
FT                   ATPRNLTP"
FT   CDS_pept        join(74434..74740,74794..76331)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268226"
FT                   /orf_name="AFUA_1G00280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87742.1"
FT                   /db_xref="HOGENOM:HBG051343"
FT                   /db_xref="UniParc:UPI000051F16B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL40"
FT                   /transl_table=1
FT                   /translation="MADEFPRTAAYKKLVDKGLIKVDKDLPQYVQDVSKDLQGNARTGE
FT                   LEDAIAKVCKRIREIDSSEVFDVEGFEGNRQEAKDFLLDVLALAEKGGIEGAGDAVKKV
FT                   SSTNITDGSDNDSEKESDGKENEEKKEKEKQEKEKQEKEKQEKEKQEKEKQEKEKKEKK
FT                   EKEKKKKVSDDDSDSEYGSEYTPGSRGRGRSATPMNDEVREQLESRLKEYYDKAIEALR
FT                   KYICGDKASKEDLRALNNNIRSDAAQLLKCKPEDTTNFTIPFDELKKMISKEVVTAPED
FT                   AQSDEYAEKLGEAKIKLYYLCRNHNIPQKWLSGLLVDSANDGATYEYRSIYNKENRSAT
FT                   EYWPYRTLQGNGFLVLFEKKKRSQKGEQSSFGVQVFDVQSKKFRVEMRKSIGSEVLNEW
FT                   RGLNGTYKFSAADRKHSKDKDGEIEEVFFYTMTQKQTSVAHSSQPAHAEVCVKFAKSIW
FT                   PRIIPKCDVQKLLPADEEVDNILEGLAKRDHMLLPREFAPNSVKIPMRPKRDGMPEVRL
FT                   DQALKWRNITPIDPSVSNYSRDSVPPDFDIPRQTRESTFSPNYDNGLGRLRNEFDEKFS
FT                   KLNSRMDHLEESVVTAEYLDNRFNQFFRQISEKLESRF"
FT   CDS_pept        join(complement(85622..85698),complement(85284..85576),
FT                   complement(84772..85232),complement(84626..84741),
FT                   complement(84231..84576))
FT                   /codon_start=1
FT                   /gene_family="HOG000194647" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904116"
FT                   /orf_name="AFUA_1G00310"
FT                   /product="Class V chitinase, putative "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitin binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="EAL87745.2"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG051364"
FT                   /db_xref="HOGENOM:HBG323847"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="UniParc:UPI0000F51A9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL37"
FT                   /transl_table=1
FT                   /translation="MLRVLLQCLLAAPVALGLRFAMYIDEYHTVDLPGSDRTEGITHAI
FT                   MAFANSTIFNSDSPPKFVPFEPVETLRKRFGPDTKVMVAIGGWGDTKGFSEGAKDDASR
FT                   ARYAKNVATMIEDLGIDGVDIDWEYPGGNGGDYIEVPNGRKIDEVELYPLFLQAIREAI
FT                   GPDKLLSISVPGKSADMIAFTKEQSAKIWPSVDMVNVMSYDLMNRRDKVTNHHTSVVGS
FT                   LDAIKAYEEIGLDTAKINLGFAYYAKWFMTDPKSNCNEHPLGCGVLALENPDGSDKSAM
FT                   AAAPGNLKVSADGTCGFSKGTKCPAGSCCSQYGYCGTGNDFCQAGCLSDYGECKGISVI
FT                   DSWRRASKGGKTDEQAGGQYFWDKQASLFWTWDTPELITRKFKEIVDAEKLGGVMAWSL
FT                   GEDSLSWEHLKAMQDCLRGRSIDQNSPASCA"
FT   CDS_pept        join(87064..87376,87435..87622,87763..87900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057386"
FT                   /orf_name="AFUA_1G00320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87746.1"
FT                   /db_xref="HOGENOM:HBG051375"
FT                   /db_xref="UniParc:UPI000051F8AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL36"
FT                   /transl_table=1
FT                   /translation="MAPNRRGDTIENPIPIDYEHPGTVGRETSSEKTGFPIMAEGREGP
FT                   SHGLPLNDFVEDDQVTVDTEVATPPPTLTEDMVGGALHHQPPDIERDQEPEATDLGFPP
FT                   ESTIATTDGEHMYRQSAIDVSQDTDPVHPVGPIPPNKVPESASTPRRPVTSNYSGCNAS
FT                   DSSATMAFLKYNFEFQTLGRERGLPQNLSLLSTMGLVKILGLSPGTQKE"
FT   CDS_pept        join(88949..89018,89067..89191)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752005"
FT                   /orf_name="AFUA_1G00330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87747.1"
FT                   /db_xref="HOGENOM:HBG051384"
FT                   /db_xref="UniParc:UPI000051EC7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL35"
FT                   /transl_table=1
FT                   /translation="MFSDEECDSSVRLDDCQQPGDSIDNPTDLDAATTVACNTGTIDNL
FT                   SDRLHQMECVIDGKNEFPP"
FT   CDS_pept        complement(90835..91227)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268227"
FT                   /orf_name="AFUA_1G00340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87748.1"
FT                   /db_xref="HOGENOM:HBG051392"
FT                   /db_xref="UniParc:UPI0000520909"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL34"
FT                   /transl_table=1
FT                   /translation="MAGDSYRMTDFKLSRDERIRLYLASIVADPKYSGFDTQMLRTVEY
FT                   IGAHAETRTTVFEFEVADSMCNKDVLQGGAASTMFDNISSTSLFTIGQPCYWDRLGVSW
FT                   SLSVWFHHPISSGARMRLVNTVVDAG"
FT   CDS_pept        join(complement(96396..96601),complement(96117..96351),
FT                   complement(95322..96066),complement(95208..95275),
FT                   complement(94948..95157))
FT                   /codon_start=1
FT                   /gene_family="HOG000217228" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268228"
FT                   /orf_name="AFUA_1G00350"
FT                   /product="Metalloreductase, putative "
FT                   /EC_number="1.16.1.-"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87749.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051196"
FT                   /db_xref="HOGENOM:HBG323858"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0000F51A33"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL33"
FT                   /transl_table=1
FT                   /translation="MEFMTLYAIVAGGIFLLLVLVRIAPSFEPLAEALSRWVAKHLAYP
FT                   YLLGRHRLIGPWTRLAVFFPLRMDEIGRRAGTLSLLNMALLYPFMQLGLFADVLGLSFD
FT                   TCRRVHGAAAWMASALLALHIVVAMLDQQTFSLHEQNNLFAVIGAGSLVALMLFSLSLF
FT                   RRLSFELFLRTHQALAAVCIYMTWRHLPSESIFPRVYLYIPLAILLLSTFVHVLLFLYR
FT                   NGILPSRTYPYASVMCRKKSKNTEGSDEDPAEGAPLKIRVALPRPMHVKAGQYVNLWMP
FT                   SVSFSSWLQCHPFMVTSWSPGRQDVLDLFVQARHGLTEKLRARAPLEGTASFTAFVSGP
FT                   YGRSEPVGEYESVLAVASGFGIAGVVPYIKRLLYGYNTSSVRVRRVHLVWQVQTIDIAV
FT                   AAEPLLNSLLDDDVLDDGYILEMSFYVEYKSKAGKGRPFGDHHRATIYNGFPDYDSIIS
FT                   TEASGEHIERVSNSQEERGKLLVLSELVH"
FT   mobile_element  complement(117795..118793)
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   mobile_element  complement(118952..119791)
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   CDS_pept        join(128569..128793,128908..129183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752006"
FT                   /orf_name="AFUA_1G00400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87754.1"
FT                   /db_xref="HOGENOM:HBG051437"
FT                   /db_xref="UniParc:UPI000051FD72"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL28"
FT                   /transl_table=1
FT                   /translation="MLKSTEIKAITSEILGLYTPALELRAAKTLELDGVGDMELLAVGI
FT                   DLMSGVLVVFPGIAVVDILPSVGVNVNAREYQLWFGVCPSEMDSEGVALDLKIVPLSEM
FT                   GTGAGITVQAVAKLLTPTVVLVVRTSLSVSQVMAWRLKSPLISRQIQHLANNVLTIKER
FT                   RAA"
FT   CDS_pept        join(135528..135876,135935..136039,136105..136221,
FT                   136291..136414,136483..136498,136546..136662,
FT                   136719..136769,136832..136985,137052..137110,
FT                   137212..137391,137440..137781)
FT                   /codon_start=1
FT                   /gene_family="HOG000157125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057387"
FT                   /orf_name="AFUA_1G00420"
FT                   /product="Carboxypeptidase S1, putative "
FT                   /EC_number="3.4.16.-"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL87756.2"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG051456"
FT                   /db_xref="HOGENOM:HBG323860"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI0000F51A7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL26"
FT                   /transl_table=1
FT                   /translation="MRGYGLISLLPVAAAIWAPAIHQLVTVDKRQLPKDPTGVKTIHTA
FT                   NNITIRYKEPGKEGVCETTPGVKSYSGYVDISPESHTFFWFFEARHDPKNAPITLWLNG
FT                   GPGSDSLIRLFEELGPCRINSTLDSTINPHSWTEVSNVLFLSQPLGVGFSYSEAEPGSL
FT                   NPFTGVFENASSAGIQGQYPVIDATLIDTTDLATHAAWEILQGFMGGLPQLDHRIKLKD
FT                   FSLWTESYGGHYGPAFFNYFHEQNEKIANGTVEGIHLNFNSLGIINGIIDEGIQASYYP
FT                   EFAVNNTYGIKLVNDTVYNYMKFANQMPNSCQDQIGYCKQTNRTSLADYAICSEATNMC
FT                   RDNVEGPYYAFGNRGVYDIRHPSKDPTPESYYVDYLKKDWVMNAIGVNINYTQSNNDVY
FT                   YAFQQTGDFVWPNFLEDLEEILKLPFGGEAVSLAVNYTHTEQFRAAGYTPMVVDGVEYG
FT                   ETREYGNFSFTRVYQAGHEVPYYQPVASLQLFNRTLFGWDIAKGTTKIGPNYSTSGKAK
FT                   ATHTESSVPLPTATPSTSVH"
FT   CDS_pept        join(complement(139503..140093),complement(138835..139442),
FT                   complement(138662..138757),complement(138359..138596))
FT                   /codon_start=1
FT                   /gene_family="HOG000157110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268229"
FT                   /orf_name="AFUA_1G00440"
FT                   /product="DUF895 domain membrane protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87758.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG174880"
FT                   /db_xref="HOGENOM:HBG323845"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F61A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL24"
FT                   /transl_table=1
FT                   /translation="MASEKPEDGHQPEKEGPAITADPEPGRHGAITGKPWMYKPLKIGP
FT                   LTLPWFASPEVQLVLVSFVCFLCPGIFNAVNGLGGGGQVNRTDTSNANTALYSTFAVVG
FT                   FFAGSIANRIGLQLTLSFGGFGYFLYVASLLSYNHNKNAGFLIFAGALLGVCAGLLWCA
FT                   QGAVMMSYPRENEKGKFIAIFWVIFNLGGVIGCLIPLGQNLHSSAGTVNDGTYIAFMVL
FT                   MALGFVLAWFLSDSKYVVRKDGSRVISMKNPTWKSELLGLYETLRTDYYIVLFFPLFLV
FT                   SNWFYGYHFNSVNGAYFNIRTWSLNSLLYWLMQMVGAFVFGKLLDLQFLSQSMRAKLNW
FT                   LILLVITMGVWGSGYAFQKQYTLETAKQDVDFTSHGYVSPMFLYMFYGFYDAAFQTCAY
FT                   WFMGSLTNNSRKLANFAGFYKGIQSAGAAGMWRMDAEKTPFMTQFASCWGLLVGSLLIA
FT                   SPIIFFKIKDHVDVEEDLKFSDETNKDVTSIAIEDHRDSTKGESVTKHVSAS"
FT   CDS_pept        join(143117..143488,143546..144466)
FT                   /codon_start=1
FT                   /gene_family="HOG000275010" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268230"
FT                   /orf_name="AFUA_1G00450"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase
FT                   (NagA), putative"
FT                   /EC_number="3.5.1.25"
FT                   /function="N-acetylglucosamine-6-phosphate deacetylase
FT                   activity"
FT                   /biological_process="N-acetylglucosamine metabolic process "
FT                   /protein_id="EAL87759.1"
FT                   /db_xref="GO:0006044"
FT                   /db_xref="GO:0008448"
FT                   /db_xref="HOGENOM:HBG319223"
FT                   /db_xref="HOGENOM:HBG464950"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI00005201DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL23"
FT                   /transl_table=1
FT                   /translation="MPGKTTTTPRITKFTNCRIVKGSELVEQDVWIDSLSGKILKDQEA
FT                   FYGLHLSPDEVVDLGGRILAPGLIDVQLNGAQGFDFSVPQASKEEYNEGLRLVNKGLAR
FT                   TGVTSYLPTVVSSTPEVYWKVLPSLGPSGSNHRPEDGAESLGAHVEGPFINLNRNGIHK
FT                   TEVLRAAQNFEDLEECYGKENLTGSSKSVKMITVAPEVGNMVSTIPSLTSAGIVCSIGH
FT                   SDATFEQALSATTAGATMVTHMFNAMRPFYHRNPGIFGLLGQSEHYRPFYSIIADGIHL
FT                   HPTSIKIAYNAHPDGLVLVTDAMKLCGLPDGVYDWMNGERIIKTGACLTLEGSDKIAGS
FT                   SATLIECINNFRRWSGASIADAINAATATPARLLGLQGVKGSLDSGADADLVVLSEEDD
FT                   PESPTLTVCQVWKRGVKIHDSDKEIASTTTV"
FT   CDS_pept        join(148615..149099,149205..150219)
FT                   /codon_start=1
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208701"
FT                   /orf_name="AFUA_1G00470"
FT                   /product="Betaine aldehyde dehydrogenase, putative "
FT                   /EC_number="1.2.1.8"
FT                   /function="betaine-aldehyde dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87761.1"
FT                   /db_xref="GO:0008802"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051EC92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL21"
FT                   /transl_table=1
FT                   /translation="MADLPFAPCHPYYDGKVQLASSGRTFRTINPANNTPLAEIHVASN
FT                   SDTDAAIAAADRAFPLWSQTPHITRARILQKAAALLRERNDELARLKTLDSGKAYSETS
FT                   TVNIVTSADVLEYYANLVGGGGLNGETTQLREDAWVFTKKAPLGVCVGISAWNYPLQIA
FT                   LWKSAPCLTAGNTMVYKPSEYTPLHAQMLAEIYREAGLPPGVFNVVYGAGDVGAYLTAH
FT                   PLVAKVSFTGQVSTGMKVAGSAAGQMKYVTMELGGKSPLLILPDADLENAVNGAMMANF
FT                   FSTGQVCTNGTQVFVPRGMKSAFKKALLDKMQYIRPGPLFDNATNFGPLSSALHLEKVT
FT                   SYIRHGIETDKATLLYGGLGKPSLPKDLENGFWVRPTVFTDCTDSMRIVQEEIFGPVMS
FT                   ILYYDTVEEAVRRANNTELGLAAGVFTRDLNMAHRIIDQLQAGITWINSWGESPAEMAV
FT                   GGWKKSGVGVENGRRGIEAWVRNKSTLVDMNGRVATVFAKL"
FT   CDS_pept        join(complement(151916..151994),complement(151700..151848),
FT                   complement(150773..151636))
FT                   /codon_start=1
FT                   /gene_family="HOG000064979" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268231"
FT                   /orf_name="AFUA_1G00480"
FT                   /product="Glucosamine-6-phosphate deaminase, putative "
FT                   /EC_number="3.5.99.6"
FT                   /function="glucosamine-6-phosphate deaminase activity "
FT                   /function="hydrolase activity"
FT                   /biological_process="N-acetylglucosamine metabolic process "
FT                   /protein_id="EAL87762.1"
FT                   /db_xref="GO:0004342"
FT                   /db_xref="GO:0006044"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051497"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="UniParc:UPI000051F632"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL20"
FT                   /transl_table=1
FT                   /translation="MSVGELSSGRTLSRRRNISRTISSVRCRIKAFKPTQDRPFVLGLP
FT                   TGSSPEIIYRTLVQRHRTGEISFKNVVTFNMDEYVGLPRDHPESYHSFMYKHFFSHVDI
FT                   PPQNINILDGNAPDLAAECASYEARIAGYGGIELFLGGVGADGHIAFNEPGSSLSSRTR
FT                   VKTLAYDTILANSRFFDNDVDKVPRMALTVGIQTIMEAREVVIVATGAHKALALKKGLE
FT                   GGVNHMWTLSALQLHQHPLVVCDRDATLELKVKTVRYFESIEQSGTDARTQGPPLVYRP
FT                   RTYVPAPLGAGKLPHQLTPASTPSKVPKDLRINTEFQNSIEEDELTPDSMSSRLVDSAI
FT                   GGLDTTLKADIMFDRMGARVVSH"
FT   CDS_pept        join(153030..153204,153279..153382,153434..153505,
FT                   153569..154648)
FT                   /codon_start=1
FT                   /gene_family="HOG000281564" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268232"
FT                   /orf_name="AFUA_1G00490"
FT                   /product="Biotin-dependent 2-oxo acid dehydrogenases
FT                   acyltransferase, putative"
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="cofactor binding"
FT                   /function="dihydrolipoyllysine-residue (2-
FT                   methylpropanoyl)transferase activity"
FT                   /biological_process="fatty-acyl-CoA biosynthetic process "
FT                   /protein_id="EAL87763.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0043754"
FT                   /db_xref="GO:0046949"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG395225"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR015761"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000051F622"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL19"
FT                   /transl_table=1
FT                   /translation="MSILRCNGGLSWALRSCQSRRVLPITRSPSTISFPRRTFHAAPAL
FT                   WGVKSQILKDVGEGITEVQIIQWYVEEGAHIEEWKPLCQYQSDKAVDDITSRYEGIVKK
FT                   LHFQADDTVPTGRALCDIEVEDGKYPEDNPPPEPAPAPAQPSPAPAQAETKQPSVEVAA
FT                   TTQKPEAPKNGSRYATLATPAVRGMLKAHNVNILDIPGTGKDGRVLKEDVLRFVTVRDS
FT                   APTSQPTTPTIPTTPVSQQSDTAVNLTPIQSQMFKTMTRSLNIPHFLFADELNINNITA
FT                   LRKKLANDPKDPRRITFLSFVIKAVSLALNEYPILNAKVDTSNPDKPQLIMRPRHNIGV
FT                   AMDTPQGLIVPNVKDVANRSIEDVAAEISRLSALGKEGKLTPADLSGGTITVSNIGNIG
FT                   GTYVAPVIVSNEVAILGVGKSKTVPIFDEAGQVTKGELVNFSWSADHRVVDGATMARMA
FT                   NKVRECIESPELMLLKLR"
FT   CDS_pept        complement(155568..156782)
FT                   /codon_start=1
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268233"
FT                   /orf_name="AFUA_1G00500"
FT                   /product="FMN dependent dehydrogenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87764.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG516177"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051FB17"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL18"
FT                   /transl_table=1
FT                   /translation="MSTNQHNPLPYTYETKVYTEGLNDKKPAITFDPFKWEGLAKERLS
FT                   ADSFGYVWGSAGTRETDDNNRKAFRKWGIVPSRLVKSDFPNLKTTLFGEDYEYPIAIAP
FT                   VGVQRIFHRDGEVAVASTAQNEGITYILSSASSTSIEDVAEANGDGSRWFQLYWPSNEH
FT                   NDITASLLKRAKAANYKVLVVTLDTYILGWRPSDLENGYNPFLRKDNIGVEIGFSDPVF
FT                   QKKFAEKHGKSIQEDMATAAAEWAHMIFPGMSHGWEDLQFLRQHWDGPIVLKGIQTVED
FT                   AKLAVEYGMQGIVVSNHGGRQQDGGVGSLDMLPDIVDAVGKDLEVIFDSGVRCGADVAK
FT                   ALALGAKMVLIGRPYVYGLAIAGREGVRHVLQSTLGDLQLTLHLSGIRSVQPEHLNRSR
FT                   LRRMD"
FT   CDS_pept        join(158014..158164,158216..158296,158415..159653,
FT                   159714..159889,159971..160063)
FT                   /codon_start=1
FT                   /gene_family="HOG000230995" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268234"
FT                   /orf_name="AFUA_1G00510"
FT                   /product="D-lactate dehydrogenase (Cytochrome), putative "
FT                   /EC_number="1.1.2.4"
FT                   /function="D-lactate dehydrogenase (cytochrome) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87765.1"
FT                   /db_xref="GO:0004458"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG257711"
FT                   /db_xref="HOGENOM:HBG553036"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniParc:UPI000051EC93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL17"
FT                   /transl_table=1
FT                   /translation="MLRVGARAGRPLRQAASSGLTGSRFRSQKISGPLVSRVFMSVGPQ
FT                   GGQESEYHKQGASSYPLRRQWTTGVGIAIASSGIAKPPEPAVASTTPLNEFPAPCHDTS
FT                   SSNIQGAVEEFVGILGKDNVISDKEALAPYSTSEWSSYSPSKTEVSSVVVCPSTTKEVS
FT                   RVMEVCHRRRLPVTAYAGGTSLEGHFAPTRGGVCIDFQGMDQILTVHKDDLDVVVQPAV
FT                   QWEVLNEELAKDGLFFPPDPGPGAMIGGMVGTGCSGTNAYHYGTMRDWVLSLTVVLADG
FT                   TIIKTRQRPRKSSAGYDLTRIFIGSEGTLGLVTEATLKLAVKPMNEAVAVASFPSVRDA
FT                   ASCVSEVVKKGVNIAAVELLDDVQMKCINTSQTTSRSWDEAPTLFFKFSGAPGEVKEKI
FT                   AIVQELAENANKKTFTFARDSEEVDELWSARKVALWSILQMKQQPTDHVWTTDVAVPMS
FT                   RLPDIIEQTREEISASGLLGGIVGHVGDGNFHAMLLFNDDQRQVAESVVHNMVKRAVEM
FT                   EGTVTGEHGVGMVKRDYLEHEVGKTTVDTMRRFKQALDPLCLLNCDKVVRVQVPKQGEV
FT                   PEW"
FT   CDS_pept        join(160405..160539,160594..162281,162436..163021)
FT                   /codon_start=1
FT                   /gene_family="HOG000191778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904117"
FT                   /orf_name="AFUA_1G00520"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87766.1"
FT                   /db_xref="HOGENOM:HBG051526"
FT                   /db_xref="HOGENOM:HBG324644"
FT                   /db_xref="UniParc:UPI000051F8AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL16"
FT                   /transl_table=1
FT                   /translation="MGTRGLVLSVATVDTSSTGTSLIAILKALGKPSYTRFLKMMKNIM
FT                   FSLEWLEAMRKVFTGFVQKLEEQYIPLVIPDSLKQDGPTSSLAERYMKSFLALDDRLEM
FT                   PPMQTLLPHLWGSDIEWMYTIDLDRELLGVDHSVYLKLSKIPREGRWHQYLDVDENRRR
FT                   RVFQKETPESIVGDIALKPSVNSDLTAKYTSIGIEPMSLKGFHGSIDMLLPREALLLNT
FT                   FSCIYKSFKKLLDPFILEWTPESFSFQEMAFALLSIAAGEVTFESIRALDKSYEREGYY
FT                   ILPDGHLLPCFLYERHFPGVEPGSAPRNRTYWFSNVLVHLASRLDVVDVEKAAVIEVVD
FT                   AGLDQGLDEFYAMVFSISDVILVHVQKGGGRVRVQRSDLMPLFYFDEELSNYLNGPRTR
FT                   PAQDTQPPTPGTNANHALQCKIQKGGDASRFSEASDGSDDMKTVIEDEHKNVDITFKSM
FT                   IRFLDIAARLHLADAKSRRVPNEILTSVMHFTDTRTYKNLANVSASCRQLSDRKFRLND
FT                   GYDVVGIDVQNMGSPRRLIIEDIQTGKRFYSEVQHLDLFFCRNTDKGMLDLYIVIGEET
FT                   TRRSVISLAALQFPKLPPKDTPCTNEVQQPISYIQSMIQRETRHPEVAQFVQISGAQYR
FT                   CLLPPGYRKLGMYHCFCNGLQAFLRHPQDESHEEWMKTIEYAVHQLSHLEQWPDSVFIV
FT                   RGRPAIIAFGTRVKLFYYIYHREEAPVVPQNASPTSIQFAASCTDLEPKHRLVQLIPGS
FT                   EPIDLHHKDDRAKLEHWFKVFCDKEDLETEWDPITVEYITMAREVGNTE"
FT   CDS_pept        join(complement(164544..164771),complement(164101..164478))
FT                   /codon_start=1
FT                   /gene_family="HOG000032567" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268235"
FT                   /orf_name="AFUA_1G00530"
FT                   /product="Thermoresistant gluconokinase family protein "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87767.1"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG051536"
FT                   /db_xref="HOGENOM:HBG335815"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="UniParc:UPI000051F89C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL15"
FT                   /transl_table=1
FT                   /translation="MLSAGERPQPAIGKNAAATRAQSSLSHSPAPMWSVQPKPEQVQHI
FT                   WVVTGPAGCGKSTVGRGLQAALNVPFLEGDDFHSQKNKEKMGSGIPLTDADRWDWLISL
FT                   RNAAIKALSPSEANNFHPPSGVVVACSALKQKYRDVMRVAAYGTPSVQIHFVYLKLDEN
FT                   ALLQRVAARQAHYMKSTMVQSQLQDLEEPKGEWECADH"
FT   CDS_pept        join(177114..177172,177234..178593)
FT                   /codon_start=1
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208702"
FT                   /orf_name="AFUA_1G00550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87769.1"
FT                   /db_xref="HOGENOM:HBG051553"
FT                   /db_xref="HOGENOM:HBG326917"
FT                   /db_xref="UniParc:UPI000051EA29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL13"
FT                   /transl_table=1
FT                   /translation="MQELSGPTQMTLLIIIILSLLLGRILCLEEVPLTPLNNYIASQAD
FT                   TWGRSPSYCPTPGDFGRERTASEYSFSSHGERSTPLPQSRPGRLRFLDHVESDDGASDD
FT                   EYPSYIPYVIEWRVTLNNRVLAKDTEQDLDSAPSSYWQQIKQKAKRVLRQKLNRNRRVK
FT                   PDDTSIMVSVNDRSQRDLTKRFEKTDIDWTAINRQIRMWQDLLCLPKKKLTVSISINYR
FT                   EDADSSSRKTDKRGNSSVTNRMLRERDDQIDAENYSGQPSVWRDVYQKMRCPGPPCQHE
FT                   GQYCWQDPIGKKHYRLRTYHLKSIIKYVEQGGILDTHDDVPDNVRKQLYDEEHQRLSKE
FT                   NKPANNLATGSTLPPININVLPTQSSQPVISSSWGTEATSISDQADYPDIPGPLEAVVE
FT                   EYANWHLSRVNSDSYKENIKKARDIALENCLDLGQIRTENPEFFVKQGVKIGVARRFVS
FT                   HTKLWLEEREKGPG"
FT   CDS_pept        180590..181627
FT                   /codon_start=1
FT                   /gene_family="HOG000158806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752007"
FT                   /orf_name="AFUA_1G00560"
FT                   /product="Pfs domain protein"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="EAL87770.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG051560"
FT                   /db_xref="HOGENOM:HBG323871"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniParc:UPI0000F51A68"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL12"
FT                   /transl_table=1
FT                   /translation="MAGKTCLSHDDYTVGWICALPLEMAAATVMLDEKHEKLRRQPNDH
FT                   NEYVLGHIGEHNIVVACLPSGEYGITSATTVAMQLLSSFHSIHFGLMVGIGGGVPKEDK
FT                   DIRLGDIVVSEPTYTHGGVVQYNYGKALSGGEFRRTGMLNRPPQSLLTALSKLQATHYT
FT                   KPSQVINFLAEIEQKLPTEQAANFARPTQTDQLFLDNYEHTNTHTQTCNGCDTTQTIRR
FT                   QCRSHNNPFIHYGLIASANQVVKDSQLRDKLGRDLGVLCVEMEAAGLMNNYPCLVIRGI
FT                   CDYADSHKNKEWQGYAAAVAAAYAKELLLTVSADQTRNTRAITNVPSSPTVSGHSLIII
FT                   YVDLI"
FT   mobile_element  complement(183105..184079)
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   mobile_element  complement(183237..183476)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(183243..184016)
FT                   /mobile_element_type="transposon:mariner transposon family"
FT   CDS_pept        join(184790..184935,184997..185713,185749..186475)
FT                   /codon_start=1
FT                   /gene_family="HOG000157088" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904118"
FT                   /orf_name="AFUA_1G00580"
FT                   /product="Transcriptional regulator PacG/VIB-1 "
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL87772.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG051574"
FT                   /db_xref="HOGENOM:HBG323872"
FT                   /db_xref="InterPro:IPR007888"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="UniParc:UPI0000F51AA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL10"
FT                   /transl_table=1
FT                   /translation="MEGFDTMAMPYLASLLSLGNIQGADYLNAMPGIDLPDQRSNFDSD
FT                   TFVSGEDIPPFTQHSLPNTLKRFSSGYDDPFTEIVTPFNPAPSEQPPDSSIDHNNKLLS
FT                   FSMPAYNFTLLDYSLRRTSLSLSAQLHGMFFLAESPWTTSPTENAPPQQGAELTCYRRN
FT                   LFQITGSVTLPRSLRYIMTEQGDRIPILAQELCISATESVEGNSRSFQCPGKRPLRTAI
FT                   NQLMTMVLVTAMRRLRKNPHQFHWTSWRAKTWTLIMRRSRLLRSGYNSVLRRPTTGGEK
FT                   SCNNISSAKILICEVHSGPVIVRGRSPRNFQSRKDLPLSGSAAASRKSAQAATLNRTPT
FT                   SDTNHRPSLTPGKAKSTAKSTSPDTSLPQSTIAAQRQSSPDWTHIPHSSRGALSSTPLP
FT                   QPSLYPQSTPEFSRMTDSQRRSSVMAAPINLSLLDDDTTGEGVNLVDSARPGSSYANDV
FT                   SHKSHDMGSSAPPTKMRKLSHSVSQAPSQSTSTSLPLLNTAGLQQPFASSLPFPNESAD
FT                   LLYEYFPLGLDD"
FT   CDS_pept        join(195962..196201,196316..196643,196752..197472,
FT                   197639..198161)
FT                   /codon_start=1
FT                   /gene_family="HOG000217384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268236"
FT                   /orf_name="AFUA_1G00610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87775.1"
FT                   /db_xref="HOGENOM:HBG051592"
FT                   /db_xref="HOGENOM:HBG328883"
FT                   /db_xref="UniParc:UPI000051F8AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL07"
FT                   /transl_table=1
FT                   /translation="MNCPICSRVSSSRLRFYCPTCACNQIYTLRINNARALLEKETLGR
FT                   QVEKALLHQTSPTLSYHRFEECSTQSPDKVPSPQDRRLTLARRRSDAESSKFQLESREV
FT                   ALICGVQNTIKRTERLWHSLHSKTVEARIFLCREVANLYSLRQWMKQDGSEMKKTYVIG
FT                   GVPIVDLRDLNGKSQNCPLLLDMPAPTEITLPHKDHPVPTIHAPIASYISRELILTATS
FT                   TQPHNLASSTTHPLGFQSNHYQPRPLTIDRSLPKLAREDPESYVLFLEGVTLLAWNVSW
FT                   LCRTQGLNIASDSWEEICNIGKNMWQLLVAPPLEEATLMRAFAVRETKPMKPLRDLPKT
FT                   SLQKTISFPMMGHYSHGTVHSFLGASEGTEFVRTWRLPIPLKVVDKLKSTLLGEMASAE
FT                   WEVLEEKEWNDSEQSSTRVTFQSNIWEFYYLSASQKRRILDVESRIRTERRDGYSTGTS
FT                   GSSVNSQLEISIASSFDPRLWRSVAHPKPLEKLTSKRRSCRACPQQMMLPFCAPDTEKQ
FT                   AKCGSESNRIFVLGLLPPRGQSGQKQEKFKARVTSDGRSGRTHNPGSCSMQDSCRFRRC
FT                   LKDMGSIHVRGDINSTLKVVMDGTVAS"
FT   CDS_pept        join(199230..199980,200079..200869,200943..202418)
FT                   /codon_start=1
FT                   /gene_family="HOG000129935" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208703"
FT                   /orf_name="AFUA_1G00630"
FT                   /product="SWI/SNF family DNA-dependent ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL87777.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051609"
FT                   /db_xref="HOGENOM:HBG325250"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000051EEC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL05"
FT                   /transl_table=1
FT                   /translation="MPACSTDECCSPLPTWNTGNVHQTAASSAIYQHEQSCSAAGIPAQ
FT                   NGLRPPVLSTESSPDHRLASSQTRPDEGRPRSSRNPINPMLESCHLGTQFTLNPEVTSR
FT                   TSTTRRVEMPIPSSSVARHPRYPDPYSQDLYPHTVTSSTIGYGMDWPMPGHNVPGRLRV
FT                   ESWDNDELLMNSSSSGLCQYPEPHDGTISVGATIFSHRAHAQDFQEWGSTESILEPYPP
FT                   GPVSGSPLESMGCERRSQSLAASVSYRNDSLKRVQPSAVPLESGFSASAQSISSIQPSM
FT                   VVDPCEVASHALRCSLMEHQRQGLVWMNELEKSARRGGILADDMGLGKTVQALSLIVVR
FT                   PGSIVERHATLIIAPAGLVQQWKESIKRLLNPGIYQRRVYVHHGSKRLVSFAHLHDHDI
FT                   VITTYGTVAAEWQRKQSIHHGSLSRSEPILGSSSRWHRVILDEAQNIKNDRSNAAMGCC
FT                   AIDATYRWCLSATPLMNHQRELYSLLKFLRVAEYTSIDGTVSLPLAGSLNLPFKIRTFQ
FT                   SAFNSGYEYERREAAEQLQNVLQAMLLRRTKSSVIGSQPIVQLPSRTTVKVYVDLNDEE
FT                   RRLYTALEGSVHAQLDHHPNSEAMRHSVTHMISLLQRLQLACCHPFLVTDDIRPLGKHF
FT                   LTEEQLMENARQLPEAVNLRLRVSENLLDCPICFDVVEDPMIFFPCGHSACVDCFGRIS
FT                   SAREVRCHSCRAVIDPARATNYISFARSNALALENSVSDTKSPVPEVVAGMAEYPRAGS
FT                   QRGGVSNSTREGDLSASQSGVDTEQQQWRTVLQPNEGESTQRLSLLRKQASRSSAARRT
FT                   YRQALENAWITSSKIDKALEIVEQIQNDGTGDKIIIFSQFTSLLDLMEIPLQRRGWLFR
FT                   RYDGSMRLADRHAVVVEFSTNPNCRLMLVSLRAGNAGLNLTAASKVIILDPFWNPFVEE
FT                   QAIGRVHRIGQQRPVHVYRILTPDTVEDRIQNLQDEKRRLVQGALSDAADATIRLGRQN
FT                   LTYLLVGPTFVARNPV"
FT   CDS_pept        join(complement(211378..211854),complement(210663..211295))
FT                   /codon_start=1
FT                   /gene_family="HOG000216806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268237"
FT                   /orf_name="AFUA_1G00640"
FT                   /product="Choline kinase, putative "
FT                   /EC_number="2.7.1.32"
FT                   /function="choline kinase activity"
FT                   /protein_id="EAL87778.1"
FT                   /db_xref="GO:0004103"
FT                   /db_xref="HOGENOM:HBG051615"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00005206A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL04"
FT                   /transl_table=1
FT                   /translation="MATAISVPVTFPEDKVPTTKDVRDIIGAFLTEEWPPVESETLTVS
FT                   YHASFVNAHRPVERPKPDTATSTEPLKVFIKLHNDTSGGLEIFEPLVPTKHEEALFCYE
FT                   YGQTELGAEVYGFFKTQDGTLGRVEEFLDARNMELEDVEDSAIRADVAKGLAIFHAEML
FT                   KALGKEGGAMIDNLVSYDFGKRLRSVVDKLASVVRKTRWCIHDVQFMNVMVKNDPREGE
FT                   SKVVLIDFEFVMQNYRAFDIGGHFMQKMFKWFDEESKIAKCRKYTEKEKKHFCDEYARQ
FT                   WNQLTGDSDTGDQVFEESEYGYLLAITFNIHNMLCFMYEQGDKDPLNLHRKKKGGHALS
FT                   SISLSSYASSYVWSTGEYSARSFSVFGCE"
FT   CDS_pept        join(215584..215661,215711..217006)
FT                   /codon_start=1
FT                   /gene_family="HOG000158769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208704"
FT                   /orf_name="AFUA_1G00650"
FT                   /product="Extracellular alpha-1,3-glucanase/mutanase,
FT                   putative"
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="EAL87779.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG051622"
FT                   /db_xref="HOGENOM:HBG332366"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI00005201DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL03"
FT                   /transl_table=1
FT                   /translation="MHAIIFLWAALIAGRAHAAAVFAHFLVSNAANFTITDWADHIRLA
FT                   QDAQVDAFALNIAADDAINGHALQLAFTAAQRARFKVFFSFDYVARGPWNQHDVIGLLL
FT                   QYRTNEAYYRVNGHPFASTFEGSENAEEWKSVKASTDCFFIPDWSSLGVKAALEKGYGI
FT                   VDGLFSWAAWPSGAEDMNTQVDMSYLELLQQGGLAYMMPVSPWFYTNLPGYGKNWLWRG
FT                   DDLWYDRWQEVLSLRPEFVEIISWNDYGESHYIGPLHQGGYGVFKTGKAPFNYVEGMPH
FT                   DGWRILLPFIVGDYKNGSAAVNEESLVTWYRTTPGAACDAGGTSANTRSHGQVEFSPQE
FT                   VTKDRIYYSALLTEYAVAEVTIGGVTQTGTWGSEPSSGKGIYHGSAPFNGATGDVEVTL
FT                   SRRDNKVLTLRGKAISGDCPNNIQNWNAWVGSGRVPCRSSTISREIYLPSNPAAVSEV"
FT   CDS_pept        join(218161..218699,218769..219429)
FT                   /codon_start=1
FT                   /gene_family="HOG000129931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268238"
FT                   /orf_name="AFUA_1G00660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87780.1"
FT                   /db_xref="HOGENOM:HBG051630"
FT                   /db_xref="UniParc:UPI000051E582"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL02"
FT                   /transl_table=1
FT                   /translation="MRRRIHLSTFHKIQTTGQAMPPPERGLARKERKSRVPLQKATVTE
FT                   TAQERPREANETLDRGILEKIQKCLNRAAHSSSTESEAKAALFIAHKMMTQYNVTQADL
FT                   LASEPDKSKAQYVGRSVVSIRHTDSSKRVTKESFVGKVATAMCTFFDCKCFSTDYGSSI
FT                   RWTFYGIAENTVAAASAYRIGVADGLVAMANRKKKRELEEVRRKELDVVAARAAGRQQQ
FT                   LDRIHTLPAIDIDPVGAEAENTFCDGLFLDDSDTLFELFVMHDSSDRDGEDDFNENDKS
FT                   AMDIMRDVDDNTETAIKQESYRISDLASIHLSSAERKLSAASSAPISNEHAVPSPWASE
FT                   MQLTRFRATSEQVADDFIEKNNIKLYRQRSRPVAARDTHAYRQGWKDRSKINLRQRRLE
FT                   "
FT   CDS_pept        complement(221860..222075)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268239"
FT                   /orf_name="AFUA_1G00670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87781.1"
FT                   /db_xref="HOGENOM:HBG051638"
FT                   /db_xref="UniParc:UPI0000520685"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WL01"
FT                   /transl_table=1
FT                   /translation="MSDRISRQWVEYIADFVNAGPLWDHSDGNLSGKEGSKLAPRQNPL
FT                   LSSGDLMPLLYPDSPSAITQAEDAFT"
FT   CDS_pept        complement(237383..237712)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268240"
FT                   /orf_name="AFUA_1G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87783.1"
FT                   /db_xref="HOGENOM:HBG051654"
FT                   /db_xref="UniParc:UPI0000520686"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ9"
FT                   /transl_table=1
FT                   /translation="MGPLVARILEEGDSELRKERAARHRAEDELNGMKELTDILLHLIE
FT                   KIWAFRCTNNQTPDDASQQQRATLESILDSALAQLELQSVQIEYEQLRRENDQLRTSNN
FT                   LQFEK"
FT   CDS_pept        join(238508..238683,238788..239796,239899..241314,
FT                   241436..241823,241880..242127,242203..243054)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268241"
FT                   /orf_name="AFUA_1G00700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87784.1"
FT                   /db_xref="HOGENOM:HBG051664"
FT                   /db_xref="UniParc:UPI000051EA30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ8"
FT                   /transl_table=1
FT                   /translation="MDLTHTDRVATTSAYHSSQTNQEDAPRAAVPRRIGLGLTRSYAAN
FT                   WQVRDAFRELYQNWKDAIIERHNLSLLDFAPEVLATRDKTRDEIRILVKGRPVQPQAEG
FT                   EQGAFGPTLGYIRFDKIRGSAEFTNFHATLDPQCLELGYTTKKDNESLAGGHGEGLKIA
FT                   ALVLSRNNHHVKIAASGFNWNFGFNGGQSRNNFYCRLSHAKARHEPMGASSRGRDTDPS
FT                   PSAWEDVSVTVERGRGERVSFTEFRAWMCDTVDLHAPAGRIRTAVGDLLLEPMYRGCLF
FT                   LKGIRVQERSINDPTFHSGYNLIRGSVDRDRRRLLNGQQVTQDIHSIWEHAIAQAEASV
FT                   LPKYLDLFQCVPPPIEVNDAHQWVTELTAKKMWGILSHESKMKDLFYYPRSRQEKDTVV
FT                   IQTELMKTPHPLPNQLWQVLQKHGQVRTPFEELQSRLKSSAETPIPGTVFAQGVARILR
FT                   ALFALDTHTQKLKLVFVRCDIHTVDLAYQADGHVLYIHDKWLQYHGVSHACHPSIEPEA
FT                   STFVCHHVVQELYCRALAIIYSPSAKEHSLLMERLVQKCQQQLEQMPRMIRLLTTEDER
FT                   ALEVSFTTGHSLAFAQLYGSQVRYMVVLHGSSCVTGTNGMESLMYDMDKDACDCPRKTV
FT                   SLDIRTVRFSDLNQGPWVPVVARLQDVDGAPDCYQTSGPIRATHGALMGTLQQTVWLRN
FT                   GEIVFGCPIENVQDRDTAANSLSQLSAFGQKRILMPDTEVASKGMASAQTPAVSCIQDL
FT                   QSSQLPDERSLVPGCECISHLSDGPAAESHVSALPTCSLAFLPTEDEIVAAPGGASITD
FT                   TDRDHGQMAISPRQVRPRESSLSSVPCIVDETSVSDSEIPRSLPDTANNPARSCQANGL
FT                   YRSCDQYVQFSRRAYARVTLREPDAQGHTARYVLYVHDILLPTDRNNDTSRLLVTKYSF
FT                   LVNHCVFQRKSNVPSDRELLLHFRDIAKMGEEEDAELIDTRNVELEDVGGDDQYPTVFH
FT                   ATRTPDSGSSKEYFARYAACGDLQDGSFFVTPLAPPLPDRGCALPLSTIPVASVFDVSF
FT                   GDTKLSAAFARAGYPIRAAVIGDNETRQWWLDHCPGAFLCSGDPASVIADVDSGKSKLP
FT                   GLEDPQLSRIVTIAGCSRSALPDPDPTDAAAAAERLREHTHLLQCCTLVALSAVWSADF
FT                   IVLELHRIREQAEFWEELAETTTTLLARGYAVSLRKIGVSHTKPELPHMAPDVVLLAVP
FT                   GCTNPRWIDDALADCAIPVNAPGCETRDAGSPLTATVFPTVDQPAMLQDGTVAESVPLQ
FT                   LVQLGTAGEDQPSALNDSKQLSSEDGTSRRSLAADTAHRHAMVVSRIIGELSKHRPSLE
FT                   SFSFRGSANPQGAIKRRRV"
FT   CDS_pept        join(complement(244879..244896),complement(244685..244789),
FT                   complement(244409..244420),complement(244162..244388),
FT                   complement(243928..244088),complement(243738..243757))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268242"
FT                   /orf_name="AFUA_1G00710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87785.1"
FT                   /db_xref="HOGENOM:HBG051668"
FT                   /db_xref="UniParc:UPI000051F15F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ7"
FT                   /transl_table=1
FT                   /translation="MANWPNMVLDVAAETDITGREFSTFITDEPEAAVTFALRHEGKTA
FT                   AFIEETRERLAHIIELGSEPRYSKEAVLQDLFRTFEHELKRAYDSTDWDERDTRNVFGL
FT                   REDPTRNFGNAVLFVTRRSPEGTVDLVAEQLEQHNGEEVKVKLSTASDIPRGVLLKSVY
FT                   LSLTAVGHSPLVVFFVS"
FT   CDS_pept        join(complement(247367..247620),complement(247144..247354),
FT                   complement(247000..247041),complement(246875..246946))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904119"
FT                   /orf_name="AFUA_1G00720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87786.1"
FT                   /db_xref="HOGENOM:HBG051674"
FT                   /db_xref="UniParc:UPI000051F8AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ6"
FT                   /transl_table=1
FT                   /translation="MLHQMLERQRKIVDYGEYYAVVDIAFFGAHDVFVVNPLEDAQNLV
FT                   SDLWGVPPDSLRLIRASSTLHKHDSASQLAAKKLLECIECSNYYQWLSRPFCFHNLRKA
FT                   ELLRSAGYNFSCLTVRLHLSLKSQSELVPIALLIGWAITGTFSQATCLADIGGSCCCGD
FT                   QAFRKIVQQARPDHQPHHLMSVDQTTIVT"
FT   CDS_pept        join(249319..249415,249469..250322,250658..251350)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057388"
FT                   /orf_name="AFUA_1G00730"
FT                   /product="DnaJ domain protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL87787.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG051681"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00005201DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ5"
FT                   /transl_table=1
FT                   /translation="MVKPDVNRDYYLDLGLTATANEEDIKKQYRKLARKFHPDRNPGRE
FT                   HEFKPKFQAIQAAHEILSDPQQRRKYDIDRLQAGYGNRYGPPKPDTPRRTPANPYASAT
FT                   PPKAQTSRQPFSGRPQSSHSAYSTGTQSYANYWRSGPKPPWEKTYGAGRTGADAYRRFQ
FT                   GTWGNSTTGWSRFNPRTARAGYTDSVPRPNATPTGQPTRPKTAYEYFKKPTDQSSRTQS
FT                   TPKKHGFAPRSASGDEPMAANTSSYTTVPRRERFQALDDYQREGAPTTTTEKPAAPSGC
FT                   GTENTREPNSKQTGGKNAGTDGDRASFSESGHHSDDSYHELPDTDWHIQIPQSSQHQIR
FT                   MRLSPSISIMHPEADTSNCSNLTPNVGQAPINGTFKRRSRDDLRKAFTAEDWRGDFEYG
FT                   SFTSPATENDRPDTDQSLNSHGRASARASTSRPGQPDLFGQGLSRSPSVSWQPHRAFPK
FT                   AKFSLQEWADAFKSWLVFIAQHEAPQQENAQRPRGSSKRAKPRYRALRTTPQPASVATE
FT                   AEEVQNTIRGSIVQEATGGDPGDVEAMDLD"
FT   CDS_pept        join(complement(259049..259498),complement(258813..259026),
FT                   complement(258432..258787))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057389"
FT                   /orf_name="AFUA_1G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87788.1"
FT                   /db_xref="HOGENOM:HBG051689"
FT                   /db_xref="UniParc:UPI000051FD96"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ4"
FT                   /transl_table=1
FT                   /translation="MIGFDLQPLPGGLEPPTSIEPDVIKIHDYSEKYLWVLNNNGSISF
FT                   NRGESPISTQLCEKVSRLFTTPRPHVLEGPSISWVQVVLFARDSPEHLNENGPLRVGDS
FT                   TIQLSEKDRDEILSGGPCRYLGPWPVEGDCQRELVLVNEDLDVVCRVRNLLMILWAGVN
FT                   TTFTDAVVESLDALCQKLSFRGDLLSRTPNEQRQPSTFESGTSSDICSMTETALILVQP
FT                   IEYIAPRAAEISIRKDASGVESAGQECNVEPAAGFPHSPPHGSRDSSQATESDHSNSTA
FT                   DEKYGVVAVVQQSRREVSGSKGDYSRYQATEDLVLHASQGSLISTPTPIPPFIRKLVE"
FT   CDS_pept        join(complement(270543..270616),complement(269880..270493),
FT                   complement(268868..269796))
FT                   /codon_start=1
FT                   /gene_family="HOG000174648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208705"
FT                   /orf_name="AFUA_1G00750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87789.1"
FT                   /db_xref="HOGENOM:HBG051696"
FT                   /db_xref="HOGENOM:HBG326573"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051FFBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ3"
FT                   /transl_table=1
FT                   /translation="MSETAHPSLITSKDDLFKYTSGRWIHNEHLRLAERYLQFDIPALL
FT                   NVIAAASGHMTSDIVSFSKLAEGGFNRLFQATFRDGKHVIARLPYPSTVPERYTVASEA
FT                   ATLDYLRLHGFPTPEVYAWCATKANPVGAEYIIMEKLDGTPLGDIWYSMTPKEQHKTMK
FT                   QIVEWEARLMSMEFPAIGSIYYQRDLPTGRKVPLSGQLASEFCIGPMAHYSWWHGERST
FT                   LDIDRGPFGRREMTWVKACAKPRLPYERLYREIYGFCQVSPNRHIENLSEYLTLAPCLG
FT                   FRMGSSLDRPVIRHPDLQPNNVLISDANEVVGLVDWQHCTILPLGLAAGIPKYFQNYGD
FT                   PDSEKLIEPRIDLPSNFETLPESDQFAIREAIRKRLVHFLYAAFTKRLNEEHYDAMFDE
FT                   SAILHQRLFKSAGSPWEGDSITLKADMIRAVQCWTSLISAHSVGYGRETCSTPTVTYPD
FT                   RVVRDILALDARQREADVAMDQMRDVLGIDILGWVPNDEYETAKEKARELKAKMLDAAE
FT                   TDEDRIGIQNHFPFDDFDENS"
FT   CDS_pept        complement(271231..271587)
FT                   /codon_start=1
FT                   /gene_family="HOG000201609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268243"
FT                   /orf_name="AFUA_1G00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87790.1"
FT                   /db_xref="HOGENOM:HBG051704"
FT                   /db_xref="UniParc:UPI000051F623"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ2"
FT                   /transl_table=1
FT                   /translation="MSRRAWANVMEAITGRGSKVWEKLAKPTVGRGKTQWPKSPSDLEN
FT                   HGVRFDYDGTLEEDGQVYHKYQVQPNAGKIPSSWKEWRDKHGGTHAVIGTIKIKQDATK
FT                   DDVDSALKSLEEKL"
FT   CDS_pept        join(274858..275004,275052..275465)
FT                   /codon_start=1
FT                   /gene_family="HOG000217225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268244"
FT                   /orf_name="AFUA_1G00770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87791.1"
FT                   /db_xref="HOGENOM:HBG051709"
FT                   /db_xref="HOGENOM:HBG333174"
FT                   /db_xref="UniParc:UPI00005208F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ1"
FT                   /transl_table=1
FT                   /translation="MAWYDVFVLWIWWCWERIRPFISTRRNGRNEDDLTSLTDKMPVFE
FT                   DKIINTSVRYVNGEIVAYVVQTEYLDTQEVCTADTKPDNSCSNSMSDQSTAVDEDEAKA
FT                   LEEPERFTVRPSYIGSTGKRTVDFFYKVSLPLDDLEMRAKESRVPESSEDLIEALFHYQ
FT                   GADIWVYVPYSYAKARMVSSGPH"
FT   CDS_pept        join(277013..277096,277232..277344,277395..277600,
FT                   277650..277838,277886..277941)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268245"
FT                   /orf_name="AFUA_1G00780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87792.1"
FT                   /db_xref="HOGENOM:HBG051716"
FT                   /db_xref="InterPro:IPR021264"
FT                   /db_xref="UniParc:UPI000051FB21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKZ0"
FT                   /transl_table=1
FT                   /translation="MAANSSRTRVPSTKRSSHENQFIGWENITLVPGSPKIFAKDSKMF
FT                   YSQVNPPNCLLAVQSNAAGPLNTQQATVQYWQILTSCPQNDWRVIGEAWIELIEPDKRH
FT                   LYPYSGGDKAKPKWWPRRLRHETPHHLLTNKRIILLIHILRMSGKGKITCAKLLEAAEQ
FT                   KAEAGKITERALTVLDEIIAIRKNEEEVETQRNHDGITATGAPDEVLNWELL"
FT   CDS_pept        complement(287037..291287)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268246"
FT                   /orf_name="AFUA_1G00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87793.1"
FT                   /db_xref="HOGENOM:HBG051724"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000051EA2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY9"
FT                   /transl_table=1
FT                   /translation="MRRGIWDFWATTVAQNENTKMNLIDANSVKLLEGLAPGISEADRT
FT                   TVTGLVLSGKALEDFSPDERKAICERMRSYKGRIPSLSLFFQDVLILELGAARVKRLVD
FT                   RSKRWGPRDIEMGDYQERKQTLRERMEHMFRCRDTDSIMVQTSDGEEREVTGDGEFQFD
FT                   LAYRQLWLCALRSCSGSPGEGHRPATVCRSWTHPHEQYKLAQLARALGFRSNSISRLAS
FT                   RPFEPEYPPWYEFDDRGRNPALKRCGIPYTITFREDRETLFLDRIHQEASEYEELDSAF
FT                   VLRDIYLSFFGDLPSSVLEGPQRPRRPRDGQSPEVGPLPTLGAENRPSSGAAPSSTTMP
FT                   SSTTTRRPTSQRETGHPATPATPATPAADMNPQVNSEREQSAPSPLMHSEDIEELSTRP
FT                   TIPSETTGATTMPPTEPPVAPGETRDWSPELMALMNDLRKLRDDIDNLSTRLDNPKFTD
FT                   QQSAIIELRKLDTATVESTDEETRQKLGTIYAEVNKRCMDIQSARSHIHVAKVEVGSEI
FT                   SKLTAFKQNGEEKSQETTQVAQALRSAQAVFDSSQGKYEELDRFLRDVTPRIRPLQQQI
FT                   AGIKVYLLGKCLIDLHHQYENCSSDIDTIRQSVADLNTKLHPQRPASHETDVTILNDIK
FT                   DNAITKVNVIWRELDAVRGAFQEAGEKPRSLNPLECESLQQNSATKLETLKAETEKALT
FT                   ISKKQIQDVKQRLQTGYARIVLLAKEAVKSELDSERTTLKNMKSDYEGVHSSIERIRSS
FT                   LENNQDSLKQNIEHSMLQGLSDLIDNGTLDGISRSLQTMQKTHDINVGQLDNSAISLEV
FT                   PLDTQAKICDKYVGIRTEITNRKKERDILRESAQEYCVQMAKTLQLAVSSQLEKVQLKA
FT                   SETTTQLRVMRDAESLAAAKQALESAKQAADESTRLAKQVEALAGLSNEDGPPDLRNHC
FT                   EKGASDATTSAKEAQSAAKTGQLFVNAWGEANQKMDNFLQSANKWKDLSATHSEPVMSQ
FT                   WMPTQRHGAVKEALNRVSNLALKTCSLRKQMRSEVLSIPNSLCDSDQPRLAELVNLRVP
FT                   EFEKATLETLTTAFGLFYCVTQRTGDYTKSKMTEIENFSTSATEAIEKADRNKWLIVDR
FT                   DARKAKEYLDKAVELAERGMNEADRLKKATVDQEGSKGAIPELALQHVTQTRECLKFGK
FT                   DNQAEARQMLQDIQISWSRALASKKKETAQAEYDRARKTVDSIQPNRSPRDAEIIRNAF
FT                   KTMEDLFKGTQQDFEKCCGPNDRFEEIADQFASVTNRAKSVIKGAEAVLRKRTLTSEQH
FT                   PAGDPSTLRDKSGGKRSRVGEPPRRMTRTQRKHQYVFIIKTIGGKPTAKWERELHSTEA
FT                   GRVLQKGRELCARGTLCALNGDLTKLGSLNPSGFETNIVDGGKVFFLGTEVELEGVDFD
FT                   LLLKKAQECYESCP"
FT   CDS_pept        join(296636..296765,296821..297872)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208706"
FT                   /orf_name="AFUA_1G00800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87794.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051735"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="UniParc:UPI0000F51AA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY8"
FT                   /transl_table=1
FT                   /translation="MPNSAKTVAIIGTGPAGLFAAWALQNDGYQVTIIEKAREHRYSTR
FT                   RAEGVAGEDQPVDIPMRTFSGSYYSNLFRALEFLKVETRVHRFRYNFHRGGTQYFQFFS
FT                   NFHKITPCLQNTAWVNLYALACYLWYTIAVFLPPRVRGTATSGQRKGETKTLDQYARRI
FT                   RLPSTFLEWYLLPLFSSVATCSHADLRECPAAYIVNYRKGTIGAHHRTIVDMRALQGLL
FT                   TRNVFQRLQTEVRSVRSESGRVELQFFKSNDKTGLETEVFDFAVLATSAKQAGVLFPDI
FT                   RPITSKLKEGAGSSRSLQPKCLRERLRTSEVRLLNLKPTAILLRVPLLIPCIDIGRGQR
FT                   WSCHHVRTMTWLKSRAMAKVKLFTCVDLSQRLSPMTCCFQFSGRCLLTKDGHG"
FT   mobile_element  299208..299744
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        complement(306044..306847)
FT                   /codon_start=1
FT                   /gene_family="HOG000188145" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268247"
FT                   /orf_name="AFUA_1G00810"
FT                   /product="Allergen Asp F7-like, putative "
FT                   /protein_id="EAL87795.1"
FT                   /db_xref="HOGENOM:HBG051743"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000051F624"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY7"
FT                   /transl_table=1
FT                   /translation="MILAMGPVFTFLALSSTLFVAIGSAAPANQNEREDPGVCETVTTV
FT                   VWTTVDVATTIYPALKDTVITGTVAVVSAGSTLTTPPGPGQAETTESQPTQLAATVVSN
FT                   PVVAAAVHAAAGERWTIQAPQPPSTASPSAYTTQTAQPTQQTSSRSSDTTSGSGSSGVC
FT                   SKDSPCFGQLTFYDTATSPSAPSSCGLTNDGFTEDVLALPVGIMTNADCGKTVTVTYNG
FT                   VTKTGTVVDKCMGCKPTDLDASRHLFGELAGFGAGRLYGVSWYIN"
FT   CDS_pept        complement(307828..308409)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752008"
FT                   /orf_name="AFUA_1G00820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87796.1"
FT                   /db_xref="HOGENOM:HBG051751"
FT                   /db_xref="UniParc:UPI000051FF9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY6"
FT                   /transl_table=1
FT                   /translation="MLTAIWHRPVHPFTMLFSRVTFAWANMFCFTKVGKASSSASGGAQ
FT                   STAYQATNEIILKYASVSPMIQSNSGTMEVTSPSKRSLAGLHAGQPILDVVKAEMDFGI
FT                   SFFRGFCGVENRGGQYRMVFTARFQKAPDALHLISCPKVIRAANLTPAKRESLRINLEA
FT                   VSDRMAKEEWDKLESRYEIVKKDWLIVLDA"
FT   CDS_pept        309461..309808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268248"
FT                   /orf_name="AFUA_1G00830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87797.1"
FT                   /db_xref="HOGENOM:HBG051758"
FT                   /db_xref="UniParc:UPI000051FD74"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY5"
FT                   /transl_table=1
FT                   /translation="MPKISKAAFESLAKKIRDNADSLKNLTFPDGATSKTAVKTQDLRF
FT                   DVHRNTQDPTMATGVIQANSEATDRTVKEFIKGRTGGHAGTHQVIGQKIRFSLGDQFKV
FT                   EEVAGAVEKTE"
FT   CDS_pept        join(310237..310262,310416..310719,311004..311151,
FT                   311230..312014,312452..313087)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268249"
FT                   /orf_name="AFUA_1G00840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87798.1"
FT                   /db_xref="HOGENOM:HBG051764"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="UniParc:UPI000051F3ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY4"
FT                   /transl_table=1
FT                   /translation="MEKFGRRARSREAEKLAVRYRKFNLPALLDAAVNVTGLDDAQCES
FT                   LSLLNPRTANCLTIGIKVLKCVEGQYNKALVLTMSTGQEIVARLPNPNAGPTFYTTASE
FT                   VATRQFSDLESRQPRPSFALVPGQNRGLPKFAIGPLTHPKYWQGKRALMELDRGPSIGK
FT                   NEIQWAEEHARPRMNFQRSVEEPETPGDYISMLQRYNKLVPFLVPPSLCSEQTNTVSHP
FT                   DLHLDNIFVDPQTNHITSIIDWQHVSASPIFLQRPYPQMLELSQNAQAECQVIEKQLLE
FT                   FYFERLKNVDPFRWRMLSEPLHFIKAEIISLVPCCWDREDLFSLRNAMITALAHWNEIS
FT                   GGGIKRPIEFTDKELEQHQNEMELVEGVSMILHQLQEDGLISLGGMVSPERYEDARKWN
FT                   NYFKQEFINLAEDEKQRELHAKKLAETLHKISNSRGRITSCREKILSTDPDLDPENWFR
FT                   CWESKSGDKLSSKQAIRLAALIKRWSRRTGEDSQTLKDWISNPSTFWGMDPFRTPFEFV
FT                   RHCLELAEKTEGKEPIRRRVTLIVLYDIISEEISRLRRQSNQLRHQKYLTSAVKNIVAK
FT                   AYHSQNASERTKLHTRLTYLQRYGEKWSRLERREIVLAPLDNARDKLVTTHILLNR"
FT   CDS_pept        join(315349..315716,315743..315947)
FT                   /codon_start=1
FT                   /gene_family="HOG000217619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268250"
FT                   /orf_name="AFUA_1G00850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87799.1"
FT                   /db_xref="HOGENOM:HBG051769"
FT                   /db_xref="UniParc:UPI000051EEC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY3"
FT                   /transl_table=1
FT                   /translation="MLKRNRDKEPVSGKNKRNAECTSHSRELTHNDYTVGWVCALPKEQ
FT                   TAATAMLDQIHYDLPKPPTDHNTYTLESIGRHNIVIACLPKGKYGTNSASAVATRMVGT
FT                   FPSIKVGLMVGIGGGIHRSTPVDQFPGVVQWDMGKAEEGGSFKRTGALNNPPSALLTAL
FT                   TKLETKHDMCGSKIPQYLDGMGKDGQD"
FT   mobile_element  complement(318455..319921)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  complement(319896..321740)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        join(complement(328030..328217),complement(327733..327976),
FT                   complement(327411..327687),complement(326861..327211),
FT                   complement(326160..326805),complement(325118..326108))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268251"
FT                   /orf_name="AFUA_1G00890"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA integration"
FT                   /biological_process="DNA recombination"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87801.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="HOGENOM:HBG051779"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniParc:UPI0000F51A4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKY1"
FT                   /transl_table=1
FT                   /translation="MVARSDSWKALQREKRRQAECKLRQQRGYDANAHEQEDAERSRGR
FT                   ASGETKNRYRERVRKYEEYLIQQKKVPEGYEVGDGHPAPTIQELKQFFRWLIQGTQGRL
FT                   APDGIPTRDTVLNRAQEFVPGFYIVTGNEIARNDRDELYRWIDRDLVEKKFLSTITKPK
FT                   YNFQLRDFERAIVVLWTIDDPFFISGRYRVEFHFITLQFLCTGSRVSSFTPASTKKKDD
FT                   GRGLRYKVRALSCLNITRFGTAIWDCDEPIYSGALYLLALALADDALYGFSSPEEVFEQ
FT                   RIPEGEDELVLRWNKEAEDRCIIRGATAGGVSEDPLTKEKYQKDFRKILANAGYFVTAT
FT                   VHAMRRALGKAVRNKYSSAHVAQILTHQSKSVYGNDYLASCSGVDVFNALRGRLADHTH
FT                   IEYFQGYGQFHEHGLPRQLPIEEEQKINADPHLVAKATEIQNAKYDEDTKRLKYEYNVL
FT                   KRKIYAKALQRYQTEWVRSQRDWKILTRGRERPEHTQQTAEKQAQCNLMPELGRLAAVM
FT                   SSKESLSFDEKVVVVKDLYTQCLRDFDVVYRPGEEPVEGRCPVKSCGKYLETLQKAERS
FT                   NHIHSCVRGEVSRTKQIPPNHVKYCWECFAFYNGRSPEFEEHCASHLPSMTSQHYEVIV
FT                   YRNTIIRAGYCIDCMWDNGKSAARRMTAFDRSTNLRKHLDDHINEKSWPSKCSDPLCSH
FT                   VSTDEQHYRRHLRDVHHYNKAICVPSEKTLKKRSSSEIDEESVVDGNSPKQRRRPWKQQ
FT                   KNSSSLSHTNRKDLKIILWEPPTKQSLAMLPPSAEAEHESEECPKDLDSQAVTHFEYFN
FT                   KTLCRSPDDDSIHSALTEVMDVTDSPCPAAISSVPSATVIDPRILDISTTNLVWPEDKH
FT                   QHLDECDLREQLTSSSLAERRGIDSPS"
FT   CDS_pept        join(328785..328813,328900..330274)
FT                   /codon_start=1
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752009"
FT                   /orf_name="AFUA_1G00910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87803.1"
FT                   /db_xref="HOGENOM:HBG051553"
FT                   /db_xref="HOGENOM:HBG326917"
FT                   /db_xref="UniParc:UPI000051EED8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX9"
FT                   /transl_table=1
FT                   /translation="MTLLIILFGLLLGGIFCIDEVTSSPLNNYIASQAGTWGHSPSYAP
FT                   TPGDFGRERTPSEYSLSPTHQFGERSTPLPQSQPSRLRFLDDLESDNGATDDDHPTYIP
FT                   YVIEWRVTLNHRVLAKDTEQDLVSRPSSYWRQIKQKAERVLRQKVNHNQRVKPDDTSVV
FT                   VSVNGRSQRDLTKHFEKTNIDWTAINRQIFMWQNLLHQCDKKLGISISINYMEDNSPPT
FT                   RRTNKRGSSSATNRMLRERDDRIDAEDSSRQPSVWRDVYQKMRCPGPPCHHEGQYCWQD
FT                   PEGKKHYKLRTHHLTALVKYVEQGGIIESHDDIPDNVREQLYAEERQRLSKQNKSTNGS
FT                   TGSMPPQININVLPAQSSQPSISSWGAEANPSTAQGEIVDIPGLLDQAVEEYTDWHLSR
FT                   VSAETFKANIKKARDVALDNCLDLKQIHGENPEFFVKQGVKIGAARKFVSDISLWLKHR
FT                   EQNKESGNH"
FT   CDS_pept        join(complement(332583..332955),complement(332211..332534),
FT                   complement(332024..332152),complement(331676..331938))
FT                   /codon_start=1
FT                   /gene_family="HOG000157393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268252"
FT                   /orf_name="AFUA_1G00920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87804.2"
FT                   /db_xref="HOGENOM:HBG051797"
FT                   /db_xref="HOGENOM:HBG323903"
FT                   /db_xref="UniParc:UPI0000F51A8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX8"
FT                   /transl_table=1
FT                   /translation="MERPHRPHRHRSSLEGVIVPSSQPLNRVFDKIILHLEPCQASDIG
FT                   YEPVTLIKLMNNEVFEKDEFLDLFFTFIQQELLGETEGTGLEQILSHIDRFCVWSAEET
FT                   NALRDCLVVFAKYLVDNFLPLKALAVKTPQPTPALSHSRTPEATIGTPQRVSNLRQACL
FT                   IRDRHRCAINRKFEAQEGQRRYKRDGPNLKDDDGKSLLEERDNMAFLEVAHIIPHSLMS
FT                   LTSEEGEGETYSKLMAYRILRMFNPGAIHLINGVDIDRPMNALTLTHDLHKLFDRMGRM
FT                   ERLPVTRTLYLTPDRSIDPPSPQLLKIHAAIGRILHLSAAGDCIDDILRDIEEMEAGEV
FT                   MPNGSTRLDDYVWFRLGETSVH"
FT   CDS_pept        333683..334717
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268253"
FT                   /orf_name="AFUA_1G00930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87805.1"
FT                   /db_xref="HOGENOM:HBG051804"
FT                   /db_xref="UniParc:UPI000051FD75"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX7"
FT                   /transl_table=1
FT                   /translation="MASVTPEDVAVLPVPPRLDEDAHHLAWEDWARRAPGQKLTTEKEG
FT                   YALIIAAEVVRSVEKGHFKPENSRKAYEVMVLTAHRESDLNPRAKNHKSSATGVFQQIE
FT                   RFHERSPLNPPSVRKVPLTVEQRMDVATAAGFFLRQLAHSHNWHKMKIHDAAYEVQKFH
FT                   RKDMHRYADPEITREVVCLSGALFPGQASMIDNAVYSDEERVKLRCPNSSRSSCKVGGC
FT                   DDDTPAASDWVPCEERGVPRLHIPMDVPPIDQTPKDSMPKDARDKWDRAIQTGSTGVVT
FT                   AIMGMGGGAVLGAATSGGVTVVPSGTALALSFNLLHPAGQVGALIGLGVVGTCWTWHYF
FT                   TSND"
FT   mobile_element  complement(335155..336129)
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   mobile_element  complement(335269..336066)
FT                   /mobile_element_type="transposon:mariner transposon family"
FT   mobile_element  complement(335287..335526)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(336865..337807,337873..337907)
FT                   /codon_start=1
FT                   /gene_family="HOG000136556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752010"
FT                   /orf_name="AFUA_1G00950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87807.1"
FT                   /db_xref="HOGENOM:HBG051819"
FT                   /db_xref="HOGENOM:HBG325275"
FT                   /db_xref="UniParc:UPI000051EEC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX5"
FT                   /transl_table=1
FT                   /translation="MAAPPEGSDPEWPPTNTQGASTEIITGDFSPPSEFRRVTRQYKRR
FT                   KDGTTAKEITRGPLFEFSGSGDGRSTCAGEILRVITDLRETITQQNETIQKIASDLTEI
FT                   EADQQHLKSQNAELQEEAQALRAKLNTLLGTGPTRSWAEVAAREPLQGPNVAPKPPKKE
FT                   LNCVRISTRRTPDDDEDGNDRFGTYLPTDMANAKIRSALLSTDPTKDAQVAGIGTTKTG
FT                   YVIRFRDTQSAEKAQNNTEWLQELGNDTKLVRPRFGVVVHRTPTEDFDLEGNKKLGIDK
FT                   LMEENDLSSKGFQIEDIAWLKKKDHPLGTSASLEVHRECGTIPD"
FT   mobile_element  338205..339398
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  339409..341796
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        join(complement(344113..344153),complement(343823..344039),
FT                   complement(342996..343763),complement(342821..342918),
FT                   complement(342629..342764),complement(342453..342497))
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904120"
FT                   /orf_name="AFUA_1G00970"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87809.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053320"
FT                   /db_xref="HOGENOM:HBG329790"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E575"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX3"
FT                   /transl_table=1
FT                   /translation="MTVAISNPAAPPVSARAYLSVIGGTCALLCTVGFVVAFGVFQGYY
FT                   TEHLLRGMSEFDIPWIGSASIFLLYVSAPICGVLVDRFGPKVLLIAGSIGVLVAIFMIS
FT                   LCSQYYQIFLAQAVLLGISMGFVTWPPFAVVSRNLPHHRGLALGVITGGSSVGGIVWSI
FT                   MIEELLTKRNLGFPWTVRVLGFTMLPLLAFACISITEPPKQSQPQPRPALEATVEGGSA
FT                   SPTPKPEYASLPLLRSTVFISICVGFGLAFLGLFNPFFYISSYAAGHGASAQTSSYMIS
FT                   IMNAATLFGRVIPGIVADRVGHYNVMIFVLLASGITSFCWTEVRSLTGLVIWSIAYGFS
FT                   SGAILSLQGACAGKIATPQNQGKAIGFLQGSLAVTVLVGSPIGGQLLGHYGYLSLSMFT
FT                   GATLVMGAVVMGYARLCLNRSPMEAHQFRFLLAPN"
FT   CDS_pept        join(complement(346476..346714),complement(346174..346397),
FT                   complement(345263..346145),complement(345160..345202),
FT                   complement(344953..345054))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752011"
FT                   /orf_name="AFUA_1G00980"
FT                   /product="FAD-dependent oxidase, putative "
FT                   /EC_number="1.5.3.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87810.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051838"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000051EA32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX2"
FT                   /transl_table=1
FT                   /translation="MRRATLIPLAIWVAGAAAAAAASLPQFPSCDISLANIGLSQNSQI
FT                   FFPNGSGWESETIRWTKYMAPTYAVSVRPAHVSDVTQVRFATRCKIPFLASSGQHGFDT
FT                   ELAELQNGMEIDLSAFRNVSVDAKKNTLTVGGGVRFMDVFDPVFNAGKEIRTSETDHQV
FT                   GTGSGACVGMISPTLGGGVGRLSGTHGIISDQLLSVQMVTANGSLVTVSKKENSNLFWG
FT                   LRGAGGNFGIVVEAVYQVTDLTSEKVVNLDYAFSTNDTGAIIDYLALFGPNMPPKLSFI
FT                   IAALYNEKLFGGVGDPGCVDPNRGRQSANTIPPSLFQFAVIVSGLYAGPQSEAEQLLAP
FT                   LLQNATLIKQNISVVPENKLVYAATFGSQGNSTIACSGKGVNRSIFGGAINTYDKATYV
FT                   DFLKAFGDLVTTNTDLRGSVFFIEHFSNYQVQKIPDHTSAYPWRDITAHLLFNYAWNDP
FT                   ANQQLMLYSARKLPRLRALKKEWDPENVFRFHHPISMS"
FT   CDS_pept        join(complement(348245..348512),complement(347632..348149))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904121"
FT                   /orf_name="AFUA_1G00990"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87811.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051845"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000052042A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX1"
FT                   /transl_table=1
FT                   /translation="MDSNSSNKIVLVTGANQGLGFAVIEVAGVRYPSNTYILCARDIEK
FT                   GQQAVHQLRDRGVAAIDLVELDVTNDDHIAAAVRHVEAQYGRLDVLVNNAGFVRLGHQD
FT                   TNLSEMRATYNEYMNVHITSVAVVTHAFTPLLHRSPAPKVINVTSGLGSITNVLSPRRM
FT                   ARVPPYGASKVGMNGLTAHLQVSENERVAAGEAKAPRIRFFISNPGLLKTAFSNYIAWG
FT                   KEPQAGAESIVQLMGDEEGKFDHAMQWEHEEGEMRVVPW"
FT   CDS_pept        join(complement(350648..351003),complement(350536..350593),
FT                   complement(349732..350475))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268254"
FT                   /orf_name="AFUA_1G01000"
FT                   /product="Oxidoreductase, 2OG-Fe(II) oxygenase family "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL87812.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG051854"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000051FD85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKX0"
FT                   /transl_table=1
FT                   /translation="MTVNGKDIDSPNAQYVAAGIDMSDLFPAPFPTNVKTVHLETLSLA
FT                   KLLQRDEDELRRIYENCKDPGFFQLDLTDDEQGVQLLQDAVDCARLMKQLLPNMSVEEK
FT                   RMYKQHSRVGVYSKGYQVYDVLPNGQPKYNETVNFPMTEMLGYGDSTVDLPDWLSPHRE
FT                   LFQRTMRSGNKIANIVLAALEVGLQVPRGALTDAHRIQDPSDDFLRLLRYPGLQPGQPR
FT                   DDLCFPAHKDFTSLGILFTWLGGLQLLASASAPGVTSGTMTGPLDIAEDAWRWVQPVPG
FT                   TAIVNVGNALEILTNKALTSGLHRVVRAPGEQLPFDRYSVLVGTRPANSFPMKPLQSPQ
FT                   ISPVLDPAAAEIATMTSGQWGTHNIGSFNNWVKARTERQEVLIIP"
FT   CDS_pept        join(352044..352678,352793..353213,353233..353476,
FT                   353525..353637,353824..354139,354193..354869,
FT                   355014..357995,358047..358955)
FT                   /codon_start=1
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057390"
FT                   /orf_name="AFUA_1G01010"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL87813.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG051862"
FT                   /db_xref="HOGENOM:HBG326168"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI000051FB18"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW9"
FT                   /transl_table=1
FT                   /translation="MSFPQVDVPSLPVGSASTQDTSPVSGPFNSSDSDHDIVNGGQANG
FT                   SPFTEPIAICGLGLRLPGGIRDGDSFWDLLVNGRDARMPIPASRYNISGFDGSLDGRDP
FT                   IKTTHGYFLDEDLSSLDASFFSMTKTELEKCDPQQRQLLEVTRECLEDAGETDYRGRNV
FT                   GCYIGNFGHDWMEISLREPQHSRSYNVLGYSDMILANRVSYEYDLRGPSVVIKTACSAS
FT                   LVALHEACRALQARDIPSAIVGGTSLILAPTLTSNFFGEGILSPEASCKTFDESADGFA
FT                   RAEGVTAIYVKRLDDALRDGNPIRAVIRGTGTNSDGKSMGIMSPSAEAHEALMRQVYDQ
FT                   AGLSPRETAFVEEKRRLSNASKCHGTGTATGDPIEATAVGNVFSERGVYIGSVKPNVGH
FT                   SEGCSGITSLIKAVLALEHKTIPPNIKFRNPNPKIPFVEKKLVVPIQPTPFPLDKAERI
FT                   SVNSFSIGGSNAHIDAYKSYARDHPDAISDIAYTLAVRRERLPHRAFAIWQNGELQTSS
FT                   LSKASAVPPAITMIFSGQGAQWAEMGKKLIETEASFRHDLASMDSILQSLRKPPCWSIL
FT                   EELQKPAEDSQINRAEMAQPLCTALQVALFHQLKRLGIKPTAVVGHSSGEIAAAYAAGY
FT                   ITLEYALAVAYYRGYITKNADRSRGAMAAVRLSATEVLPFLRTGVCIACENSPSSTTIS
FT                   GDKEALKEILARLKEEKPDVFARLLKVEMAYHSRASETLLLVLRSTHIFADHMKPLGIE
FT                   YLELLRAENNFGIPRSADKALFLSSVICKPMVDTASFGPEYWVDNLNSPIWHQDSTATF
FT                   LSALGRMYQEAVPLAVKALFPEERRALCGLPVYPWDHSESYWYESRLSSAWRQRPFPHH
FT                   SLLGERTVDSPDFSPIWRNMLSLEDVTWIADHKIRRDVVFPLAGYIAMAGEAIRQTTGV
FT                   DVGYRLRDVEARKALVLTDFKATEVVTVLHAHTGVPAEGPSWYDFSIASCHGGSWLIHC
FT                   TGQVSPLAETLSLSWEPESASQRSLPRELTPMRFYEAMARVGVVFGPEFQRLVDITSSA
FT                   TDPLAEARVMSPAPRENKRPFALHPTAIDACIQLLIVAAARGLCRNLDQLEVPVVVGNV
FT                   EVVSRGSANLRALAQDFTQGVECVTENSKLALRMSGLQLAPLAAEVADQIDVHAGARLQ
FT                   WLPDFDFVDHSGLFNKPQRPSLEIELEEQLTLLCVLESMDKVAHIPPCHPHLAKYREWL
FT                   ALQVRMAEAGQYTLVEHAKEWVGLPRVKRQKLIQDTYAKILDLPGRHAYSVGIKRICEH
FT                   ADQIFTGEADTLDLLMQDDILAELYDSVSFGYGDFVRLLSSNRPNLRILEVSAGTGGTT
FT                   EQTLRGLVDSSSLPPYSVYTFTDVSAGFFPQAKERFAYAPNMEFRTFDISQDGLIQGFE
FT                   AASYDIILAPNVVHATASLKETLSNLEPLLKPNGFIILTELCSLIKSPNYIFGNFVGWW
FT                   LGEADGRDWEPYVQPEQWDAELKAAGFTGVNAVVPDQDVPSYRLAATIISQPARKADVP
FT                   EIDRAVTLLYQSADADIVERLQLYLRDSGWQVDKCQLGEEMPPKGQDIIASVRLESDFF
FT                   GEDLSPDRLAAFQALIRHLDAEKVLWLCPRFQVRCKDPQSAQTLGVAQTVRTELNLPLF
FT                   TLEIDTNETRFEELVHRVLQKIRTTKDEASLHADKEFVVTDGQVCIGRYHPFDLKKELP
FT                   SRALTLDSAAAYLLVGGTGGLGRSMTTWMVEYGATELILLSRRAGKDRESQSLSQELEQ
FT                   MGCSVHLVAGSVENPEDIARSIASAKKPIKGVFQLAMVLQDAPLLEMTYSDWVNVNGPK
FT                   VTGTWNLHHALKDQPLDFFWLASSILTAVDTPGQANYLATGTFLEAFCQYRHSLGLPAS
FT                   VLNICPVEGVGFVAENAHAKKNMKAQGIYTLREREFLDFVELSLIDSTPSAGGNTSPTA
FT                   TPPGPWVNRSQVVMGLRSEQGLGDPHNRASWRHNRRMRLYHNRRTQESESARDGKNGAK
FT                   ASALQAFLERVREMGDEGLLRGEGVDFLAFEVGKKIHDLMLKPDEEVEIGRTLAQIGLD
FT                   SLMAIELRRWIKQVFGLTMSVLEIMGSGSLKQLAEDLAAKYAEKIQQ"
FT   CDS_pept        join(complement(374851..375565),complement(372405..374795),
FT                   complement(370902..372373))
FT                   /codon_start=1
FT                   /gene_family="HOG000217668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208707"
FT                   /orf_name="AFUA_1G01020"
FT                   /product="Pfs, NACHT and Ankyrin domain protein "
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="EAL87814.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG051870"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00005201DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW8"
FT                   /transl_table=1
FT                   /translation="MTNMKRTFPAIRAGLLVGISGGVLSKADVRLGDVVVGTRVMQYDL
FT                   GKVIGDGELQPTAIPKVPHHSLGTAVSALHSIHELNPSRVPSILRLKLDGHPEYRRPSS
FT                   PDRLFHATYEHESTTAGCEGCDQSKLVLRSRRTSDNIMIHYGAIASGNQVMRSGTTRDN
FT                   VARKLDVMCFEMEAAGLMDILPCLSIRGICDYSDSHKSKEWQRYAAATAAAYARELLEE
FT                   LPVAKAHLNLTWMPNPHQFPLHERRQRLLNSLRFEQMDSRKSTIRTALAKTCRWFLSHP
FT                   DYQAWLDPQNLTRHHGFLWISGKPGAGKSTIMKFAYSSMRSKSRNKHAITASFFFNARG
FT                   EYLEKSILGLYRSLLLQLLEGYPDLQAVLDDPDINSQGQNGCPSLDVLKDLFRSAVSAL
FT                   GQRSFMCFVDALDECDEQQVVDMVQYFEELAEQSMNKGILLRICFSSRHYPYIVIHRGI
FT                   RLTLEDQSGHGEDLATYVANRLQIEDPVLLEDLQTQLLRKAAGVFMWVVLVIDILNKEY
FT                   RHNGLALRRRLAEIPSDLSELFKDILRCDNENIEGLLLCILWILFAKRPLQPKEFYHAL
FT                   WSGLSLEDLADAQIPDVSVPDASDSLDRFKRCVIGSSKGLAEITKSKQPTVQFIHESVR
FT                   DFLLKERGLHELWPDLGFDWESSSHEKLKQCCDSYMNHTLVRAYISNVLSEAKADLQTG
FT                   ISKRYLFLEYASQHVLYHANAAAEAVPQDEFLSHFPVSNWISVNNIFEKFKVCEYSQDA
FT                   SLFYILADKGFPELIRTRLKEDPHIHVPGERYGYPLFAALANSNKDVVAALLNASLSVR
FT                   NGVDITEGLNHRKDLKQYAYRTPLSWAAQEGRTSIVELLLQTETPVDDMDAKGRTPLSR
FT                   ASENGHKAVAELLIGNGADVNAGDNDGWTPLSRASLRGHKVVAKLLIGKGADVNVRDND
FT                   GWTPLSHASETGHEEVVRLLINKGSDVNVCDNDGWTPLSRASLCGHKVVAKLLIGKGAD
FT                   VNVRDNDGWSPLSRASDEGHEEVAKLLIDKGADVNVCDKEGWTPLSPKLLTDKGADVNA
FT                   SDKEGWTPLLRALQKGREKVAKLLIHKGADVNASNNYGWIPLLHAIEKGHKKVAKLLIS
FT                   KGADVNVRHNDGWTPLSRASDEGHEEVAKLLINKGADVNVRDKEGWTPLSRALIHGHEE
FT                   VAKLLTDKGADVNVRHNDGWTPLSRASDEGHEEVAKLLIDKGADVNICDNDGWTPLSRA
FT                   LLCGYKKVAKLLISKGADVNVRHNDGWTPLSRASDEGHEEVAKLLINKGADVNAGDNDG
FT                   WTPLARASLCGHEEVAKLLIDKGADVNICDNNGWTPLSHASEKGHEEVVRLLIDKGADV
FT                   NICDNDGWTPLSRALLCGYKMVAKLLIGKGADVNVRDNDGWTPLARASLCGHEEVAKLL
FT                   IDKGADVNICDNNGWTPLSHASEKGHEEVVRLLIDKGVDVNVRDKEGWTPLSRASIRGH
FT                   EEVAKLLIDKGADVNAGDSDGWTPLSRTLLRGHEEVAKLLIAKGTDVNANNNNGLTGML
FT                   SSTAE"
FT   mobile_element  378709..382305
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        complement(382400..383350)
FT                   /codon_start=1
FT                   /gene_family="HOG000158806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057391"
FT                   /orf_name="AFUA_1G01040"
FT                   /product="Pfs domain protein"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="EAL87816.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG051883"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0000F51A41"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW6"
FT                   /transl_table=1
FT                   /translation="MSLRLATEAYTVAWFAPLHFEASAAILMLDEHHQSPLPNEGQRLC
FT                   YRFGRMGRTNVAIAFFPAGEIGIGVAGYMASEIQRDLRNIKTGILVGIGAGIPRYGRDM
FT                   RLGDVVVASPTDNNSGVLGFDMVKIEPEQIVLKQWQNAPDRHIRSAMTNLRASPETTAR
FT                   FMSNLNRFRSTSFPQCPVPPPNVTCGSFTQRREPLIHYGCILSGNSVIKSAEIRNQLAR
FT                   EYDALAIEMEAAGMMNTLPVAVVRGISDWADAEKNDVWQEYAAATAAAVAKDLLACLDG
FT                   SHSISCKYCILTMPDTSSHMLQAKLNYGTTQPRPF"
FT   CDS_pept        join(complement(385713..386244),complement(385302..385660))
FT                   /codon_start=1
FT                   /gene_family="HOG000136552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268255"
FT                   /orf_name="AFUA_1G01050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87817.1"
FT                   /db_xref="HOGENOM:HBG024260"
FT                   /db_xref="HOGENOM:HBG051891"
FT                   /db_xref="UniParc:UPI000051F89E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW5"
FT                   /transl_table=1
FT                   /translation="MAILMTSSDTGAQQEPPTPERARSVDFTTRHPDLGLGSLKSADIF
FT                   VPGFMTVLDNYRTILQQGGSIALGRGETLASVRLDRSLSALFSTEAPEVIQGPAITWTA
FT                   LVLSAGPHFDGESQFKVGESLVEVVGDDLELIRSGRPWRFLSPWPDRDDCEAELRATEM
FT                   TLHELLDTEQLICEVLEKSAFLENELRSRQRLIDQLRSGEQRPTPTTANAGSATVHSKD
FT                   SSDCSSHEAFAVTAVNKVCQANSTGTASDISGPGETRSQKSIDLGSPRIPGAAMAPESV
FT                   QAGVPHLDFILNLHE"
FT   CDS_pept        join(complement(391258..391294),complement(391137..391188),
FT                   complement(390761..391091))
FT                   /codon_start=1
FT                   /gene_family="HOG000217852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904122"
FT                   /orf_name="AFUA_1G01070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87819.1"
FT                   /db_xref="HOGENOM:HBG051906"
FT                   /db_xref="UniParc:UPI00005201FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW3"
FT                   /transl_table=1
FT                   /translation="MVFRNTTVRAGYYLRNHLEEHISEKSWPSKEHLHDVHHYNKAICV
FT                   PSEKARKKRSFSDIDEGCVGDQDPPKRERRPRKQQKKSSASPHASLKDLKIILWEPPIR
FT                   QHQAVFPLPAEAAHENGERLTDLAYQAVNHCGHFE"
FT   CDS_pept        join(complement(391538..391941),complement(391423..391480))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268256"
FT                   /orf_name="AFUA_1G01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87820.1"
FT                   /db_xref="HOGENOM:HBG051913"
FT                   /db_xref="UniParc:UPI000051EC7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW2"
FT                   /transl_table=1
FT                   /translation="MRAEIDNAGTPGDRERLNAQYRAQKKRIYARELERFRKEWVRQRR
FT                   DQFILTRGKECPIYGEQSAEKRTWCDIMPELGRLVTVMSSDEPLEFEAKRAVVEDLVIH
FT                   CQRDYDVVYLPGQEPVEGRCPAYGCGKVMQEDPKEAAIFNPTFDGRNLV"
FT   CDS_pept        join(complement(393403..393602),complement(393103..393364),
FT                   complement(392967..393054),complement(392806..392945),
FT                   complement(392457..392690))
FT                   /codon_start=1
FT                   /gene_family="HOG000129930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904123"
FT                   /orf_name="AFUA_1G01090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87821.1"
FT                   /db_xref="HOGENOM:HBG051919"
FT                   /db_xref="UniParc:UPI000051EEE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW1"
FT                   /transl_table=1
FT                   /translation="MAGVSDAWKAAQKAAREERKREQARQRREQRGYDPKAYREKDAQR
FT                   SWSKASPETKEDYLKRVRTYENSDELDSFLVEEKGMPVGYKVGKEHPVPTLDELKELFR
FT                   WYIDSTKGKLDPEGRPTMKTTLIRAQQFVPGFALETGKRIPEQDATELYCWIEKDLVAQ
FT                   KFIKVIKKPKYNVKPGDFERDDDLIFMSGRFRVQFHFTTLLYFCIGARVAAICPKFKHR
FT                   AERGLRYKTWVKNNVDPENTAYVKFDRLCFLRLISWKLTVGPSDSALQYGTAMSPFMPE
FT                   HFCCSLLLSLMVLSLAIRLPPISSSK"
FT   CDS_pept        complement(394863..395585)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268257"
FT                   /orf_name="AFUA_1G01100"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /protein_id="EAL87822.1"
FT                   /db_xref="HOGENOM:HBG051924"
FT                   /db_xref="UniParc:UPI000051F3CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKW0"
FT                   /transl_table=1
FT                   /translation="MRSMPYLPHQMRGEAVPQPSNSSPVQQPQTDHHARSSLQHAITMI
FT                   IIVHDLCSSSDLFFGWPAILHPLWNATVTILGFVVANPSSSRSRRAIQWIFKALAVFEA
FT                   FAATEPFAARAETLTKSLVTKLNDILTTLDEKSEQEQTNDRGRIAPGLTLQQSPDSVTS
FT                   TTPSSANPVDMLRGSLAGGLEHTFDNTFFTDDSLCSSIEAAEINTWAAYQDHLDIWNGS
FT                   HSDKALDATYTLGIGNTP"
FT   CDS_pept        join(400777..400918,400993..401217,401326..401591)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057392"
FT                   /orf_name="AFUA_1G01110"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /protein_id="EAL87823.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG051928"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniParc:UPI000051F3FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKV9"
FT                   /transl_table=1
FT                   /translation="MNIYMVIFRLRPDDSFFIASGLKGLCGSIAVYLGRHGARNWLLSV
FT                   AVWNITSLGDVRRAFTTASLPVIGVVQGTMVLRDRMFSTMTPDEFRQPSHQSFRSLKPA
FT                   SRVARAINFIAFHYPPIQRLIGRHGPCHLLTAAVELANPVLMRSLGVVEPLKPTRPLSN
FT                   YGVDSLVAVELRNWVPQQLEIDISVLQIVSVRTLTALCETLLGKLVR"
FT   CDS_pept        join(complement(403213..403563),complement(403059..403157),
FT                   complement(402756..403010))
FT                   /codon_start=1
FT                   /gene_family="HOG000158603" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057393"
FT                   /gene_name="plyF"
FT                   /orf_name="AFUA_1G01120"
FT                   /product="Probable pectate lyase F "
FT                   /EC_number="4.2.2.2"
FT                   /function="pectate lyase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87824.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0030570"
FT                   /db_xref="HOGENOM:HBG086784"
FT                   /db_xref="HOGENOM:HBG418288"
FT                   /db_xref="InterPro:IPR004898"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051E7FA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKV8"
FT                   /transl_table=1
FT                   /translation="MWSSIAAFPVLVPVALACLGYEGGVPTPTAHHSNSAVIEVAAGQV
FT                   FDAGWAKYDRGSGACKGQSEGDWKDAVFYLHSGATLKNVIIGANQAEGVHCDGPCTLQF
FT                   VWFEDVCEDAITIKNDKAGQETWIIGGGAYHASDKIVQHNGCGTVNIINFYAEDYGKVP
FT                   RSCGNCDKQCKRNVYVEGTTARNGGEVVGINLNYGDTATLKNVCADSAHPCVFYDGCAG
FT                   DCEPKKVGYCSG"
FT   mat_peptide     join(complement(403213..403512),complement(403059..403157),
FT                   complement(402759..403010))
FT                   /product="Probable pectate lyase F "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKV8 "
FT   sig_peptide     complement(403513..403563)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKV8 "
FT   CDS_pept        404882..405535
FT                   /codon_start=1
FT                   /gene_family="HOG000217121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268258"
FT                   /orf_name="AFUA_1G01130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87825.1"
FT                   /db_xref="HOGENOM:HBG050847"
FT                   /db_xref="UniParc:UPI000051E7ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKV7"
FT                   /transl_table=1
FT                   /translation="MSYFHYFPSLPAEIRLQIWNLSLPASRVIRITCDRGIKPNSRRYA
FT                   RGFRANHPNPVQLQVNREAREEALREFVPYFRTEVSPHACIYLAPERDTVRLGEAVLAY
FT                   LGEAERHALQRMIIEVNDYLLFETYGLESLWCMQRLKEVDLIVSQTPVASYHRRDIVEV
FT                   IRDAFQEYVRNHPQWQIPHVRMVSALGKQMGSFTIDPAEMDTVQPSVLFDGHAG"
FT   CDS_pept        complement(405928..406686)
FT                   /codon_start=1
FT                   /gene_family="HOG000213360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904124"
FT                   /orf_name="AFUA_1G01140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87826.1"
FT                   /db_xref="HOGENOM:HBG050855"
FT                   /db_xref="HOGENOM:HBG331611"
FT                   /db_xref="UniParc:UPI000051FFB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKV6"
FT                   /transl_table=1
FT                   /translation="MSSLLQSRWAPKPNEHKTQGQVGPPAPASPSPGRRMLLSPAGELS
FT                   RFMKIVARLKWKLPFLAEGYRLATLRTDSPEAVAHAEVMFKIDFHEYYALLERALVHLL
FT                   GVFGIAVSAVGKGSGSNSVWSTHRYHANVLEALEDENCPLRSVFRKGNVFEQLRKAKEL
FT                   RNRWKTADLTEQEKKQESIWSSRREATMPLQNYDFDRMLADIFDGLEDGCRLAQQHVAN
FT                   LDKSNHTQAQADASNADWDFIVDAMDWEAV"
FT   CDS_pept        join(complement(408764..408853),complement(408554..408758),
FT                   complement(408307..408490),complement(407809..408239),
FT                   complement(407443..407760),complement(406882..407414))
FT                   /codon_start=1
FT                   /gene_family="HOG000171671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904125"
FT                   /orf_name="AFUA_1G01160"
FT                   /product="5'-nucleotidase, putative "
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="EAL87827.2"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG050864"
FT                   /db_xref="HOGENOM:HBG323917"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="UniParc:UPI0000F51A89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKV5"
FT                   /transl_table=1
FT                   /translation="MHSAEVQFVHFNDVVSLSNIPVEERSSLTIYHVPPAGLLAGFLQL
FT                   QRNFAASNPRAQTLTLFSGDAFSPSLEASVLKGEQICPVLDLVGVDIGCYGNHDFDFGD
FT                   ARLIDLSSRLKFPWLLSNAFHRPLGPTKRFLGSAQEYIVRQLDNGLRVGFIGLAGTDWP
FT                   SNCEDLPPCEIESPVEVARRLARYLRFSEKCDLVIALTHMRVPEDMLVANATARGDSRV
FT                   DLLLGGHDHDVIRRFAGDTDFKAENVEQGRKVSDIEVNGLVPDAEGDVRLVKSGTDWRG
FT                   LSLIRLIVQRDDNGAVTGSTVKLRQYTDIQAAIAVPQVPLEIVKTLDTIHERVGTLVQK
FT                   PLLHSAVPIDGRNFTIRREETNLGNMLADAVRALYGTDVGFFNSGAIRFDKILKATVPD
FT                   CEPLRVRDVITSLSAYDICPFGNALLVKKLPGEIIRQSLENSVSDKHTDGRFLQISGLR
FT                   IVASWHRPEGSRIIDVQLERSDGRLEPLDPRRMYTVAMPSFIAQGHDGFTWLPQLETIV
FT                   NEEAGMTDTALLLDIFGHSEDPYGGDCESSSHALGVERARNLTIVGRSMSDSLPVVKPA
FT                   VEGRIRFVDA"
FT   CDS_pept        join(complement(411779..411783),complement(411327..411708))
FT                   /codon_start=1
FT                   /gene_family="HOG000213349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752012"
FT                   /orf_name="AFUA_1G01175"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="EBA27324.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI0000F51A8C"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9R4"
FT                   /transl_table=1
FT                   /translation="MALSEYHAILHRDKYAILYFCDSCDHCASLDPTYNDMASAVADAD
FT                   DMIDFYKINMSRHRDISDTAMVEKPTLLLVKDGRELERFCKPVPQQLEYMVSQALCGMT
FT                   KISMIPYTEREGHGDLMYCIPAQK"
FT   CDS_pept        join(complement(414347..414594),complement(414073..414273),
FT                   complement(412777..414019))
FT                   /codon_start=1
FT                   /gene_family="HOG000159116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268259"
FT                   /orf_name="AFUA_1G01180"
FT                   /product="Isoamyl alcohol oxidase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EBA27325.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323919"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000F51A52"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9R5"
FT                   /transl_table=1
FT                   /translation="MKTSWALATLVALASAKGSKGAQCRCLPGDSCWPSPASWAALNST
FT                   VGGRLVATVPIGSPCHDPTYDAAACAALRDAWNLPQTHIESSSSIMQTYFANQSCDPFT
FT                   AQSKPCTLGNYVNYAVNVSSSNDVIAAVNFARKNNIRFVIRNTGHDYFARSSGAGALSV
FT                   WMHHFNDIQYKDWSDSHYKGPAFKVGAGVMGFQVLEAAHARGLVVVGGECPTVGLAGGY
FT                   IQGGGHSALSTSYGLGADNALEFQVVTAAGKLVTANRSTNPDLFWAISGGGAGNYGVVI
FT                   SATIKAHPDATVAGAGLQFLSSKTTADKFYEAISEFHGLLPEMIDAGATVIYQVASSFF
FT                   AINPITAYNKTTDDVKTLLAPFINVLDSLSIPYTVSYTEYASYYDHYNKYMGPLPYGNL
FT                   GVGEYQYGGRLIPRDVLDNNAAGFASVIRNITEHGVIAVGVGMNVSQPGDVSNAIFPAL
FT                   RNAAITMQIGTHWNETAPWSQMLEDQYKMTNEYVPQLEAVTPGSGCYQNEANFRQPNWK
FT                   DTFFGVNYSPLLKIKQKWDPSYFFYALKAVGSDYWTVDDSGRMCHA"
FT   CDS_pept        join(417270..417431,417493..417874,417922..418039,
FT                   418090..418552)
FT                   /codon_start=1
FT                   /gene_family="HOG000201285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268260"
FT                   /orf_name="AFUA_1G01190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87831.1"
FT                   /db_xref="HOGENOM:HBG050893"
FT                   /db_xref="HOGENOM:HBG326047"
FT                   /db_xref="UniParc:UPI000051EED9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKV1"
FT                   /transl_table=1
FT                   /translation="MAQDSQTTADLGPALVRGIWAAVIIAVIIVVLRVFAKVKIGQFRV
FT                   DDVLMIVSLILVVVATVFLTQCVQHGFGKNLLLLVKEKPHDVQLVLKYIAIQVPIVTIS
FT                   TTIARCSFVLYLLAILGNNKKYQIALWTVMVLQFAGNVVSAVLPLSICRNVRILWDPTT
FT                   KTTCGDVHAVIKFAYYSNTANSACDLFLAVFPTLIFWNLNLKMRIKISLIILLSLGILA
FT                   MIASIIKTTKLNEVPSVTNLGASGAVELIRWAYVENAIIIITSSVPCIRPLIISSVRKF
FT                   SSRGYSRSYELTGPATGQRRTGHDETAQSRRTRRFTKNGPPDTGSIERILDPVSNTNTS
FT                   VSGRRDSPPHLDQGITKQVEISVISNDQLSRDHP"
FT   CDS_pept        join(419161..419752,419805..420433)
FT                   /codon_start=1
FT                   /gene_family="HOG000161224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208708"
FT                   /orf_name="AFUA_1G01200"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87832.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG424315"
FT                   /db_xref="HOGENOM:HBG492478"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F163"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKV0"
FT                   /transl_table=1
FT                   /translation="MYHRSAFGLVLASILLLNPVAGKPPLGQTPQMGWNSWNTFKSQIN
FT                   SSVIENTVQLFEHLGLKDVGYEYILLDEGWSDYSRTADGYLQPNLTSFPNGIKPLIDDN
FT                   HAKELKIGLYGDSGILTCGFRPGSWSYEERDAQTLARWGVDYWKYDNCGGFQAMTEPPQ
FT                   VRFGIMQKALELSGRQIFYSVCEWGYQFPWHWGGKIGHSYRMSGDITAKFTNETGCACK
FT                   TAYCLNTGYAGCSVLSIIRKMREISQYQTPGHWLDMDMLEIGNGEMTLYQQQTHFAFWA
FT                   ALKSPLIIGADLSKLSDESVAVLKNKDIIAVNQDSLGQAVHYIESASKEGAWQVWAGPV
FT                   NGGFVVLLLNEKSYPQALSVSFADLRLGLDGPVQVTELWSHKSLGKVDGYKGVLQPYQT
FT                   LVFRLRF"
FT   CDS_pept        join(complement(421088..421404),complement(420901..421039))
FT                   /codon_start=1
FT                   /gene_family="HOG000217119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268261"
FT                   /orf_name="AFUA_1G01210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87833.1"
FT                   /db_xref="HOGENOM:HBG050906"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000051F88B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU9"
FT                   /transl_table=1
FT                   /translation="MKLSSTILVTCLTACSSVFAATEDPLNYRNIERPYIAPKPSNTTT
FT                   LLEYIKSRSDLSRLSEALDKVGGFSEAFDTDPTWKFTFFAPNNDAFEKNVGRYFNTFES
FT                   TPKGRWWLGNTMLHHYVPNTNLKSSSFNETYQQFQVIQHPGLRRHTG"
FT   CDS_pept        join(421825..422635,422686..423074)
FT                   /codon_start=1
FT                   /gene_family="HOG000217118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268262"
FT                   /orf_name="AFUA_1G01220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87834.1"
FT                   /db_xref="HOGENOM:HBG050916"
FT                   /db_xref="HOGENOM:HBG329624"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniParc:UPI000051F3FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU8"
FT                   /transl_table=1
FT                   /translation="MWKIFLNILALAGVCHSIVSDIPSVYGPIPHVGDFSGVDSTKYLK
FT                   RRPGDFVHPGIWHTHEDLERIRTNVISKKDPWASAYEKFSADEYSQANYQMQGPHAVIS
FT                   RGKISNYTSFAHDVRAAWQNALMWYITRNQSHWDRSTTILDAWGSNLTDIIGTDRSLLI
FT                   GLDGDLFVNAAEIMRWEGNWTEAGAKWQGGSGFSNQLYWLFSRQSVVVGQANYGMASIK
FT                   AMLSFAVYLNDVELYNYAMNAFIQDNCAGLFAQYHPETGQSVEAGRDQSHTMSGIGWAA
FT                   YGARVGQSQGVDLYSLGHNLLLKASEYAAKYNLNETVEYDPKWSRCEAVLVNGPWATIS
FT                   EQRRGVTNQNPIWDILYYQYVVKRKAKAPWTTKAREFEGFEGAVSSNDHPSWGGLIWAY
FT                   "
FT   CDS_pept        join(423561..423825,423869..424171,424338..425050,
FT                   425106..425420)
FT                   /codon_start=1
FT                   /gene_family="HOG000217117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268263"
FT                   /orf_name="AFUA_1G01230"
FT                   /product="Beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /function="xylan 1,4-beta-xylosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87835.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009044"
FT                   /db_xref="HOGENOM:HBG050923"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000051F650"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU7"
FT                   /transl_table=1
FT                   /translation="MRRFTLFLLAIQSWVLTTLAIRNPIITGWNPDPSILRVGGEYFLA
FT                   TSSFEYWPSTPIYKSKDLANWELFSHAFTRPEQLQLYGTPTGAGGPAGAWAPTLSYING
FT                   KYYLAAMTRWTYDPVARVWPRVMWVSSRDLRTWSDPIWGDPWGIDPSLFQDPVSQKVYL
FT                   NLMAPNNNKDRIWGIYQCEVDIDSGRCGTDDLHRASIARSLAPEGPWEPAPHNPILFNG
FT                   AYGYDNLTVQSTGHATIFEAANGDSYVVYLARRKINGSSPLGRETFMSPVTWKDGWPMI
FT                   NGGNPVLLSESFGASHDQKPPPPRFIDTFDQKTLDPSWYTLRTPYAPIYDLKDGGRKKS
FT                   HGIVFRPNVFGLSDRDTPAAILRKQKSLNMTFSAQLLPTTSGLGYGETVGISAYLSELQ
FT                   HQDIGVSGCVNSTGMCIFTQLMMNGTTEYKQVKLNSTSIPSDLTLHIRATPLSYKLGYS
FT                   FGSDETITWLASLSSSWLAFAPSGWFVFEGASFALFATGTGQPWPPHAPEVGFSQVTET
FT                   YYDEDIPNYDQWSV"
FT   CDS_pept        join(426187..427050,427099..428733)
FT                   /codon_start=1
FT                   /gene_family="HOG000217116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268264"
FT                   /orf_name="AFUA_1G01240"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87836.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG050932"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005201DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU6"
FT                   /transl_table=1
FT                   /translation="MSPRPTAPPPDLDQLDCNKDKIPACQSCRRKKAKCDREQPCSQCV
FT                   RFNVICLYENGRLKPGLRAGAVEQLQRRVETLENMFIGQGILWQKIWDTVSNSAVGVEQ
FT                   NDRDFERIGVDQVRHRVKDTLLQLAEDNGGSLRSVVDNVPEDNIERDAPPVKRRKLDSQ
FT                   SSATERPSPSGHSASAPLNAHDLPSRDVMNDLVEFYFANVHHWIPILHVRKFREQIQTT
FT                   EGWDKAIHILHAIVATCIRFSHHPGAGTIEARREMAVASRQKVILNSMESFSVENLQAL
FT                   VIIAFDTIGSGRGPSAWSIVGSMTRTVEQLQLSVEESQGDRGSGEGEFLIQRMVFLKPS
FT                   KFWWQAEERRRVFWTVFLMDRFCSVSTGWNLSLTSADVKRRLPCEGALWEKEYEVRAPF
FT                   FGISDKSTLSSSSPNIVDNDPAKGDPEQDAIGGFAYCIEATESLTLVINFFLQHALNLQ
FT                   NAQKAQLWLMKFKELDLRLVQWKLFLPPKWRTASVLNEDGVMDPNLTLAHMTHNTAVIL
FT                   LHQSIAYPPSHWKQCPVRLPSVASAETCIEAAAEIATIGQQFLDHSPILTNPQFSFCLF
FT                   IAGRMLLTHSTYTKTAIPDQLDSIATSLWEISRRWAGPNTPGLENLASVFAKRLLNARR
FT                   HASGRTSLDIRRTVYSDSTERADPVPEQNSDGNEGPADSQARTNLPRGSFDGSGHSASP
FT                   KLPTYAGDWSNRDPMQNGPSPNGSLYNALSLAFPPLPLSLQPQYASISEAHMLDPALLP
FT                   KDHVPSLYPAPPVETLHAQPLWDPVAQSYNDCNNNPNPDYASRFVNLPSSPGHRISRYG
FT                   DPSMNGENIPPNGEVPGNIR"
FT   CDS_pept        join(complement(430470..430700),complement(430246..430401),
FT                   complement(428894..430198))
FT                   /codon_start=1
FT                   /gene_family="HOG000217115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057394"
FT                   /orf_name="AFUA_1G01250"
FT                   /product="Glucuronyl hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87837.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG050939"
FT                   /db_xref="HOGENOM:HBG325399"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000051E58B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU5"
FT                   /transl_table=1
FT                   /translation="MLSGSWGIGLERCCIPVYVFRSYMVCHDDFTRVDYGGRLKTQENF
FT                   LSPSPSYFKRSRRVGIQAAILKALAKVPDTMDEPAPKRLRGESKHEENGTCAESSGIPQ
FT                   WVIHALYSESVTAKLWNVASRALGKAEPPTFFPEYTGKDGATYVYRHLSFWTSGFFPGS
FT                   LYLLLERQAKNNSSTEPCTPHPLVLQHLCQWWTVNLHQNATLNTTHDLGFMIAPWAIKA
FT                   WELHRDARAFSSLVTAANTLASRFCPKVQSIRSWDTCVTKRYSFTDPSRDFLVIIDNML
FT                   NLDMLFWVAKETGNRHLYDVALAHARTTQRHHIRANHSTYHVVNFDQETCTPKEKLTNQ
FT                   GYSDESCWARGQAWGILGFVQTFQWTGDPSFLQTSRQLADYFIKNLPGDGVPYWDFDAP
FT                   VTSDSPRDTSAAMIASCGMLLIYKALRAQGKYDESEHYLVAVKRIVEGTLSKFLNPPTF
FT                   KFIVQPSNRGIETYEDGLPCDHEEKPEPGFLAVSESAATNGMNGRGVNGTESKKPVAET
FT                   ILTGATINNYEFAPRRWANHGLVYADYYFMLLGNMLLELGLVPSLP"
FT   CDS_pept        join(431132..431326,431373..431566,431618..431645,
FT                   431695..431750,431798..431895,431944..431963,
FT                   432008..432492,432536..432755,432809..433093)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268265"
FT                   /orf_name="AFUA_1G01260"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87838.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000F51AAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU4"
FT                   /transl_table=1
FT                   /translation="MPDIESKASKAEEQETVSPMKPFQHGELDQETAAYANSTAIHVDK
FT                   ATNRRLFWMINRRVLVCMLATYFCQALDKGTLGFASIMGIQTDAHLVGNEYSWLGTILY
FT                   IGVLAGEYPTNFLLQKLPVGKYIASNVFLWGVVIACSAAATNFPGLMAVRFLLGVFESC
FT                   VQPCFILMTSMWYTRSEQTILTSLWYCMMGVQLMIGGLLAYGVEHYRGHSIKSWQLLFL
FT                   VLGVATCAWALFMGWYLPDSPMKAKCWSEADKRLMVERVRANETGIQNRVFKKYQVLEV
FT                   LRDPAIWLYALLQMTSCLIIGGLGVFSNIIIKSFGFTTLQTQLLNIAQGGVTIAVMVGG
FT                   ASLATWTKQTILTMHLWTIPAIIGTAIIFTIPPTPKTRAGLLIAFYCTQFILAEGNLLF
FT                   SLISRNVAGQTKKSTVLAVTFIAWSASNAAAPQIFRSDDAPRYHKGLTAHFCLYALFNI
FT                   ILLSLRTVLMARNRKKRSAAAAAGQVSPSESSADEKIEHSNAFLDLTDKENPDFRVRSP
FT                   TATSWVYGS"
FT   CDS_pept        join(435615..435907,435963..436158)
FT                   /codon_start=1
FT                   /gene_family="HOG000217505" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268266"
FT                   /orf_name="AFUA_1G01265"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27326.1"
FT                   /db_xref="UniParc:UPI0000F51A6E"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9R6"
FT                   /transl_table=1
FT                   /translation="MALIRLHLEDTKARQSWKNDSRQATVASTIGRGDATRIIDTILES
FT                   IHEGWRHLSPKRQSDLRAKFHERKKYGKRWLLLADRLGPGILLLCSTKTANLVRNTSVT
FT                   AKMLEDIASQVQASQAETMRTLAIINPLAQCLFRDEGYSEYDRAEILRQIRDVGSATV"
FT   CDS_pept        join(436429..436512,436575..437709,437738..438168)
FT                   /codon_start=1
FT                   /gene_family="HOG000166635" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268267"
FT                   /orf_name="AFUA_1G01270"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87839.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG050957"
FT                   /db_xref="HOGENOM:HBG324782"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051F8B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU3"
FT                   /transl_table=1
FT                   /translation="MSFLMESSAVGQPSPLSFSNTLNALPGALVLYAALHSLYNIYLHS
FT                   LSRFPGPKLWQTSYIFRHIASIRGTLDVSIKAFHTEYGPVVRYSPDELSFISAEAWRDI
FT                   YGFRENALPKDPSFYGLIQLSRDKSPSIFTVDQDHHPRVRKALSYAFSEKALHDQEPFV
FT                   KHYVDLLIQRLRGIADAEDNRVDLVKWYNFTTFDIIGDLAIGRSFDCLQDSAYHSWVDA
FT                   FWKSIKMISPYARAMATYTDVPRLLRLFAPRALKEARLRRLQYVGVHMEERLARGILRD
FT                   KPDFISYILRSKGTADELTDGEVEANVSFLLLAGTETTATALSGTTYYLLKNPEGLRKA
FT                   TAEVRSAYNSEDEITFATTAERLPYMQACLTEGLRIYPSGPIAAPRRTPRGTVTWIAGH
FT                   PVPPVGGASNSPLNFHRQADFIPERWLSPSTMDPASPFRRDNRAASQPFSVGPRNCLGK
FT                   AFALNEMQVILARMLWNFDMKLLPQSDGWERQRIFTLWDKGPLMVELNEVRSSLHNQLF
FT                   LQVCMVVCMVVHQSRSLQRAVHSSGPARNLTG"
FT   CDS_pept        join(439336..440187,440251..440421)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268268"
FT                   /orf_name="AFUA_1G01280"
FT                   /product="Polyketide synthase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL87841.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG050972"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="UniParc:UPI000051F88C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU1"
FT                   /transl_table=1
FT                   /translation="MDRAMAISTGPQTDTRMDISVDSRTDMPTVMSTTEMATPMGILMV
FT                   ISRITHGMKTTNLQLQLPFVAWGCDCPAGSVTNSPSTNFSSTKATLALLRQTTGITWMH
FT                   ITAPHGKHGTVITKHGYFLKDTDLTQFDPSMFSITAAEAEQLDPSQQENQEHIKAIVDI
FT                   RVVISISAPLDTNAPELRIPRPRTFIGTRPPPPREAEARIRAYIKNILPGAIRTESKPT
FT                   AEMWELVLCVSQQAYLPRLFGVKGSGQKAALSGIMESLEKWKEERGKGLPALWIVHGSG
FT                   DTMIPPVCSTGFVQRLREVLPSIPARLDVLPGEHLFDVDITMEEEWVTMGRGFLEHYWP
FT                   "
FT   CDS_pept        join(441786..442684,442733..443030)
FT                   /codon_start=1
FT                   /gene_family="HOG000217114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268269"
FT                   /orf_name="AFUA_1G01300"
FT                   /product="GPI anchored protein, putative "
FT                   /function="poly(beta-D-mannuronate) lyase activity "
FT                   /biological_process="alginic acid catabolic process "
FT                   /cellular_component="periplasmic space"
FT                   /protein_id="EAL87842.1"
FT                   /db_xref="GO:0042122"
FT                   /db_xref="GO:0042597"
FT                   /db_xref="GO:0045135"
FT                   /db_xref="HOGENOM:HBG050979"
FT                   /db_xref="HOGENOM:HBG299561"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniParc:UPI0000520415"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKU0"
FT                   /transl_table=1
FT                   /translation="MKFTIWSSLLALPNALAHPRSVQERSNFAHPGLLHTAADFSRITS
FT                   KVNSKAEPWFTGWNKLSSSSYRSLSYNANPQAVVYRGSDGTHSENYASLYRDIAAAYIT
FT                   AIYWKVTGDTAYADKAVSILDAWAATLTGISGSSDKFLAAGIYGYEIANAAEIMRTYNG
FT                   WSAQNIAKFQNMMVEVFYPLNHIFLEQHNGAAIDHYWANWDLCNIASMMSIGVLTDNRT
FT                   MYDEAINYFKTGAGNGQIEKMIWKLYQVDGQTLGQGQEAGRDQGHAMLDFALLGVIAQT
FT                   AYNQGDDLFGYLDNRILAGAEYVAKYNLGNDVPYTTYTNSDVAQTVISNASRGDIRPIW
FT                   ELLYNHYGVRKGLNVKYTKQYRDLVVEDGAGAEGGGGNYGPNSGGYDQLGFGTLMYTL"
FT   CDS_pept        join(complement(444510..444743),complement(444116..444460),
FT                   complement(443676..444068),complement(443051..443560))
FT                   /codon_start=1
FT                   /gene_family="HOG000157213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268270"
FT                   /orf_name="AFUA_1G01310"
FT                   /product="Carboxylesterase, putative "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87843.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG050985"
FT                   /db_xref="HOGENOM:HBG327208"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000051F651"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT9"
FT                   /transl_table=1
FT                   /translation="MIISTLLCVLSGSSIGHAASHSTRPVADLGYSRYQGVRLAAGVDQ
FT                   YLGMRYAAQPLGTLRFRASRGPVHNSTLQDASEFGPICVGTGQSTTSTRAEDCLFINVF
FT                   TPADATEHSKLPVWVFIQGGAYATNSNANYNGTEVVRESGNNIVFVNFNYRVGALGFLA
FT                   GAEVQRHGDLNVGLLDQREALKWVKRHIRQFGGNPDHVVIHGASAGGGSVSFHLTAYGG
FT                   RNDGLFVGAIPESPWWAPQVTISESEILYNRLLQAVGCSTLACLRAVDASAIQKANLNA
FT                   PDQGLISYPAGLGKFWPVIDGDLVRDRLYASFEKGKFIRVPLMTINDAYPKMDPVPQHA
FT                   AYFPSVSAAFGDATIVCPGIHITNNMARFFEHGSDKVWNYRYNVQDPPRIAAGLGVTHT
FT                   FDLQAIFGLNYGSSVSSSMRDITPIIPVVMHYYISFIRTLNPNLLKADSAPFWKPWGDG
FT                   ERLKVQTNATAMETVSAVQWDRCSLWKRLAPVLEG"
FT   CDS_pept        complement(444989..446455)
FT                   /codon_start=1
FT                   /gene_family="HOG000217113" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904126"
FT                   /orf_name="AFUA_1G01320"
FT                   /product="Endo-polygalacturonase, putative "
FT                   /protein_id="EAL87844.1"
FT                   /db_xref="HOGENOM:HBG050993"
FT                   /db_xref="HOGENOM:HBG345912"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000052090B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT8"
FT                   /transl_table=1
FT                   /translation="MVTMLKHVLLATAAAFLVLNVVAGELCNSTAPVVVHPTPPGVSKY
FT                   DSFAVHVRSNAEKTQEYTVQPFLVQVGEANTTSGASIVHNTSVAYFDFCGSVQVSLTSN
FT                   NGPIHSVVVRPHSYNIVPNVHGDVVTFSLDSPKNVVIQVNDDIWDVLTLLTNPIETEMP
FT                   NPSDPGVIYFHPGINNSTAITTNKSLLIPPGTTVYVASGATITLPIAFHNISDASIRGR
FT                   GLLLKAPITIEYASRIAVRDLVLINTNIGVAVSSDVTVSGIRSFSIGAWADGFDSYCSR
FT                   NVLVDSVFMRNSDDNIALYQHRNNWSGDSSNLTIQNAVLWADYAHPINIGTHGNTPNPE
FT                   TMDGVIIRNIDVLDHREPQMWYQGCLAINAGDDNLIQNVLVDGMRVENFREGQLINLRV
FT                   MYNSKYNTSPGRGIRNVYIKGLHYDGANANPSLMLGYDSQRNITNVTFEDLVVNGKKIY
FT                   DGMKKPTWYYTADFVPMFANEHVYNLTFSA"
FT   CDS_pept        join(complement(447616..447833),complement(447373..447573),
FT                   complement(447173..447324),complement(446907..447121))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268271"
FT                   /orf_name="AFUA_1G01330"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87845.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000052042B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT7"
FT                   /transl_table=1
FT                   /translation="MSFPYKHVLLIGATSGIGCAMADRLVEAGIKVTAVGRRKDRLDEF
FT                   VRKHGEQLASAVQFDITVHEDIPKFAAKIIDSYPDVDCLFLNAGIQLPFKLDDRGQFDL
FT                   EPFSKQMNVNYFSLVALTHAFLPFLVGKQSPTSIIFTGSNVAIVPAASLPAYSASKAAL
FT                   NVFTLSLRDQLRNSNVAVIEISPPPVQTEIHDYMGKEVGSKLGMPLDTFADLAFQRLVA
FT                   GQDQIVIGSIGPAERFNAIIDQRRAAFEDLAEVMRAQQK"
FT   CDS_pept        join(448198..448257,448309..449748)
FT                   /codon_start=1
FT                   /gene_family="HOG000217112" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057395"
FT                   /orf_name="AFUA_1G01340"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87846.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051009"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051FD86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT6"
FT                   /transl_table=1
FT                   /translation="MVFRGRPSKACERCRSRRLKCDYRPDSCTPCLRAAAACYGYRDPQ
FT                   AIRIEDQTEDARRKALLKSKPARLAEASLSVSIDARARMVFFAHYVSVGSRGWDFLIRW
FT                   ERETEVAPRWLNVSIDAVSLALLAHHHASAPLLSLARQRYALALRVMKQALNFAPTEID
FT                   SLIAASLLLDLFEKITHTEASVIQFWPSHVNGTLALIRKIGVGHFQDHYALRIMARFLT
FT                   NYIISCVASAHALSKDVLILRDHLERHLDLKDDPKWKISGLTIEYASFLHAVHTGRWSL
FT                   QDRMARAQDLDRALLAVSQDMPPDWQPERRILQYTLPHVYGQEMDLYRDRHVTQTWNVV
FT                   RQVRIQLNEYLLDCYETLNAVHGVNQLAASEAALSDIAALSLEVYASVPQYASYACRSK
FT                   RSQGQADNTDLSVVSQKGCNKVHTPSELLDCYTLLFPMYVAARSKAATADQRRWVSYMF
FT                   RYISDHFGIRNALLLAQLLDQNSDISPWCIYAMLGGYGFAA"
FT   CDS_pept        450255..450875
FT                   /codon_start=1
FT                   /gene_family="HOG000217111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268272"
FT                   /orf_name="AFUA_1G01350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87847.2"
FT                   /db_xref="HOGENOM:HBG051015"
FT                   /db_xref="UniParc:UPI0000F51AC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT5"
FT                   /transl_table=1
FT                   /translation="MAASVQDTGQPTAPTPQKKKPAKLRQRKNAQDEAHDDKPNGTPPE
FT                   TNNKPVETERHQGSEPVSSPEPEPELEPEQPKRRDRRTRRPQRDPDEQSETVSENAEQF
FT                   DPFTHRERRRRPRRRDEHRIVPFGAESVGREVGRRQDASGPLDNISNVQGAIMGQDQPN
FT                   PAQPEKEQKKSKDNTLSLRLDLNLEIEVQLKARIHGDLTLSLL"
FT   CDS_pept        complement(451136..451861)
FT                   /codon_start=1
FT                   /gene_family="HOG000213326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208709"
FT                   /orf_name="AFUA_1G01360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87848.1"
FT                   /db_xref="HOGENOM:HBG051020"
FT                   /db_xref="HOGENOM:HBG329218"
FT                   /db_xref="UniParc:UPI000051FD87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT4"
FT                   /transl_table=1
FT                   /translation="MSLNTVTSGLNQDLPTDSVTKTASGTVNSTADHITDQTIPGEYPS
FT                   DDTDTKYDKPAPDISFSSIWSASKTWLFSLFPNVLDRFENWIKALVAWVLPPPRQAKMY
FT                   EAILNRPIASSFIICQLVCCGVPLLVFLAGVFLFAAVAVLLWAVLSLLLAAPILLVASM
FT                   MGVSLWGWGWVLYGLVKFIDQHFLGGMITRFWLANRQDQDGGDGPEGEGQKGEEDEMTG
FT                   KDDKSEKKRPKKLQVKKDT"
FT   CDS_pept        join(complement(452634..452773),complement(452052..452580))
FT                   /codon_start=1
FT                   /gene_family="HOG000125753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268273"
FT                   /orf_name="AFUA_1G01370"
FT                   /product="Glutathione S-transferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL87849.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG416344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051F652"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT3"
FT                   /transl_table=1
FT                   /translation="MLIVHHLQRSQSERIVWLCEELGIPYELRTYQRDAKTLLAPPELQ
FT                   QLHPTQAAPVIQDGTTTLAESGAIVEYILTKYGKGKLTVPPTADNYADYLYFLHFANGY
FT                   FQPALVGYSTVLRSGISRDDPSARFARRNFEQALRVLDDRLAKHTWLAGEEFTAADVMN
FT                   VFTLTTARLFFPYRLAGYEGILGYLQRVSQREAYQTAMAKGDPGLIPLIHGDNPRPIRL
FT                   "
FT   CDS_pept        complement(453032..453946)
FT                   /codon_start=1
FT                   /gene_family="HOG000213315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057396"
FT                   /orf_name="AFUA_1G01380"
FT                   /product="Alpha-1,6-mannosyltransferase subunit (Hoc1),
FT                   putative"
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL87850.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG051036"
FT                   /db_xref="HOGENOM:HBG327780"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000051F3EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT2"
FT                   /transl_table=1
FT                   /translation="MRPFVAIQAIVVFSILGLLYRYYGHHSHLSAVTEAHPVTGLAIPQ
FT                   TVHQLLLSMPDHPISQFEPSDHVISWQQSGWKVEYWSEEACLELAHEVDASGTFAAAFE
FT                   KLPYAVLKSDFCRYLVLFGRGGVYSDLDVHLVQPLPWTVMGSEDRHHRPPNVIIGLEGD
FT                   ATTKGLPRSPQFVQWTMASTALHPMFRDLLTRIAERTPNFVKQAQALEGDAEVNVMDWT
FT                   GPSVWTDTILDYLGCSEEQIQNLRDLKDPVRIRDVMILPKRSFAVTQGEDHTLPDVLVK
FT                   HYFSGTWKGCKNHWHGWSLPWLC"
FT   CDS_pept        complement(454910..456094)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268274"
FT                   /orf_name="AFUA_1G01390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87851.1"
FT                   /db_xref="HOGENOM:HBG051042"
FT                   /db_xref="UniParc:UPI00005201D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT1"
FT                   /transl_table=1
FT                   /translation="MLGTPNETKFSDRDDLQTIPVIQSPDAYLLQEQMLSSVHNYALGV
FT                   FQSRKWKFDPLRTYAPQGSQDFGAIWKDLSDQCFGAGILSRNHGQRREAIMKLQCILEG
FT                   IEAVGNASDPHLLVRFWRLCRYLHGINLSTENEPSQPRGQILRLFITRFRDLARLNSGE
FT                   QSPLYLLLDAFSKMDFEDAIWGLRIGHLRAIQTLQSIIGERHPMVLSMRVYYMKQWRIK
FT                   DGRHHDMLVDHHLQTLRAAETTLGTSSDEAISILHDLTYYAYYSLQDDADMKTDKVLAF
FT                   AIELRRRAGARLHGPCRWNMLTQYYTFATQILATMASAQNDLVQAESYIREAVARFHNG
FT                   DVECQTRASMLLGKYERWIRDKNGPVWEVMRARETIQQLQSSLTNALSGKTRGH"
FT   CDS_pept        456376..456576
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057397"
FT                   /orf_name="AFUA_1G01400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87852.1"
FT                   /db_xref="HOGENOM:HBG051049"
FT                   /db_xref="UniParc:UPI0000520687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKT0"
FT                   /transl_table=1
FT                   /translation="MVGLITFQSFSDGLVSGKQPDPSGIGDLRGKVEYIWNWRDRAGEP
FT                   ADGNMVHQPRGRLVSGSSRCL"
FT   CDS_pept        join(457495..457763,457839..457965,458023..458385,
FT                   458490..458795,458848..459069,459117..459374)
FT                   /codon_start=1
FT                   /gene_family="HOG000048564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268275"
FT                   /orf_name="AFUA_1G01410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87853.1"
FT                   /db_xref="HOGENOM:HBG051056"
FT                   /db_xref="UniParc:UPI000051EEC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS9"
FT                   /transl_table=1
FT                   /translation="MSSSDTMDDNSPGQDNAHSIFTRHAADLQKSAQAVTKRISEDPRV
FT                   NLDWSLSAQVFPESVIIMAACSVAGSDPQLGVVPLSIPIPGSTETPSAMSALLDSCSQQ
FT                   GRKAFSKASSEMTRLNLRASSALGPNGMITRIMHLVKSSKATTHALRDEILALRAMSVE
FT                   SLQSIRDISTSFANWSEFINQISFHFDQYLLVTRSGQESPVDLEWARAEVERTRNDLLQ
FT                   KEHAQNEAGKVHARALAADADKRSPSRRSSVNCLAYLWNGDRKEEDDIDARVNKHVKEV
FT                   LQILEQSTQQQKQQKEDAQLRIEMSSKHLGEADKRVEAARHEHEKACQRLSSLQPSRWQ
FT                   RKTCICWQRRTSTWYQEIDRILRTSAVELQKLSVQVASFEMWFEQLSILIDNIVNAHFG
FT                   SVSRTLRIHSPVALDVDADEGRRLSREDKEQSRNQHLLHHLFQIQGYLSAIEEISRLYS
FT                   TISEKYIQPGIDHLDCLDRSDLAIYQLNRKRLSEWHQVASHEIHQLMIEVKKLSFP"
FT   CDS_pept        complement(460988..462481)
FT                   /codon_start=1
FT                   /gene_family="HOG000217108" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268276"
FT                   /orf_name="AFUA_1G01420"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87854.1"
FT                   /db_xref="HOGENOM:HBG051065"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051FF9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS8"
FT                   /transl_table=1
FT                   /translation="MDMQEGSVASANNPENAADNFSPLSMLPPECLVNILDHLDTADNL
FT                   AVSNVSKDLRKWAKPLVFRDILWAYTSTPLRRVLLLLEQIFLNPQCAGYVKHLQLTYTG
FT                   PAWILPDLDIDFRQHATRFAFVSRKAIQFVSQIGLFDTVGYAALLYQGDYYAYAAVLMF
FT                   QLHNLRVLELDYTYTLVGGYPGLFLQIALRSSFEGISRFNRLEKLKYGGDVPQAEKLDD
FT                   EAEEAVAAIPVLENTDQFAPWFALPKLKHVEMWLRSTFELDKYKDQLAGRELESLVLAR
FT                   SSVDAADIKEILSACPKLRKLHLGVSYNLVSKLALLDSKELADALKPLKDRLETLSIGL
FT                   DTDPSFVGGFSWEQDNTFGSTLTDPFLMLFSEFTKLQELEVPMPLLLGWFSNENWADFH
FT                   KYLPPKLRHLVMRNDLSGFDNYTWDPYGMVFAVDQRIVETKKRIPSLERVTLRVWATNP
FT                   RRPNEDFLAEAADMAQSVGVQCDLVVDELGSGLWVARAS"
FT   CDS_pept        join(complement(464625..464939),complement(464315..464579),
FT                   complement(464127..464263),complement(463159..464076))
FT                   /codon_start=1
FT                   /gene_family="HOG000217107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268277"
FT                   /orf_name="AFUA_1G01430"
FT                   /product="AMP-binding enzyme, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL87855.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG051072"
FT                   /db_xref="HOGENOM:HBG323810"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51AA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS7"
FT                   /transl_table=1
FT                   /translation="MTRIATFPLPGIKHGKRILVSTIEERAKNDPDSSWVSMPVDNNDL
FT                   SKGYKEITFAEFNNAVNHAVHWLRQNLPESDEPFQSFAYAGPKDLRYPILAAAAGKLQK
FT                   VMVLPSPLITPAAQRLILKKTQCKVYIRPASLAQAVGIILEDAPHIQQIAAPELDSLLQ
FT                   ETPAEPFVYPRSWGEGKKDPWLVAHTSGTTGFPKPITYTHEMMAALDVAASLPDIDEFL
FT                   LHHAPGRRWYTPLPSLHLVGMMMVLSMPTYAHGTLVVGPPAPPSADTVVDIFKYGRVDS
FT                   ALLTPALIDEMCLNDRALSALRSLKLVSYGGAPLSRMSGDLLAPHVQLVPAIGSTEAGG
FT                   YFTKFRRDDKDWDYLEFQKQSGAVFEPRSGALHELVFVRVPECRMQQIFLLYPDQDRFE
FT                   TKDLWVEHPTRKGLWKIVGRVDDYIPLSHADGLYAASLEREIEQHPKVKAALIGGHGRP
FT                   LPVLLVELHDETEVASAAGRQAMFESLQPYLDKVNENCHECVKLSFERLIVASRDRPFI
FT                   RTIKGSVARIPSLELYKEEIAALFENN"
FT   CDS_pept        join(465834..465981,466023..466069)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268278"
FT                   /orf_name="AFUA_1G01440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87856.1"
FT                   /db_xref="HOGENOM:HBG051080"
FT                   /db_xref="UniParc:UPI00005201D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS6"
FT                   /transl_table=1
FT                   /translation="MVRIEAYVPSNSPRLIGKTTSQWIVKGEGYSISEFKAGWKGPWGS
FT                   RSEKTSDVSESSHWRTSTT"
FT   CDS_pept        join(467133..467327,467371..467509,467571..467679,
FT                   467725..468547)
FT                   /codon_start=1
FT                   /gene_family="HOG000191990" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904127"
FT                   /orf_name="AFUA_1G01450"
FT                   /product="Toxin biosynthesis protein, putative "
FT                   /protein_id="EAL87857.1"
FT                   /db_xref="HOGENOM:HBG051085"
FT                   /db_xref="HOGENOM:HBG329429"
FT                   /db_xref="UniParc:UPI000051E7EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS5"
FT                   /transl_table=1
FT                   /translation="MTSPFRVVEHIIPGQHIREHPHALRGRQETALKLAIKQYIPCDQT
FT                   EPILENAVTIIGAHGNGFPKTDRRYMREDLYAQLKKRSIPVRGIWIADASNQGASGVLN
FT                   EHVQGDNTPWHDHSRDLLHMINHFRDDIARPIIGVAHSMGCTQLIQLSMIHPRLFSTLI
FT                   LYEPIIFGDQFQGPNPAITAVLRRDIWPSREKAEMQLRRGFAKWDPRVVDCYLRFGLRP
FT                   VPTRLYNPENDPDIPPTAVTLTTSKHQEAWTYTIRNLEPESAGLNDLLLPDWDPVLERS
FT                   APFSRPEAWAAFRNLPFVRPSVFWVYGGRSWLAPPAAQESMVRATGTGIGGSGGVAKGM
FT                   VDRTVSPKATHLVVFEEVGWCSEVAAAWLEKWFARYLREEEFWRTYQSKKSDPEMLGIQ
FT                   RASIRVAKVVVGPQGDVAKAML"
FT   CDS_pept        complement(468979..469782)
FT                   /codon_start=1
FT                   /gene_family="HOG000079046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208710"
FT                   /orf_name="AFUA_1G01460"
FT                   /product="Zn-dependent hydrolases of the beta-lactamase
FT                   fold, putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87858.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051093"
FT                   /db_xref="HOGENOM:HBG333307"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI000051FFA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS4"
FT                   /transl_table=1
FT                   /translation="MAPKLNITHIGTATAVLEIDGVNMLTDPFFSPAGSSWPVTETITL
FT                   QVSDDPALRLDQLPVIDAVLLSHEDHVDNLDELGRRLLDGRRVFTTVDGAKNLSPRPGV
FT                   HGLKPWEKIDTVIAGKKFQIIATPTQHIAGDECTGFIITNEEFGRGRDGLPNAIWFTGD
FT                   TVYIDELKKVGEQYHVLAAIMNLGNAYGPVDKTDPSKGACQITMDGKSGVRLLRDVKAD
FT                   VLVPMHYESWGHFTQFGKELRRDFEEEGILDKVCWLTPGKPVSVL"
FT   CDS_pept        join(complement(473023..473203),complement(472919..472974),
FT                   complement(472747..472871),complement(472574..472684),
FT                   complement(472377..472523),complement(472288..472327),
FT                   complement(472143..472242),complement(471914..472097),
FT                   complement(471717..471808),complement(471622..471667),
FT                   complement(471453..471574),complement(471047..471402))
FT                   /codon_start=1
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904128"
FT                   /orf_name="AFUA_1G01480"
FT                   /product="POT peptide transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87859.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059453"
FT                   /db_xref="HOGENOM:HBG323814"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI000051E576"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS3"
FT                   /transl_table=1
FT                   /translation="MALSCTVKPADSFECDHVEIAEPEKRNLRRVCDDISLDVFLVAGV
FT                   ELAERFTYRSITAPMQNYIQHGRDDVLHHGALGLGQKVATGISYFFVGWCYLAPILGAV
FT                   VADSYLGRFQTIFLGAGLSVCGVLVLFITSLPPSLEHGGGLPGLMLALILIGLGCGGIK
FT                   SNVGPLIAEQYSMRTERVKTLQSGEVVIVDPNLTVQTVYARYYWIINIGALSIIPASWL
FT                   ELKVDFWAAFLMPLCLWLLAIMAFVAGRKRYVVQQPHGSAVTKALRVLWISLKNNGNMD
FT                   AARPMTMEATGSPVCWDDTFVDELKRALVACRVFPIFWLCNGQANNNLVSQASSLKTYG
FT                   MPHDMMGLFNPLTILIAVPLFERLINPALRRFDIPFKPISRMTTGFVAIAFAIAIAAII
FT                   QQLIYRQPPSHVSIFLQIPVYALIGLSEFFSSLSAMEYAYTKAPRSMRSIVSALFLLTC
FT                   TIGSTVGITLSPVSVDPKLLVEYVSLSIVMFATGVVFYFCFRKYNQMEESMNMIGETAG
FT                   KQ"
FT   CDS_pept        join(475987..476223,476269..481272,481331..481954)
FT                   /codon_start=1
FT                   /gene_family="HOG000213293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057398"
FT                   /orf_name="AFUA_1G01490"
FT                   /product="NACHT domain protein"
FT                   /function="binding"
FT                   /protein_id="EAL87861.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051114"
FT                   /db_xref="HOGENOM:HBG328261"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051F16C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS1"
FT                   /transl_table=1
FT                   /translation="MSASAIQAKAPTIDTFFDAIAAERLRRMPPDGSRLDAALRRASSL
FT                   AFAVASLRDAVVSFMDGADEATKLVWGGLLLTLEMGIEQVDILDAIFSRYGRVTLQISL
FT                   LLQQESVFTESTSLQNEVAKTYASLLQLVLHVAMEYSDASRSLDWLIMGEHVDAAFFQF
FT                   HNSCNTNWRKLSELALSKRTTMDVASIYQFLDLQDRPLQMILEGHNHSLADGSFAWFDP
FT                   HLTTFALSNREMMVITGSPGAGKSALAQWTVERLQVSSECDIWNVIPCWVREDVPITTL
FT                   TLTILKGILLQMLDRCVSSWKTQEGILAPVQQAADMASTGATDSQVEDVLWSAVRTATQ
FT                   SHMHFIIVLDGLDQIKNAKATMAGFLARLQGSISGTSSKLIIFSRELPAQQQLGESTQQ
FT                   LSLNPSLTQSDMLAAVTDAIRSDGQFYGLAGDQIDMMAQRIVARAKGCFVWAQLTLESM
FT                   KHESTFKGMMTAIQQAPGNVSELIGNHLSTTDIARPDIRCLLAWLVASERPLRAKEVEE
FT                   LLSVDAESLKLTPRPAGAERNIFKPLGRLVMVRDGFVAFRHSMIRENLRQRAMSADSNY
FT                   SDNQGFPFNLEEAHYDLLTRSLAWTRICVKEEVAISMDKLPVQQRDGLFDAYILLEYTS
FT                   RYWFAHLLSSPMTTADREFAFTPVFKSALPSSVLFAQLELTGRESQFTRSSILELYRLS
FT                   VAVRRVALGEKSPAFLQSLILSARAANLAKASWAHDHLYEAWMLSRSQLGTSSPISMEL
FT                   EQLMLTAPQQAGRSDKLTRLRTEALREMTLSHWESTEVTFTRRLECLTSLVTTYQSSNQ
FT                   HDEAYSVSRQFYRQTLDTYGSHSPESMQAAEFMTRHFQIASSDDLALEIARLKYDNMVH
FT                   SMDVTDQRRISYSLYLAQLYEKKHKTKEADAILTRLWAGICSHDIDSEWTWEKKTKVAF
FT                   AYYQFLRRHGRHEEAKMVLGELSSDLESGGIHSQAMADRATSLRAEARAQGLIGMERSL
FT                   SMLIWNYYLASGDQHSPEAVTLAEDLADELMSTHTTVDSLAGLSPEERIYIHSLMDSIA
FT                   SSGSGRHSTSVLRLCHDLCTLHGREGQWKQGSDCAWSVLKHVWPDVHNPTSEAKFRSDR
FT                   APLIANIVLDYAYCLFRRLDVANATTVYGNAFKASITAEKVTVPHLTAVVKTVVEFYET
FT                   TFQFSKALVLLHQVSQFFISRLGDSDKHTIDSLYSEGDLAARLDRKDEAEAAYRHIYRV
FT                   SIQDGKVGSTGVRAAIDLLVIYEQRQDRESALQVYRHLWPTLIRFDEKDGYDRALLEGL
FT                   LDRTYLGYMKVLTAGTAEEGHAERYTVASQYLNLCKTIHGQSSPATRDATLRLAEICEQ
FT                   SDSHLEEALALYRHVLQTKEWVPPTQASRALPDMTDPTAKMVKHKLAQIYLRKKSTSDE
FT                   AHGLYMEELTLSKQQRGLSSSPTMLWLREVALVYALKDTIEARNQGATLLRDHVNEVIH
FT                   VTASREAVVERAHRLAEIYLECGYKDAGYDLIDELHKKVIHDTPAAQRLALNEYRPAVF
FT                   VAAFEEKFGKKMTYSQILDALSQESGVYHEYQTSLSRHDLVTTLVAGQKLHVLQTEQRR
FT                   TTAATKTQGSLYEYFCNSLSVSSSLRSRDVVHQFYNLCRREVLNADYNINIITETTHMV
FT                   RDLCDSSRFQDAAELTGVFHSFVHLTDGLNSHEAIFTAIKLCLYLNGYQTSKCSDSGTA
FT                   KHMAFESQMLLQEIMDRARHLKIEFSELPFAELNDLATVLGEHEMFDDLEAILTDLWTS
FT                   RLVQKTWSFNMIVWIGRRLVETRFCRGHTDAATQLGRDICYNLRQVWGNCDPVTLEMTK
FT                   LLSGLYTASGNHLAAVALHETALHELLNDTDIDQAHAADAASQHLRLLMHAQSRLRKES
FT                   SQAVDTSAYDELVQQVGTKFGVRPEGLQGAGDDVGMWHRPRRFSLDMGEEQMHSNHLRS
FT                   SSGSALLNGNAGAKRISITAL"
FT   CDS_pept        482368..482934
FT                   /codon_start=1
FT                   /gene_family="HOG000213029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268279"
FT                   /orf_name="AFUA_1G01500"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87862.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051122"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005208FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKS0"
FT                   /transl_table=1
FT                   /translation="MTEISYRRPHSFQRTSAIVTGTSVEMGFLYSQLFVTPAYPTHSFK
FT                   DQTIIVTGSNVGLGLEAARHFVRLNAATVILAVRNRPAGEAAKASIQASHPDSATSVEV
FT                   WDLDLASYASVLAFAEKVSSLPRLDVLLCNASISTSSFQLAEAHERTLTVNVISTVLLG
FT                   LLVLPALRRSAARRGNRCRRRFGGS"
FT   CDS_pept        join(complement(483811..483968),complement(483602..483757),
FT                   complement(483427..483554),complement(483276..483376))
FT                   /codon_start=1
FT                   /gene_family="HOG000169930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752013"
FT                   /orf_name="AFUA_1G01520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87863.2"
FT                   /db_xref="HOGENOM:HBG051127"
FT                   /db_xref="UniParc:UPI0000F51AB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR9"
FT                   /transl_table=1
FT                   /translation="MKFTTIVSLFGLAQLALCADRGSYTVSGLGQRKQEILRAGGNTMD
FT                   MAIAMLESDHMKTDYVYGDGKSGDATNFGIFKQNWMMLRTSASDFKGQSESQVSNGAVL
FT                   NHDLKKDIKARHDSEKYYGFDKWVAGHRNGATGLQHPYTDDINTYKSAIQWIRQQIESD
FT                   PKYKKDDTRFWVDVVAI"
FT   CDS_pept        486112..486696
FT                   /codon_start=1
FT                   /gene_family="HOG000252320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268280"
FT                   /orf_name="AFUA_1G01530"
FT                   /product="GrpB domain protein"
FT                   /protein_id="EAL87865.1"
FT                   /db_xref="HOGENOM:HBG345757"
FT                   /db_xref="HOGENOM:HBG416393"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniParc:UPI000051F634"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR7"
FT                   /transl_table=1
FT                   /translation="MTMSTDKSARHYIETISTRPQKPIEIVDYDPSWPTTFASIAQRIR
FT                   SALGATALSVSHVGSTSVPGLPAKAIIDVDLVVPDPTAEDEYAPALEAAGFQFLFREPN
FT                   WYEHRFFGLAEPYANVHVFGPGAAELSRHQRFREWLVSHPADRELYVQAKREAARQSQE
FT                   KGESVQGYNLRKERVIEEIMVRAGIPLPGTD"
FT   CDS_pept        join(complement(488181..488384),complement(487880..488136),
FT                   complement(487548..487829),complement(487318..487491),
FT                   complement(486857..487259))
FT                   /codon_start=1
FT                   /gene_family="HOG000213282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752014"
FT                   /orf_name="AFUA_1G01540"
FT                   /product="Endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /protein_id="EAL87866.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG051149"
FT                   /db_xref="HOGENOM:HBG669880"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI000051F3EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR6"
FT                   /transl_table=1
FT                   /translation="MRSFPLVLAAGIPALAATAGEFNILALNVAGLPPILNGNDVPGDK
FT                   SDNSRQIGRKFAEYGYDVIHVQEDFNYHAYIYETDNHPYRTPTSGGAGIGSGLNTLSNF
FT                   EFTNFVRTKWATCSNAEGADCLTPKGFTSMRVRVEEGVYVDFYNLHADAGSKDDDVKAR
FT                   SANLQQLADYIKVNSAGNAVLVFGDTNARYTRTGDNIRVFQTQNGMVNPWVELILQGAA
FT                   PAEGSNALLCQNPSTTSDCETVDKIFYRGSRAVDLRAVFWNYESNKFLSDKGTILSDHN
FT                   PITTNFTWTLSNAFRQSDIFGGPHGTWFNDLDSLPTAFTGQNKPSKISLRGAERLDSVG
FT                   LTVASGKSYTHGGTGGQLSELPLAANEYWTKAKLCQGQYRGHTRNFYLLATTSSGRTVS
FT                   AGTATSDCKEFAAAPGWQIVGFYGQDGDEIDQLGFLYGLI"
FT   CDS_pept        complement(489565..490644)
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268281"
FT                   /orf_name="AFUA_1G01550"
FT                   /product="High affinity zinc ion transporter, putative "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87867.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI000051FFB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR5"
FT                   /transl_table=1
FT                   /translation="MSAFDPSNVDLNTASKEDVICFLSLSENEYNGHLGARISSIFVIF
FT                   ITSTVFTLFPVVAQRLPQWRIPHHVYLFGRYFGTGVIVATAFIHLLDPAYQSIGPGTCI
FT                   GMSGAWGEYSWCAAIVLSSVILVFLLDVGAEVYVEWKYSVPREANATATFITQPACSSP
FT                   HESSDRLTATEPSSPTGGKDLYPRADELSVASERAFRQDIAAFLVLEFGIIFHSVIIGL
FT                   NLGVAGDEFAALYPVLVFHQSFEGLGIGARMSALHFGRRRWLPWILCLAYGLTTPVAIA
FT                   IGLGVRTSYSPGSRTALIVQGVLDALSAGILIYSGLVELLARDFLFDPCRTKRRGQILY
FT                   MLGCTLLGAGMMALIGKWA"
FT   CDS_pept        join(492489..492626,492679..493602,493666..494421)
FT                   /codon_start=1
FT                   /gene_family="HOG000213260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904129"
FT                   /orf_name="AFUA_1G01560"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87868.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051163"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F653"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR4"
FT                   /transl_table=1
FT                   /translation="MSDSQRGQGQPKGLPAWTATRTAKEGARKKTRTTYSCLNCHRRKV
FT                   KCDRVKPCSACCLRGTPSECEYGTSKRDHHYIQQSALIDSLMKTCEDLKKQLAEARALA
FT                   NLPPVKPEEPFSVSSPEDHREKTVDEERSQNPESRASSSLIKQSADPAGRSFAQTTNTP
FT                   CTTDRSSRSLSDDKRILTDPAVASSFVEVFVERLIDNFSPQPASVYGGTVALREASRMR
FT                   ILSPMLCTAFEAASLTFAGRREQIREVEAVGHARYVRVLRQLQTALNDPKQNKSTEVMV
FT                   VVLLFTIIEVRGVSPCRIRFPLTSRAGLQAQHQRFPAEAPTRRTAIAPGADPVPTSVRD
FT                   RSVAVRRSPLILGRVTAALVQSKPTFLASKEWLTVPWPGDAPSKDILHRLLDIAVDIPA
FT                   YLGQIDRFTAALHSGTVPSTELVAQQTALWDRATELQSRLNRWKTMFADTYPPGQAWEE
FT                   PTADTATRPESDPQTTFPTFLYRDPATMRLRPAPLLVYPDLLSATCMTFYWALHLILST
FT                   ADSGLGSVLGLQERYQYACNICRSMKYYVENTPGGLVSRIMFVLRTAFDAFADGMVEKA
FT                   FVTEVFRHIADKFHFSVFANQCASFSVSG"
FT   CDS_pept        join(complement(495675..496042),complement(494889..495618))
FT                   /codon_start=1
FT                   /gene_family="HOG000213249" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057399"
FT                   /orf_name="AFUA_1G01570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87869.1"
FT                   /db_xref="HOGENOM:HBG051171"
FT                   /db_xref="UniParc:UPI000051EA27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR3"
FT                   /transl_table=1
FT                   /translation="MADSLAYDYTSWQFLEGIGQASPLQQELQTEDDLRLAFELSSHGR
FT                   SENDIALLSSDNCLPDGQISAKAATAATGIVQAQMHSPPIEVGMGMGMGMGMDLDMAMA
FT                   MEMDMTMEMFAQGMDFISEPPFPDLSLGHGQKAPDELSFLRSTSDDVTQRALFMTPSGI
FT                   TSPSSSSSSPSFASTSPSSHRNSSSPSLDPCTPSATSSTSKEDEDHDWDCDRDRDPSLG
FT                   TALGMDMGMHFYKLPDRLDSSSSSSSPRPPRLHRPHHHPTQPSLHRINHRASAAADDED
FT                   ALTPLEMPDGSTRFTANWLPVDPTGGFTIDSPESASASAMDVGDPYGHGYSPQDRAYGY
FT                   GYAEGDLAMEFSKEAFIQMPAPAPV"
FT   CDS_pept        497181..497336
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268282"
FT                   /orf_name="AFUA_1G01580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87870.1"
FT                   /db_xref="HOGENOM:HBG051180"
FT                   /db_xref="UniParc:UPI000051FB32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR2"
FT                   /transl_table=1
FT                   /translation="MAADPKCWGEGSHCRSILVHLAMANCEGEFPRQSSVRAPPRTVES
FT                   RERKSG"
FT   CDS_pept        join(complement(498658..499907),complement(497339..498605))
FT                   /codon_start=1
FT                   /gene_family="HOG000167193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268283"
FT                   /orf_name="AFUA_1G01590"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87871.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051186"
FT                   /db_xref="HOGENOM:HBG331996"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EC7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR1"
FT                   /transl_table=1
FT                   /translation="MDPAQPGDAPPTSTNTAGTLEDSSSTAKRRWRRNRIACDSCHSRR
FT                   VRCDRAFPCSRCLRSEIRCEFTRERRKRGRIARSKQTATVPNGGSMEKLPKAPNVQPPV
FT                   PAAVPADAAPTPLPNHASPTTSFQHRSPATNEMTVSAHSIDDRRSQADPSLPARRPGPT
FT                   GNVTEEWLSAAHVSPDSYEVLGGGAWGDGPLPRVLDIWNGADLAGYSAPTVQSSKPAGA
FT                   ARAPSISSTTLKYPVLQPLMPFLEANLPRRLVFDLLELYFTSAFSTHMHPVCHHIHCYV
FT                   LRKASFLSRENPRPSSPALLASMLWVAALDDRAFALSISPPQRKKICQFLCALTIRLLR
FT                   PLIHVSFKEQAGSNASDPTFTGVAPECPPTTVHHPFESSGDDRGLVGPAGSLDDVITYI
FT                   HVASIISSSEQKAASMRWWHAAFTLARELKLNQEIEVIPNADGQTEGSSPAFDYSLPGW
FT                   SGVDTGAFFDYSNPTRPSLNCVCDHSHDPHATITEEHREERRRTWWLLYIMDRHLALCY
FT                   NRPLALLDAESEDLLLPLDEGSWQAGNVHSNSPKPDGPHCPISGEKNKRRVFPDFICHD
FT                   HSIFGFFLPLMTITGELIDLNQARNHPMLGSRLHGKDGWDAHLSEVLRQLEIYKASLTT
FT                   FAATAAVPEAPLATTYRPPGPDPPVEPSLSQAFSWHTQTVIAYASYLVHVLHILLVGKW
FT                   DPVSLIEDKDFWTSSPAFATTISHALDAADSVHQILRYDPDISFMPYFFGIQLLQGSFL
FT                   LLLIVERLQKEAGEGILNACEVMIRATESCVVTLNTEYQRNFRQVMRSAVAQARGRPVN
FT                   HSEIRHRRKAVLALYRWTRKGTGLAL"
FT   CDS_pept        join(complement(501398..502611),complement(500803..501349))
FT                   /codon_start=1
FT                   /gene_family="HOG000245621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268284"
FT                   /orf_name="AFUA_1G01600"
FT                   /product="Deoxyribodipyrimidine photo-lyase Phr1, putative "
FT                   /EC_number="4.1.99.3"
FT                   /function="deoxyribodipyrimidine photo-lyase activity "
FT                   /biological_process="DNA repair"
FT                   /protein_id="EAL87872.1"
FT                   /db_xref="GO:0003904"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG328640"
FT                   /db_xref="HOGENOM:HBG693486"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="UniParc:UPI000051F3FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKR0"
FT                   /transl_table=1
FT                   /translation="MAPRKRKTAAIPSSDDGTTQQPSKREKLDLSRPHPNAQQAENFGI
FT                   VLREFYPPEMSNERCQAYNDGRLERPIETLQRAYEETADQRRAIGANSAVVFWFKSDLR
FT                   LYDNRALRMAYETAKGCNIPLIGLYILSPQDLTAHLLSPARVDLILRTLHQLKRDLSEL
FT                   DIPLYMETQEIRKNIPQRIVDLCQQWGANHLYANLEYEVDELRREAKLVRLCAKNGIKF
FT                   ETAHDACVVPPGQVTSQQGKQYAVYSPWYRTWVAYLNENPGCLEVSEEPGSNPGDARKY
FT                   FKELFESEVPAAPEHKQLSEEEKQHLGHLYPAGEHEALRRLEAFLEEKGRDYAEERNMV
FT                   SGQTTSILSPYFASGLLSARTAIEHARRANKGSLQHGDPGLVRWIGEVAWREFYRHVLV
FT                   HWPFICMNKCFKPEFTNLEWEYEEDRFTAWREGKTGFPIVDAAMRQAKQDKWMHNRTRM
FT                   IVASFLSKDLLLDWRRGERYFMETLIDGDFASNHGGWGFGSSTGVDPQPYFRIFNPLLQ
FT                   SERFDPDGEYIRKWVPELRDIQGAAIHEPYARGGGAIAAKNGYPRPMLNHSQSRDLALH
FT                   RYKRASESGR"
FT   CDS_pept        503947..504960
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904130"
FT                   /orf_name="AFUA_1G01610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87873.1"
FT                   /db_xref="HOGENOM:HBG051198"
FT                   /db_xref="HOGENOM:HBG329730"
FT                   /db_xref="UniParc:UPI000051F3D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ9"
FT                   /transl_table=1
FT                   /translation="MASPPPVSTATATATGSSHHFPNDSVLKYSHIGQTEKYVFSAFAG
FT                   VVWYNAIELIVLCLTTFKRYRGCYFWSLLLASISLTTYILGFFFFFFLSMSVTPYVAVA
FT                   FIVPSWCVMITGHSLVLWSRLHLVMQRPKVLRAILVMIIVNAITMQIPITVLLFGAVSA
FT                   HPKVFTRGYNVMERIQLIVFAVQECIISSTYVYETIKMLRLRPPEARHRRMLLQLLVIN
FT                   IVILVLDVAVIGTQYAGYYPVQVMFKPVAYSIKFKLEYAILGRLIQIAKGEGLDREQVS
FT                   SSVQGFQSCLSDQTATVGNGSLSSPRPPPDSPGTGMSYIRDEDTYASLRFHERRTL"
FT   CDS_pept        join(506341..506498,507075..507489,507531..509276)
FT                   /codon_start=1
FT                   /gene_family="HOG000048316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904131"
FT                   /orf_name="AFUA_1G01620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87874.1"
FT                   /db_xref="HOGENOM:HBG051207"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000051E58C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ8"
FT                   /transl_table=1
FT                   /translation="MKTERLVGAIRGLPAPISMANRNDESMLVMNTIRTDRQWLERTGH
FT                   DGYNRFGCPLLAAVQAYIEPGGIQAGLRAASGRDRVWITAFIAVLCIITLTNWDFQVSA
FT                   LSGIPVVGLLVIYLALTRPTKCGESPSPRRPIATGLVIRPLAFRVVVTLLAVLGVEIAL
FT                   FGPPGTTIVGIILTGVAKSLMWHFLLQTCQAEHCSWSVTAAIGTFSIVATRNPFILTSN
FT                   VQAFSHLIASLLALGQVISFLPDKAKCKSALWICIAVYLVPYLFNNYSIHVAKSSVTQS
FT                   STHPIDLLRQDAKANFQALLERQSTSYAAACEEYRRRYGMEPPPGFEGWYNFAKAHQSP
FT                   IIDDFDVIYERVSPFWSISGVEVTETISRLQETLNSDVCVCTFSAAEARTSCSHPHRSV
FT                   DRNIQGFLNAVLADLRGLLPDIRFLVNHLDEPRVLLPPSSERPGSLNMTNYSRRPVWDT
FT                   VTKPCSSADRKKVDRPKVQTFGLPFVTDHHSAIDLCRHPEYRDSHGLLISPTSFPLIEG
FT                   LVPILATGSLSTMGDILYPSPAYLEPEFEYVAAKDGSWDSKHTNLYWAGSTTGAFAVKN
FT                   DWQSFHRERFVKLAQNLGNGLHSYLREGKGVVNLVKSSFLNSRLFDVAFTRILQCETRY
FT                   CRDQRALFRIRSWADRDEALRSRLVFDIDGNGISGRYYKLLASKSAPLKQTLLREWHDD
FT                   RLLPWVHYIPVSQSMTELPEMVMYFTSEAGQKCAQEIAEQGQDWFSKAIRKEDMTIYMY
FT                   RVLLELARLQDPERPANKS"
FT   CDS_pept        join(complement(511073..511213),complement(510075..511013))
FT                   /codon_start=1
FT                   /gene_family="HOG000183783" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268285"
FT                   /orf_name="AFUA_1G01630"
FT                   /product="Oxidoreductase CipA-like, putative "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87875.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051216"
FT                   /db_xref="HOGENOM:HBG326518"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005206A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ7"
FT                   /transl_table=1
FT                   /translation="MTQNDTPRTSYSDPSHPIQYLDNMAQKYARDQPSGFTNRIERVAI
FT                   VGAGGTVGKYITQELLKTGQHTITALTRADSQSTLPAGVRTATVDYQDESTLVAALQHQ
FT                   QFLIITLNVSAPKDTQSKLIQAAAKAGVPYVMPNCYGCDITNEKLRKEMLVGEPVRQAC
FT                   AEIEATGVSTWVALVCGFWYEFSLSTGPEWFGFDFQQKKLTFYDEGTVRINVSTWEQCG
FT                   RAVAAFLKFKELPEDENDTSPTVRGWANRPLFISSFLVSQRDMFESWKRITGDKEEDWT
FT                   IEYEPTAVRYQRGIERMQKGDRYGFAQAMYARVFYPNGGGDYESSRGLDNDVLGLPQED
FT                   LDERTKHAKEMIEAGYSYF"
FT   CDS_pept        511963..513336
FT                   /codon_start=1
FT                   /gene_family="HOG000213238" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268286"
FT                   /orf_name="AFUA_1G01640"
FT                   /product="Kinesin family protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="EAL87876.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG051222"
FT                   /db_xref="HOGENOM:HBG332168"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000051E7FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ6"
FT                   /transl_table=1
FT                   /translation="MQSIKVFVRWRPLAPSEANTPEIARTQHAHPTSNTSALSLTPPPA
FT                   HKLSRPWKSESAFTRIFTASDNNKAVFEAVVAPTLPRVLNGQSCNFFAYGHSGSGKSHT
FT                   IIGYDFEHPDEFGLCLSAARALYEHLDQRNATAGMNEPEKKFLLGLRMYELRKNTAFDL
FT                   LNDRCKCHIREGPDGKTHLRGETETLADGKVRVRPIVTKACSSFDEFHAQLLAGIGRRA
FT                   TGSSTVHDQSSRTHAVFEVEIVTRELLAARDAVVERQSELVPVGKRATDVYLEENLKGL
FT                   IRMPDGTFAPNPEYQINQAAIDEAEAKKAEFESYVRKAEEHVEAVKRSCRHTCLGGKFV
FT                   FVDLAGSEYYHDKRTVSTCRAKQTPQEQQEGRQINTDLLSLKEVIRAMAQKQSRIPFRS
FT                   SPLTMVLREHFLTGEGDGGFSAMILTASPSSEQYTATIDTLKYGNLIGVAGEHGKGRK"
FT   CDS_pept        join(513915..514052,514116..514427,514499..515287)
FT                   /codon_start=1
FT                   /gene_family="HOG000217105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268287"
FT                   /orf_name="AFUA_1G01650"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87877.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051229"
FT                   /db_xref="HOGENOM:HBG327920"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000520441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ5"
FT                   /transl_table=1
FT                   /translation="MATRPHQPSQASRPSMAVTRPREGRERKTLRRSRFGCRNCKLRKI
FT                   KCDESKPQCERCRSFGVLCNFMSNIPDLQPIAAEAGKSLAVEVRGKADLRPPVTSAVWT
FT                   SDGSTFYQLNAKCQDLITLYLGRSLMAPTNPIVRQVNRSLLSLAFSYPFLMHASLAVAF
FT                   MYDRHLNGPSGDRGSLEECYHRAQSIALLNQRLRDPIEEKDKDPIWGTAAALGILTFSS
FT                   PDARTPEESWPLKSSGPSDLGWLRMSNAKMTLWRIVNPLRSNSLFHVMAATFAVMHSPF
FT                   PESGIDGIPSELAAVCLLNDSSTAMNNPYFHAAHAVSQILLLPDSEVTIGQIQVFIRCI
FT                   HGAFEDLLQKRDPVALLLLYLWYRKAGRSVWWVELRARVEGPSICSYLQLYHHGNAAVH
FT                   AFLPGGALADRWY"
FT   CDS_pept        join(515889..517052,517105..517971)
FT                   /codon_start=1
FT                   /gene_family="HOG000217084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904132"
FT                   /orf_name="AFUA_1G01660"
FT                   /product="Alpha-L-rhamnosidase A, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL87878.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG051238"
FT                   /db_xref="HOGENOM:HBG330100"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI000051F87B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ4"
FT                   /transl_table=1
FT                   /translation="MSWSFQQRGPSPAPDEEPDVEMRFLTFFVLAAAACAAVPYEEYIL
FT                   APATRDLVPERVYQVSGSISDPSAVTHAEGGKATFHGVSSVTYDFGRNIAGIVSVAVSR
FT                   VSSPDAFIGVTFSESSAWISHEACDATADAGLDSPLWFPVGHGPGRYTAEKKHNRGAFR
FT                   YLNLITNTSATVVVDSVQVNFTAAPTQNLRAYKGYFHCDDELLNRIWYAGAYTNQLCTI
FT                   DPSMGNALPLLGAVTSRDNITLPETVPWWSNYTIANGSSVLTDGAKRDRLVWPGDMSIA
FT                   LESVAVSTYDLYSVRMALESLFAMQQADGRLPYAGKPFYDTVSYTYHLHSLVGVAYYYR
FT                   FAEDLNWLAAHWTQYKRALQWSLSSIDHTGLANVAASADWLRFGMGGHNIEANSILYFV
FT                   LRESLLLATTLNDTASSSSWSRIASTLKASANARLWDPAVGLYRDNETTTLHPQDGNAW
FT                   ALKANITLSATQSAAISAALSARWGPYGAPAPEAGSTVSPFSTGFELQAHFLAGQPQRA
FT                   LDLMRRQWGFMLDDPRMTQSTFIEGYSTDGSLHYAPYRNDARISHAHGWATGPTAALMF
FT                   YAAGLQIAGAGGERWLFAPMPGDLQAVEAGFETRLGRFATEFTRGEEGYTKLVFTTPEG
FT                   TSGEVRLEAEGVLVSGNGTRVKLVEGVSTGLHGGTWRLTRV"
FT   CDS_pept        join(518024..518230,518384..519577)
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752015"
FT                   /orf_name="AFUA_1G01670"
FT                   /product="Formaldehyde dehydrogenase, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87879.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051248"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FB33"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ3"
FT                   /transl_table=1
FT                   /translation="MDRVECVCVCVCARTVLMPTARKKKCIPLSTPLDSLQYQPWSSEV
FT                   DKCNPLLQTSDRILETRQNDEAALTLSIPPSNPESDIQSTNDDRNSQVNLPQASSKPPT
FT                   NRIRPTTSTLYKPHPTEQMKAAQWMGTRLIQLGTVAKPTITDPADAIIHITHCTIGGAD
FT                   LHLYDGELSDMLAQGDILGHEAIGTVEDAGEAVRSISPGDRVMILPVIACGHCEFCKRQ
FT                   EFSLCDTTNPSREMESAYGHRVAGMLGFTRLYGGYPGAQAEYVRVPHADFCCVRVPADM
FT                   DAKELLGLAHVTTAAWHGCELADVQPGDTVGVWGCGPVGLSVQRLAVLRGATKVYAVDK
FT                   DAGRLQIAEGFGMIPVDVGVHSEVGDYILSMEPRGLDCAVEASGFRSTQKPQHAAMRAI
FT                   GLEHDSSDTVSAMIKATRKGGHLALLGDFFYRTNDFPIGPLMEKGLTIRGGQVNSQKAL
FT                   TVADMRVN"
FT   CDS_pept        join(520194..520260,520328..521400)
FT                   /codon_start=1
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268288"
FT                   /orf_name="AFUA_1G01680"
FT                   /product="Branched-chain amino acid aminotransferase "
FT                   /EC_number="2.6.1.42"
FT                   /function="L-isoleucine transaminase activity"
FT                   /function="L-leucine transaminase activity"
FT                   /function="L-valine transaminase activity"
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="EAL87880.1"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="GO:0052654"
FT                   /db_xref="GO:0052655"
FT                   /db_xref="GO:0052656"
FT                   /db_xref="HOGENOM:HBG424074"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="UniParc:UPI000051FB13"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ2"
FT                   /transl_table=1
FT                   /translation="MSFPPPPVDTIDWSNVGFKVRDVNGHVECHFSHSTGATWSPPKFV
FT                   SSPFLPLHGMAPGLNYGQQAYEGLKAFRHPSGQISIFRPDRNAARLRRSAEFVSMPPVP
FT                   EDLFLQCVKLAVAANAEFVPPHETGAAMYIRPLLFGSSAQLGLSPPDAYTFVVFVMPTG
FT                   VYHGVHAVDALILEDFDRAAPQGTGSAKVGGNYAPVLRHSARAAAEGFGITLHLDSRTR
FT                   SEIDEFSTSAFIGVRRDGDKVTLVQPDSTNVIDSVTARSVCEIGERLFGFAVEKRRIGY
FT                   DEIKEFHEVIAAGTAAALVPIRSITMRSRGERFTFDCGADGQSGGEICIKLLQTLKGIQ
FT                   AGKIEDPFGWNCLVDQAPPAAWLEGATGHEGDTEGINVP"
FT   CDS_pept        join(complement(522063..523185),complement(521533..521948))
FT                   /codon_start=1
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268289"
FT                   /orf_name="AFUA_1G01690"
FT                   /product="Cytochrome P450 alkane hydroxylase, putative "
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87881.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051262"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000520442"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ1"
FT                   /transl_table=1
FT                   /translation="MTSNYSISLVAGAIAVFVYTLSVLRRKWTQYRFARAHNCQAPPRL
FT                   ASKDPLFGLDTIYATVQNVKEHKFLERAQARFDAVGHTIQTRRLLQTIIFTRDPQNIKT
FT                   ILSLRFKDYALGHRYKTFGPLLGHGIFTTDGEHWAQSRAMIRPNFVREQVADLAIFEAQ
FT                   MADLLELIPNDGRTVDLQDLFFSYTIDSATEFLFGQSVQSLKKRRSGGRDAHAEDDFAS
FT                   AFNYAQHAIATRIRLGPLAAFYRDRKVERCNRVCHALVEQFVDKALEVRAQGGRVDEKT
FT                   LEDGDGEKKPRYVFLHGLAQQTGDRRRIRDEVMNVLLAGRDTTASLLSNLFFMLAKHPR
FT                   IWARLRDEVAPLNGRPPTYEQLRNLTYVKYCLNESLRLHPVVPGNARFAITDTVLPVGG
FT                   GPDGQSPVFVPKGGIVTYSVWSMHRREDIYGPDANEFRPERWADLRPGWEYLPFNGGPR
FT                   ICVGQQYALTEAGYVTVRLAQQFAVLESRDPGPWEENLTLTLCSRNGTKVSLRN"
FT   CDS_pept        join(complement(527128..527369),complement(524155..527047))
FT                   /codon_start=1
FT                   /gene_family="HOG000213226" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904133"
FT                   /orf_name="AFUA_1G01700"
FT                   /product="Conserved serine-rich protein "
FT                   /protein_id="EAL87882.1"
FT                   /db_xref="HOGENOM:HBG051268"
FT                   /db_xref="UniParc:UPI000051F3F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKQ0"
FT                   /transl_table=1
FT                   /translation="MVFLRLTVKVYPREQTQSSSSFSIRSFLGDRDRDASGQNSGQAAG
FT                   KPASFLLVLENPEEVTMGGLAGMIREKWTKLRPNAEPLEIKKLVDDEHDSDDLDAELTV
FT                   ADVFVDNGRARTDGADQRGTVRVIQKPAPYAPVRFPSVSQDWDAAAQEFERQMKIKKEA
FT                   VQANLRKIPTIAEESQSFSERDTPSAQVNGGRTLAATVDDRERRRDVPVSSVEQEEIPM
FT                   SPPRWGESPVHENDSQDPKGVVVAATPQHKRMESQELGESPSPERQWAPTPKTQTSPAK
FT                   RGSVSKHVPATRSISQFVAEPDFPTSNRTERERIGSESPLSPRQAPSRPEREVDEEEEV
FT                   ETDISQQGRESDEEEEEEEEEVEEQFNDLDNDGDVAMNDSDVAALDKVPAEAEAEETVE
FT                   PVVNGSKESSSKGGLPAVRQRKRKKSLEEEQPNKEPRLEARSPGSSDKENNPSQSLSEP
FT                   PVSSPLVRRHERAPSFSGIGRRPSVSEKPESAKAGLGLGITKSPPSKPQVMVPLSQEAT
FT                   TSIGTPLFSSKASTIRRASLVENDATPSKQTPALDRVKQLHSALRKDSPAEKSAQRRSV
FT                   SFAEGEDVVISTSTPIPKSTPQTNPKGKATPGSEPGKKSSTASKMVFPTGVPQERVEQL
FT                   MREANQKFAKHHKDKEEVEEMIKVAKEQNKDPAYVRNLEELLAKLDRVQKLEKRNRSSE
FT                   RDRLERARADLRAKREEIAKMEADMGTSSQDKQQKADSAKINGNANTSSAETASKAKGA
FT                   KKSTPAAEPNGSVKKATEATKGAELSSTPTTAERKGSTKKVTEAKKGPDSTATPTAPKT
FT                   RPTEEEAKGTPSESPENTTEDAKLPPMTTIQRGDLPKGKANGTKKSPASAPVDVSSTTS
FT                   SSSDESSEYSESENEDDDETDAEAETQTGTDQPAQSKADLLRRSSVTPSSQSNARSPAP
FT                   SQSASQSWGQPINGSRSRATLKTLLVDKKKESAEKAQLAKKKISAAPKRPRNIFSPPSD
FT                   DDSDESESSSSSSSSSSESESDKDSDSENESHSSADHGDIMSSGTVGKLRAARKK"
FT   CDS_pept        join(527644..527669,527793..527919)
FT                   /codon_start=1
FT                   /gene_family="HOG000048317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752016"
FT                   /orf_name="AFUA_1G01710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87883.1"
FT                   /db_xref="HOGENOM:HBG051275"
FT                   /db_xref="UniParc:UPI000051E7EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP9"
FT                   /transl_table=1
FT                   /translation="MVSGEDTATIILNRNVTDVEFCRDGFRVVTDPTLYLGTVQIFCPS
FT                   FVSSL"
FT   CDS_pept        complement(528067..531564)
FT                   /codon_start=1
FT                   /gene_family="HOG000213215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268290"
FT                   /orf_name="AFUA_1G01720"
FT                   /product="Protein kinase and ribonuclease Ire1, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="endoribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="mRNA processing"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87884.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0016891"
FT                   /db_xref="HOGENOM:HBG051285"
FT                   /db_xref="HOGENOM:HBG330096"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010513"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniParc:UPI00005208F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP8"
FT                   /transl_table=1
FT                   /translation="MRWRLPGARTTLPASVALLLLPILVAPQQLQEHDDLPSTLSVPLS
FT                   PTQRSFDHHPLPTINVKSNDASALATMALAGPGRAVRARPAQASSSSAGLAPQLHARSL
FT                   QDWEVEDFVLLATVDGSIHARDRRTGAARWALEVPSSPMVESIYHRANRSSFDRAQPED
FT                   DFLWIVEPSQDGNLYIYSPGPDAGLQKLGLTVKELVEQTPYSGTDPAVTYTARKETTLY
FT                   TVDARTGNILQVFSSRGPITSGHGCRKVDGFDLEAEECDTPSGTLVLGRVEYAVAIQNT
FT                   ETGDPICTLKYSEWTANNRDMDLQSQYFRTMDQSHIYSMHDGVVLGFDHSRMDRPRYTQ
FT                   RFSSPVVRVFDVARPINVESPEAATPLVLLSQPLQPPDPDYGSLDDRDARVFVDCTSAG
FT                   GWFAMSEETYPLVTGRAKMAQCYEKDYLRHGQPLTSLPTSQQRDALAGVHSLNGPRVVR
FT                   NTPSISGPSPLELANDTPRELMRSPSELALPPALRHSTIIRKGWDNAVDIFVTILLLFF
FT                   GAFIYFNSHNIQELAKQKLDVKNIIASYAQPPLSTPSTPVVESTHFKRDSSPSRPISNL
FT                   TVEVTVPEEQQEGDATPKPKRDRSAVGPDSTPRVKIREPSRGPDSDDDVEELDQAASPE
FT                   KPKKKARRGRRGGKNHRRGKKPDSEGESKDQADRVVDQVNNLQPQSRLEPDLQLVRTVS
FT                   NDIIEMDGVLQIGRLRVFSDVVLGHGSHGTVVYRGSFDGRDVAVKRMLVEFYDIASHEV
FT                   GLLQESDDHNNVIRYFCREQAAGFLYIALELCPASLQDLIERPGDYPQLVQGGLDMPDI
FT                   LRQIIAGVRYLHSLKIVHRDLKPQNILVAMPRGRTGSRSLRLLISDFGLCKKLDDNQSS
FT                   FRATTAHAAGTSGWRAPELLVDDDNRSAIQGGESQHTESSEPAVVDPQTNRRATRAIDI
FT                   FSLGCVFYYVLTRGSHPFDKNGKFMREANIVKGNFNLDELQRLGDYAFEADDLIRSMLS
FT                   LDPRKRLAPLCSSLAFRLFTDLFPRPDASAVLMHPFFWNPSDRLSFLCDVSDHFEFEPR
FT                   DPPSDALLCLESVACRVMGPEMDFLRLLPKDFKDNLGKQRKYTGSKMLDLLRALRNKRN
FT                   HYNDMPAHLKAHIGGLPEGYLNFWTVRFPSLLMSCHSVIVELRLTKIDRFKRYFTPVE"
FT   CDS_pept        join(complement(534669..534765),complement(533892..534586),
FT                   complement(533237..533818))
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208711"
FT                   /orf_name="AFUA_1G01730"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL87885.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI000051F400"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP7"
FT                   /transl_table=1
FT                   /translation="MKLSSRTWTSLVTVVLAGQGAVTALELDINDVQSIKDAAATTAYN
FT                   MMSNYTGNQTGQIPGKLPDTWWEGGAMFMTLIQYWFWTGDTSYNEVTTQGMLWQKGNND
FT                   YFPSNYSNYLGNDDQVFWGLAAMTAAELNFPEEDGQPSWVSLAQGVFNTQVPRWDTSTC
FT                   HGGLRWQISTYQDGYRTKNAISNGGLFQLAARLARYTNNETYSQWAERIWDWSATTPLL
FT                   KESDWTIADTTSPETGCTDHGDLQWTYNYGTYISGAAYMYNFTNGGDKWKKGLDGLLNT
FT                   TFQRFFPFQNGMVMSEIACEPNMKCDRNQDCFKGFLSSWLTFMTTIVPYTSSEVVPRIQ
FT                   QSALAAAKQCSGGQNRTLCGRRWHQDTFDGTSSLEEQMSALSVFSSSMIAHRMQAQAPL
FT                   TVDTGGTSKSNASAGTGSEQAAPQPQPVTTGDRAGAGIVTVVFLSGWIAAVTWMVYGR"
FT   CDS_pept        join(complement(538428..538448),complement(537989..538146),
FT                   complement(536416..537910))
FT                   /codon_start=1
FT                   /gene_family="HOG000226736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268291"
FT                   /orf_name="AFUA_1G01740"
FT                   /product="T-complex protein 1, beta subunit, putative "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87886.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012716"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI00005206A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP6"
FT                   /transl_table=1
FT                   /translation="MKVSFKRASFANPTQIFADDVVEEKGENARLSAFVGAIAVGDLVK
FT                   STLGPKGMDKILQSASTGDILVTNDGATILKSIALDNAAAKVLVNISKVQDDEVGDGTT
FT                   SVTVLAAELLREAEKLVNRKIHPQTIIEGYRIASKAALEALEKAAVDRSKDMEAFRKDL
FT                   HAIARTTLSSKVLAQDREHFAALACDAVLRLKGSTDLSHIQIIKKAGGKLSDSYLDEGF
FT                   ILDKKIGVNQPKRLENAKILVANTAMDTDKVKIFGARVKVESTGKLAELEKAEREKMRA
FT                   KVERIKSHGINCFVNRQLIYNWPEQLFTEAGIMSIEHADFDGIERLALVTGGEIASTFD
FT                   HPEQVKLGHCDVIEEVIIGEDTLIKFSGVAAGQACTIVLRGATEQLLDEAERSLHDALA
FT                   VLSQTVKDPRVTLGGGCAEMVMSKAVEQAAQNTTGKKQLAVDAFSYALRQLPTILADNA
FT                   GLDSSDLVTRLRQAINNGMTSSGLDLLTPGGGIADMRELGVVESYKLKRAVVSSASEAA
FT                   EVSMVVDLLLHKRLANYVRLQLLLRVDNIIRAAPRKRERM"
FT   CDS_pept        join(538463..538538,538607..538984,539039..540471)
FT                   /codon_start=1
FT                   /gene_family="HOG000213214" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268292"
FT                   /orf_name="AFUA_1G01750"
FT                   /product="Peptidyl-prolyl cis-trans isomerase, putative "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL87887.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG023674"
FT                   /db_xref="HOGENOM:HBG317856"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI0000520688"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP5"
FT                   /transl_table=1
FT                   /translation="MADTGEQAKLAVNKRPHAAIEDEEDGNGSSSDDDFGPALPSADAP
FT                   KKKRRKLPFEKVYVNALPASPRYSKSLMHKEQLSFVTMTPYTDFLITSSMDGIVKFWKK
FT                   MAVGVEFVKEFRAHPAEIKSVSVSADGRSFATAGADKTIKIFDVITFDLLAMLSLDFTP
FT                   RCVCWVHPRGASLPLLAVTDEDSPMIQVFDGRGEHTTPLNTVKSIHRSPVAAIAFNNAY
FT                   DCVISADRSGMVEYWRASDGSYEKPDNVFELKSSTNLFEFKKSKSAPASITISPSGEQF
FT                   ATVSFPDRQVRVFDFATGKLYRKYDESITTITEMQQAGTALYPLDEVEFGRRLAIEREL
FT                   ENPITQPKINVIFDESGHFVLYGSLYGAKCINTYTNRVVRVYAKDEPFRPLNLALYQGQ
FT                   PQKKGVMTVSMAASANPLLQESEERDPILVSTGFAKIRFYLFTNETEISKSSRDVQNER
FT                   PTHADARETTAKKAAETGTSAILHTTMGDIHLRLFPQAAPKAVENFVTHARNGYYNNTI
FT                   FHRVIRKFMIQGGDPLGDGTGGESIWGGEFEDEFSSLKHDKPYTLSMANAGPNTNGSQF
FT                   FITTEKTPWLDGKHTIFGRAVQGLDVIHKIENTKTYKEKPEQDIKIVSITVT"
FT   CDS_pept        join(complement(541580..542061),complement(541112..541514))
FT                   /codon_start=1
FT                   /gene_family="HOG000213193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268293"
FT                   /orf_name="AFUA_1G01760"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL87888.1"
FT                   /db_xref="HOGENOM:HBG051315"
FT                   /db_xref="HOGENOM:HBG330091"
FT                   /db_xref="UniParc:UPI000051FD78"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP4"
FT                   /transl_table=1
FT                   /translation="MASGLLAWTANNAVLKPSCRLFYPLTIVFFLTTIVLASTDTILPS
FT                   AASASFPECGLSCTQLQQAADSCLASPEDTHAVHVSCFCQSSLLSQLKTSPDGTCDSSC
FT                   TSESDRQLLQAWYTNYCNSGGNSGAATTTVTSGAAASTSTSSSNAQAQAKEAKPQTWWD
FT                   GHYQWVIMVIVLVIAFSIIAAVATWLKKRHDAKYPNLYHGVGGSGSGTESGFFASRVRD
FT                   QSPGPGQPGQFSSTLGGLAPPPRSSYPNSDSIASSSRTEVVPPKSRSGHPSSRLAKTPQ
FT                   SADDDVEIREVTR"
FT   CDS_pept        join(543902..544194,544260..544441,544491..544870)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268294"
FT                   /orf_name="AFUA_1G01770"
FT                   /product="Short chain oxidoreductase/dehydrogenase,
FT                   putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87889.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000520407"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP3"
FT                   /transl_table=1
FT                   /translation="MAAPQTWLITGASSGFGVVLAEAVLKAGHRVVATARNPTKAAQTY
FT                   PQIESLGGTWLQLDVTRPDTKETVEDAIRKQGRIDVVVNNAGYALLGSVEDMSEEEIHQ
FT                   QINTNVYGPMRVIKAALPFMRAQKSGTIVNISSIAGLQAQPSCSLYAASKFALEGFSES
FT                   LSKEVAPFNIRVLIVEPGAFRTNFLSAYATPAAGLNPAYEGTTIDQVLQLFQSRNGKQE
FT                   GDPVKAVERIIDVVQGTGVGAGKTSCLRLPLGRDCIARAKTKLEEVRKNLDEMEDIACS
FT                   TDM"
FT   CDS_pept        join(545310..545598,545657..546118,546186..546460)
FT                   /codon_start=1
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269295"
FT                   /orf_name="AFUA_1G01780"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87890.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG736195"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F156"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP2"
FT                   /transl_table=1
FT                   /translation="MSKAIEFNVFKGSESGDVIPDTIRRTIQPSEVFVEISHAGLCGTD
FT                   RLFKHKGIALGHEGAGTVRDVGSAVTTFKVGDKVGFGWVRKVCGHCDFCVSGHDQYCQQ
FT                   REQYGKGNTEIGAFATHAVWHESMLVKLPHDLEPEYAAPLMCGGATVWCALTCYDIKPG
FT                   ERVGIQGIGGLGHMAIQFASKLGCDVVVFSSSAAKKDEAKGLGANEFHTLENGAVGDAV
FT                   RPVKHLLWCGNEPPDFSKLVPPSLSAGDLSMQQPPLPVMPLISNGIRVQGSAVASRVSV
FT                   RKMLRFVSVHRIRPIIMTWPMTKDGIQAAFQILEQGKMRYRGVIVGQRHLMGKPAVEKM
FT                   G"
FT   CDS_pept        546741..547406
FT                   /codon_start=1
FT                   /gene_family="HOG000213182" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269296"
FT                   /orf_name="AFUA_1G01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87891.1"
FT                   /db_xref="HOGENOM:HBG051332"
FT                   /db_xref="HOGENOM:HBG330087"
FT                   /db_xref="UniParc:UPI0000520689"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP1"
FT                   /transl_table=1
FT                   /translation="MPPNRVSNLSPNLLNGIFASLSQPSRRWSLLRTLQSDNPRDINGE
FT                   LRGTASFHPLRHSSAASDHRDVVYREEGELPKTFGPGLRWTKKYIWRQGENGGISVWFV
FT                   KVKPTAKQPEAQEEEDEADYLFHNFDFEGQGQDEAETVDAKESTFVTPPVPPLVPSEED
FT                   TAVIMARGDHLCINDMYRTAYAFRVRPESGEVVSWSSRHVVKGPKKDQDIVNFYQMEG"
FT   CDS_pept        join(complement(549428..549586),complement(549296..549375),
FT                   complement(549067..549247),complement(548966..549019),
FT                   complement(548392..548886),complement(548029..548296),
FT                   complement(547679..547977))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057631"
FT                   /orf_name="AFUA_1G01812"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87892.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51A46"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKP0"
FT                   /transl_table=1
FT                   /translation="MSHPTDEKAFVDQVPRESDAEKGSVSHEFAPKSKLDLFEDPDEGL
FT                   SPEERAKIDRALVRKLDIRLIPWLSLLYLISFLDRTNIGNAKLAGLQKDLNMTNDQYND
FT                   SLTIFFISYSVFEPITNVLLKRWRPSRFIPAIMFGWGLCMTLMGVVHNWSGLMAVRWFL
FT                   GLTEAGLFPGVGYFLSCWYKRTEFGVRMAIFFSAAALAGSFGGLLAAAIAQMDGVGGRP
FT                   GWSWIFILEGLATIVIGVLSLWMVHDFPDEATFLSEVDRKRVLRRLAEDQQSSAEHEQF
FT                   KMSYFWASLKDWKTYVSAIIYMGADGSLYAFSLFVPTIINQLGYTSIKAQLLSVPPYAA
FT                   AAIVTVTVGFIADRTRQRGICNILVSLVGITGFAMLLGCKTAGARYAGTFLGAMGIYPA
FT                   ISNTISWASNNTEGVYKRGVTLGIVIGWGNLNGIVSSNIYRGKDAPNFYPGHGTVLAYL
FT                   VLFQFGGSLVQYLLLRLENRKRLRGDRDHWIQGLDRSQIELLGDKRPDFIYTL"
FT   CDS_pept        join(complement(551463..551963),complement(550631..551407))
FT                   /codon_start=1
FT                   /gene_family="HOG000213171" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269297"
FT                   /orf_name="AFUA_1G01820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87894.1"
FT                   /db_xref="HOGENOM:HBG051335"
FT                   /db_xref="HOGENOM:HBG330086"
FT                   /db_xref="UniParc:UPI000051F3C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKN8"
FT                   /transl_table=1
FT                   /translation="MEGCVTLTTSSIVSLIVLFSLLLCLFILFRHLDAVVLAMAQASQA
FT                   SKPFCSPANKETQPGVNNTSAEDNDNTASENVSPKSFSISPVYFEKTAVVVLNPRKCSN
FT                   ILDSHLDDIRVPTLQPRTPQKRLHLAAADLNQLRKVSLQRTDSDDLLDAGIEDLMIPVL
FT                   EPERKPLIIARVRKDSDIPKPYPPGMNTGPWDGNIHWAIKGCSIFESQQEEAAAFSYRP
FT                   NLLSRQPISDLWIFQYGLRYIPDGRESNVFRTVRIERLASNVNLNQVLPSVPGEIYAAS
FT                   LCNTSPITGYNTAIVVFVLEKDALDFVQKSKEGLPLGFCVASVFLVNTPTYPMTFQMSQ
FT                   FIFHQGYTRCLVISHLRRSLREEIHRVLKRSAYYNYIESVEEGPVVGDIYVRFYSVKMA
FT                   AAAYDLFQGHPSFERCSTKFLKKAAE"
FT   CDS_pept        join(553171..553211,553260..554202)
FT                   /codon_start=1
FT                   /gene_family="HOG000264717" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057632"
FT                   /orf_name="AFUA_1G01830"
FT                   /product="Thiamin pyrophosphokinase, putative "
FT                   /EC_number="2.7.6.-"
FT                   /function="hydrolase activity"
FT                   /function="kinase activity"
FT                   /protein_id="EAL87895.2"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG098963"
FT                   /db_xref="HOGENOM:HBG738523"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI0000F51A93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKN7"
FT                   /transl_table=1
FT                   /translation="MKKTILEIVKDCDNFPYNQPGETAAYEQQISKLWKFFLPNDRRPH
FT                   GYLVESVVERMPWTEDFHVLPAPHKEIHLLPQDHAREQETWTERCERSLDALIALARAR
FT                   GVFPRLGKPRDERFPIIGAQFPVSIERSAISLFGIVGRGVHMTVYTRTKYGLKIWVPQR
FT                   NPKKSTYPGMLDNAVAGGVAAGERPMDCLIREAEEEAGMEESMVRKAHAVGTVTWFNIS
FT                   DDRAGGEPGLMNPGLLYVYDLEVGPEVVLNPVDEEDVCAFHLMDVREVLDAMAEGKFKP
FT                   ASASVMVDFLVRHGLITAEDDDDYPEIVSRLHRLLPFATSPTAGRT"
FT   CDS_pept        join(complement(557033..557094),complement(556943..556969),
FT                   complement(555486..556870),complement(554478..555436),
FT                   complement(554338..554424))
FT                   /codon_start=1
FT                   /gene_family="HOG000213160" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269298"
FT                   /orf_name="AFUA_1G01850"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87897.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051337"
FT                   /db_xref="HOGENOM:HBG323833"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0000F51A56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKN5"
FT                   /transl_table=1
FT                   /translation="MPRPRRPGAPEPKRRSRKGCWPCKARKVKCDEEKPSCLNCRRQNE
FT                   SCDYSIRLNWEGRTRRKSSVSSPSSQSSGHSAHLVSLAVLPSDLAQVDPLESGQGEGSP
FT                   QELAPHNTIWATACGSSLVAKTSCSRELENGLEILTSSAYSDHLGNSFPYMSYRTSVAT
FT                   SSQMTDSINSRPDTTPQMMATPQETLSPFTFPALHGSGDVAYPDASLNIGSPAMLNFPQ
FT                   SSILSSSLSYLRESAMETDPYVRSLVVHPRQTGSRGERNSVSSGSHKYFPFDTDDNSRQ
FT                   AGIPFPRHRFACTHPDTVDKDSLSAVRTETTTKTPGSAPTDTYFTKVMNGPIASEDYIY
FT                   SLQRDAEGICQRNIYQPSEISSSERKWSAYLTSVTDNYGLDHGRPDLDLNQMDDHSAVD
FT                   INYALDLINPERQTRTTFESASAGHGLATSVGCGYYASPVPINIPRHLSPLPLALVEKP
FT                   INLMYFHHFLDHTAKMLVAHDCGDNPFITVLPSMAIGDSNILNLMLAYSASHRARYLNH
FT                   PEPANRIAHWVSNVFPTLRIALEDPDQNITDNHLAAAIMLLSLKIISPSTFEVPIPWQS
FT                   HLKLARDLYLARGVQMAYPGNRVGSFLSRWLEYIDVMGSLSCQDIEPPLFLYQSIVSAC
FT                   SSAPANDDFFIDCFTGYTPKTALLLSRLAKLVHQCERTRVGNMISVGPDQRPSPEVVVE
FT                   AESLLADFQVADNMARINSRHHQEPVSADMLAIDRSFRYAGLVHLHRRVLCSPTASAPV
FT                   LEALDGLFKALGQLESGGSAEVGALFPLFTAGCETRDLQQQADIMQRVKNLEKTGLKQI
FT                   QNARTLMQRCWDEDLPWSSLAQGEFLG"
FT   CDS_pept        join(557960..558037,558103..558140,558230..558253,
FT                   558317..558509,558565..558620,558681..558840,5
FT                   58893..559084)
FT                   /codon_start=1
FT                   /gene_family="HOG000048318" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269299"
FT                   /orf_name="AFUA_1G01860"
FT                   /product="Integral membrane protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87898.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG051338"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniParc:UPI0000F51A97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKN4"
FT                   /transl_table=1
FT                   /translation="MAVAVVAKHPVQRMSSPSRGFSALVHLFGLASFIGSFKFMHENPN
FT                   RANEAYGWHFQYLTVIGLALSTLTFAVALLADLTLSARLFLVKNLLSICSAPMEVLISV
FT                   LYWGLRMIDERLVVPDWAYIPMHAGKYWFSRRTSHCVIDRSPTSFPSMDNQYRTRPWPI
FT                   KRNRVRLLGLDRAMLQVQRMVPVSDLRAGALRRPRRSFRDERRCHGAEHCNPKMALRSC
FT                   QWLRDSLKTQGSSWCSETERRFEA"
FT   CDS_pept        join(559787..560353,560423..560599)
FT                   /codon_start=1
FT                   /gene_family="HOG000213138" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904383"
FT                   /gene_name="pam17"
FT                   /orf_name="AFUA_1G01870"
FT                   /product="Presequence translocated-associated motor subunit
FT                   pam17, mitochondrial"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL87899.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051339"
FT                   /db_xref="HOGENOM:HBG330084"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniParc:UPI00005201F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKN3"
FT                   /transl_table=1
FT                   /translation="MHLTLMNGTLRTAALSGRFALASPSPLPTATPLFQCCQKMSLRTQ
FT                   ARPVSTSTTRILLKPSLRPQTSSMCLSPIFRKTAFRLNSTAANASRAEVPKLDWNSFFK
FT                   LRASRRRYTLASSIIASMASTIIGVQILSEQDLESLGAQVMGLDPFVVLGLATATCGAV
FT                   GWLAGPFLGNAIWRLVYRKYKPAFLMREKEFFDRIKRFRVDPSSNSIANPVPDYYGEKI
FT                   GSVQGYRQWLKDQRAYNRKRRSFII"
FT   transit_peptide 559787..559933
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKN3 "
FT   mat_peptide     join(559934..560353,560423..560596)
FT                   /product="Presequence translocated-associated motor subunit
FT                   pam17, mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKN3 "
FT   CDS_pept        join(complement(561701..562026),complement(561537..561647),
FT                   complement(561128..561484),complement(560926..561079))
FT                   /codon_start=1
FT                   /gene_family="HOG000027949" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269300"
FT                   /orf_name="AFUA_1G01890"
FT                   /product="Enoyl-CoA hydratase/isomerase family protein "
FT                   /EC_number="4.2.1.55"
FT                   /function="3-hydroxybutyryl-CoA dehydratase activity "
FT                   /function="isomerase activity"
FT                   /protein_id="EAL87900.1"
FT                   /db_xref="GO:0003859"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG461048"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI000051F3F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKN2"
FT                   /transl_table=1
FT                   /translation="MYPNPPPVAIPTSYESLQTTHIKVSHHPAGSPTVTPVVIVTLNRP
FT                   DKHNAFTLAMAEDLERVFGMFDLDERVKVVVLTGAGKTFCAGADLEIGFGGGRERERTA
FT                   DHRDSGGRVALAIHRCRKPTIAAVQGSAVGVGMTMILPAAIRIAHESSKYGFVFARRGI
FT                   TMESCSSYFLPRLIGYSRAMFLVSTGGVYPPNSKHFDGLFAETLPEGTQVLPRALELAA
FT                   EIAENVSPMASALNRALMWRGPESPEEAHLLESGILYHMFGARDQREGVSAFFEKRKPN
FT                   FKATLEHDGPANYPWWSEASIDPPAKAAKESSKL"
FT   CDS_pept        complement(562607..563353)
FT                   /codon_start=1
FT                   /gene_family="HOG000217104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269301"
FT                   /orf_name="AFUA_1G01900"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87902.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051341"
FT                   /db_xref="HOGENOM:HBG328682"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI0000520416"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKN0"
FT                   /transl_table=1
FT                   /translation="MSVSSCCLKGFEWAGSPSGRTAKLAKNDVYIVGDNPDVAIIIIHD
FT                   LLGWTFPNVRLLADHYACEANATVYIPDFFGGEVLPMELILKGEWERLDVRGFLGRNSR
FT                   EIREPELFDCARALRERYKKVGVAGFCYGGWAAFRLGAQEHQPPLVDCITVGHPSLLTK
FT                   KDIDEIAVPVQILAPEHDSVYTAELKRHTFDTLSKLGVPFDYQHYPGVEHGCFTRGDSN
FT                   KTGEREAMTRGKIAAVSWFTQWLGQP"
FT   CDS_pept        564445..565725
FT                   /codon_start=1
FT                   /gene_family="HOG000168398" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269302"
FT                   /orf_name="AFUA_1G01910"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL87903.1"
FT                   /db_xref="HOGENOM:HBG051342"
FT                   /db_xref="HOGENOM:HBG326862"
FT                   /db_xref="UniParc:UPI000051EED3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM9"
FT                   /transl_table=1
FT                   /translation="MYLFNKNQRRLLVYFAVFYVLLFIFCHFNSARDPGSYFFRPEEGY
FT                   RPQYSVRRILESRHFISRFNQSTPQPKQSLQNVTSGGRDPTICAGIVTVKRPIQQNLDT
FT                   AVGSLLDGLSREQRANIVVHVLFALSNPYDHPDYPQPWASNVIDRILTYKNSGADVSQM
FT                   ERWERENMIKDKSLIDYQLSLKSCYEGTKAPWILLLEDDVVAQREWYRHTMRSLGTIKH
FT                   WRSHGKIKDWLYLRLFYTEKFLGWNTEEWPTYLISSLAVISLVALAGVCARRRLRPMQG
FT                   ILTNPFLAVVCLLCVPLLIALYFLAGRVTVQPMRPGVHLMNSHGCCSQALLFPREKAPL
FT                   LMDHLEKLQKTRPEPVDSAIEILADQEGLDRWTMSPSQMQHVGAASYKENRKSYELDGP
FT                   YSVKGAHGVWSMSFEKAYRPPFDPDAF"
FT   CDS_pept        join(568452..568659,568769..568825,568888..568955,
FT                   569012..569340,569393..569485,569550..569880)
FT                   /codon_start=1
FT                   /gene_family="HOG000048319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057633"
FT                   /orf_name="AFUA_1G01920"
FT                   /product="Plasma membrane protein Pth11-like, putative "
FT                   /protein_id="EAL87904.1"
FT                   /db_xref="HOGENOM:HBG051344"
FT                   /db_xref="UniParc:UPI000052042C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM8"
FT                   /transl_table=1
FT                   /translation="MEDSSLGADPTKTPVVPAPAGQQSNFDNPASHANDYYIIAGICTA
FT                   LMTFLVFVRLYIRFLVTRTPWWDDSHRCTTQLFQSAYTGVVMKEGSLGLGRHAWDVTLA
FT                   KFAEFDKYARPLTAPAIYFTKLTLLLLYLRLFLLNRPVKFGIWGGIVFCTIYYTAAFFL
FT                   NLFLRDLHALSKLAYSVGVFSVVSDVYIITLPLLAIVQLRLSRAKKWRVAAVFLTGLLS
FT                   VVMSFLGCIFRFQVNVMDITYSLLPIYIVNTVEVDIGIICTCLPLLGALFKENTKESRQ
FT                   PTGFRSIHNHLPSSRSRFPRSVDRKHQNHNSDNIELIPQTSAAGVVPETYPVSPPSSSP
FT                   NAIWRITTIEQKWVESSVPQQ"
FT   CDS_pept        join(571079..571459,571530..572720)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269303"
FT                   /orf_name="AFUA_1G01930"
FT                   /product="MFS multidrug transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87905.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FB14"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM7"
FT                   /transl_table=1
FT                   /translation="MEDLEKHRSSSFSPNEDANKSTPLLHEDHTSAHGAVSLWDSETKR
FT                   FPETNLSRGIVGWDGQNDPANPQNFSAGQKWGLLALMSSITFLSPLASSMFAPAASYVA
FT                   VDLGVTNETLLSFSVTIFLLGYTFGPLILAPLSEIYGRRIVLSFANWFFVVWLVGCALA
FT                   PNIESLIVFRFLCGIGGCGCITLGAGLIADLFPVEQRGMATSIWSLGPLVGPVAGPICA
FT                   GFIGESIGWRWIFWILLIASGAISFGIECLNRETCAPVLIRWKTAKLAKELGRTDLRSA
FT                   YEPDGQGVSVASTLKLGLMRPLQLFFKSPIVFLLSIYMSLTYGLLYLFFTTIPSVFQKQ
FT                   YGFSTGLSGLAYLGIGIGFFVGLALIAFTNDRILMKLTAKNGGKSEPEMRLPTMIFFSC
FT                   FLPVSFFWYGWSAAKKAHWIVPIIGMCPFGISLMGLFMPIQTYVIDCYPAYAASANAIL
FT                   TATRSLVVALVPLAGPSMFNSLGLGWGNSLLGFLALAFVPIPILFTRYGKAIREKFPVN
FT                   FDGKKA"
FT   CDS_pept        573081..574421
FT                   /codon_start=1
FT                   /gene_family="HOG000213127" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269304"
FT                   /orf_name="AFUA_1G01940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87906.1"
FT                   /db_xref="HOGENOM:HBG051345"
FT                   /db_xref="HOGENOM:HBG331973"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000520916"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM6"
FT                   /transl_table=1
FT                   /translation="MVSTRHNASLSSSEKKRLRDRRAQENLRRKRENHIKYLEERVQFC
FT                   ERHHGASSMQQLLTAVDSLRWENELLRARQDRLRNMIVSWDADEIGVVSSVTSQQPRRL
FT                   ENAGLDINPKTGCLCDQEKKGLAVTPSVTANVGIPDLGAQNEIFTRTTGLTLEYAGTGP
FT                   GFGHLNGVPNVAAAGPNILPSIQLPELPHSSATQTLPSTVPTWCLVPMNEYGHDPSLVP
FT                   ATSPWFTRPDLIIACPPVPDPLDLLHGTRRNYLANEIHCAIRRRAIRDAECLALGWLTY
FT                   VYSKWRVSPNPATFTRLAPFQQPLMTQIQQGHPITLDLIIWQQLRVNIIRNWTKYDFAE
FT                   LTGYLGCCAKVRWPWGKDMLERDADNNLQIRQEFFEVFTHESGWGLTSEFIDKYPKLME
FT                   GLDVEALRFRMILPSKAELSVVPHWDSRVEYSCEQELEVQPDHSVHI"
FT   CDS_pept        join(577542..577581,577660..577863,577932..578092)
FT                   /codon_start=1
FT                   /gene_family="HOG000213115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208971"
FT                   /orf_name="AFUA_1G01950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87907.1"
FT                   /db_xref="HOGENOM:HBG051346"
FT                   /db_xref="HOGENOM:HBG330083"
FT                   /db_xref="InterPro:IPR022024"
FT                   /db_xref="UniParc:UPI000051E58D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM5"
FT                   /transl_table=1
FT                   /translation="MTGRNVSHGRGGAGNIYSTANPTSAKDLITPTIKQDTFTTGRGGS
FT                   GNMVQYDPERPEIARELQDVESPPQRVEEAPHHTGRGGVANAYVPTPEEEKKVREQEEE
FT                   NLQRVRTASRDRLKDVKLASEKRAGSSSPR"
FT   CDS_pept        complement(579129..580202)
FT                   /codon_start=1
FT                   /gene_family="HOG000213104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269305"
FT                   /orf_name="AFUA_1G01960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87908.1"
FT                   /db_xref="HOGENOM:HBG051347"
FT                   /db_xref="UniParc:UPI000051F3F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM4"
FT                   /transl_table=1
FT                   /translation="MKRHILCHYMPSWKYSRSTSTQNRSSMKTLPSISVLTCVAQSQSQ
FT                   MSPTGPNGAKDNLNVHDLELMMQWCTKTYRSLSHSSNVESIWQTVIPREAMRHPALMHG
FT                   ILALSALHLASSTGGSMYERYIKTAEAHKDLALSGFRKRFTNIDHSNCDAAFALCSLTT
FT                   ISSLAFPLIAGQGQTNTALDDICVAFQVARNSMNVLVQIADQVKSGELKPLLEEDEGGP
FT                   KMPDTSRLAIMSLSMTNSQLVNRNPKHEREMFEATIRQLGQSLEKLAQGREASIVAFQW
FT                   MHHIPPRFMDLVHERHPFALVILAHYAVVLHFMRSRWWMGDWGARIIQQVGQLLDSQWR
FT                   QSISWVLDATGCYIAPT"
FT   CDS_pept        join(586992..587219,587284..587363,587422..587907,
FT                   587970..588246)
FT                   /codon_start=1
FT                   /gene_family="HOG000213093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904384"
FT                   /orf_name="AFUA_1G01970"
FT                   /product="VeA-like protein"
FT                   /protein_id="EAL87909.1"
FT                   /db_xref="HOGENOM:HBG051348"
FT                   /db_xref="HOGENOM:HBG330077"
FT                   /db_xref="InterPro:IPR021740"
FT                   /db_xref="UniParc:UPI00005201DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM3"
FT                   /transl_table=1
FT                   /translation="MYAVEERSHPVPPPPPPLSMDRIPPPSSAYPTPGSAGPMRSADHL
FT                   APVSTIHEGRIWSLQVVQQPIRARMCGFGDKDRRPITPPPCIRLIVRDAQTEKEIDINE
FT                   IDTSFYVLTVDLWNADGTSEVNLVKHSATSPSISTAMSSSYPPPPQNLSPTYPAFTQNP
FT                   YGQPVGYPQMNNYYGGNAQLAYQYGTNPQASYYPPYYAGGQMPPAGMSPAQQPVPAGPG
FT                   GMFTRNLIGSLSASAFRLTDPDNKIGVWFILQDLSVRTEGTFRLKMSFVNVGTQSGDST
FT                   NNTPVINHGSAPVLASVFSEPFQVFSAKKFPGVIESTQLSKCFALQGIKIPIRKDGVKG
FT                   PRGRGGDGDDDADDYE"
FT   CDS_pept        join(589651..589875,589955..590269)
FT                   /codon_start=1
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269306"
FT                   /orf_name="AFUA_1G01980"
FT                   /product="IgE binding protein, putative "
FT                   /protein_id="EAL87910.1"
FT                   /db_xref="HOGENOM:HBG051349"
FT                   /db_xref="HOGENOM:HBG325733"
FT                   /db_xref="UniParc:UPI000051FFC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM2"
FT                   /transl_table=1
FT                   /translation="MLLSFLAALTAAENQTAGIPFQVRASAPGTPVDNRMMTASNLTFF
FT                   LNGQTASTCPLSSGCPPGNRTVLNGDASSLNVVVPGGQRIYVTGDGSVHFTPGHSPSIP
FT                   PGASTGPFSQAGGAWHFKGMGARDFVACPVPINRWRVFAALQNATVPGVNVTACVPFVA
FT                   TVIPFMSSQPAAYQYT"
FT   CDS_pept        join(complement(591883..592107),complement(590738..591816),
FT                   complement(590438..590681))
FT                   /codon_start=1
FT                   /gene_family="HOG000091641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208972"
FT                   /orf_name="AFUA_1G01990"
FT                   /product="Ribosome biogenesis protein Rsa4, putative "
FT                   /protein_id="EAL87911.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG330076"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051FFC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM1"
FT                   /transl_table=1
FT                   /translation="MATLVPPPSKRQKLETAEKTRLQQEVESIPDNLGSVRVQFFDQAT
FT                   GSATGPSVSVPVADANIKNLETLLNTLQGNDDDERVPYRFTYQSDDKDGQTIDIQADLY
FT                   HSLLKPGLKTTEDTIHLYFTPQAVFRVKAVSRCSASIAGHGEAILATSFSPVSSSTMVS
FT                   GSGDSTARIWDCDTGTPKHTLKGHTSWVLAVSYSPNGAMIATGSMDNTVRLWDAAKGTA
FT                   LGGPLKGHAKWITSLAWEPYHTQEIGRPRLASASKDSTVRIWDVVGKRIDTVLTGHKGS
FT                   VTCVRWGGTGKIYTSSHDRTIKIWNAQNGSLLQTLSAHAHRVNHLALSTDFALRTAYHD
FT                   HTGKVPGSDTEKVAVAKKRFEQAAMVNNKIVEKLVSASDDFTMYLWDPENSTKPIARLL
FT                   GHQKEVNHVTFSPDMAYIASAGFDNHVKLWNGRDGKFITTLRGHVGAVYQCCFSADSRL
FT                   LVSSSKDTTLKVWNVRTGKLAMDLPGHKDEVFAVDWSPDGQRVGSGGKDKAVRIWTN"
FT   CDS_pept        join(592368..592865,592913..593234,593297..593337,
FT                   593390..593539,593591..593710,593774..593861,5
FT                   93920..595223)
FT                   /codon_start=1
FT                   /gene_family="HOG000213082" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752270"
FT                   /orf_name="AFUA_1G02000"
FT                   /product="DNA mismatch repair protein Msh4, putative "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="EAL87912.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG124664"
FT                   /db_xref="HOGENOM:HBG599749"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="UniParc:UPI0000F51A45"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKM0"
FT                   /transl_table=1
FT                   /translation="MRSLSCVSSFGDASSFTALTSRQDSDRPRTARPATTATSIASQDI
FT                   ICAISESRGVSSTVGLAFVNLSTAETVLCQICDSQTYAKTVTKIAVFEPTEILFMSSAR
FT                   ESKLFYIIQENIPDTAYTFLDRRYWSEKAGHEHVDRLAFPQDVETIKITLGGNYFASCC
FT                   LAAKVLKYIELELNRVFTSHSLRIRFEPSQGSMSMDLSTIVSLELIQNLQNAKSEDSLL
FT                   GLLNETLTPMGARLLRANILQPCTEKSKLLARYDAVEDLSTKEDMFISVRQALKGFIDA
FT                   DKVLTSLILAPTKRTFQYVEQSGNNVIMLKTYVSSINSIYKALATAQSSLLMTIRELCG
FT                   PAGHRAIEQLIEETLNEHVTYQTKPLDLRNQRIYCVRAGVNSLLDVARQTYKEANVDAA
FT                   DLVAKVSESHNLTLDLKLDSARQYYISVSASEVKTLSGIFINIYRRKNRIECQTLDLVK
FT                   LNQKIMDAHNEVINMSDQTIQSLINDVCSEISVLFKVSEAIAMLDMLAAFAELATCNEY
FT                   IRPELTDVLAIKSGRHPIREKIHTKKFIPNDAYATQQSRFQIITGSNMSGKSTYIRSLA
FT                   LMTIMAQIGCFVPAEYASFPVMHQLFARVSTSDDLEANVSTFAAEMREMAFILRNIEPR
FT                   SIVIVDELGRGTSTTDGLAIAIAIAEALIESHALVWFVTHFRDLALILAERNGVVSLHL
FT                   AAEISPDISQMVMLYKIAEGPDTTQFYGLAVAKLVDLPPGVLERAQTVSEKLNRIAQRR
FT                   HSRSKALMLSRKRNLLLSLREQLLQARNGTLEGDALREWLKELQDNFVLRMAAIEDETA
FT                   EMNNEEVDYDSNTAPAESAQDNFGQLSS"
FT   CDS_pept        join(complement(597653..598126),complement(597347..597585),
FT                   complement(595635..597288))
FT                   /codon_start=1
FT                   /gene_family="HOG000213071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269307"
FT                   /orf_name="AFUA_1G02010"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87913.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051350"
FT                   /db_xref="HOGENOM:HBG330075"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051F3C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL9"
FT                   /transl_table=1
FT                   /translation="MSENEQPRATPSQGQNRGGNRRRGRGGFSHQTGQTEGTQRPSDGA
FT                   GRGPRSRGQGHRRGGGGRDKQNRGANPGQAADENVTPEANAETPSQGAPMAEEGEGRQV
FT                   AAAETDDADDGEICFICASNVAHSSVSPCNHRTCHICALRLRALYKNKACAHCRTESSY
FT                   VIFTDDPAKRYEDFTDADFSQKDDNLGIKYENNDIFEDTVLLLRYNCPDRSCDVACLGW
FT                   PDLHRHVKSKHGKVMCDLCTRNKKVFTHEHELFTMAELRKHEKYGDDVPGALDQSGFKG
FT                   HPECGFCRKRFYGDDELYAHCRDRHERCHICDRRSGSRQQQYYIDYNALEDHFQKDHFL
FT                   CLDKECLEKKFVVFESQMDLKAHQLECHPNGLSKDARRDARTVDLSDFDLRAPYQSQRQ
FT                   RRGAGRGRDPNAEPLPVSSTQPLRRDEIAYQRQMAIQSAQSVSTRSFGGQLTRNDTQTV
FT                   RAPARSGAATPVRTPPAGPPVAEMEALNVGAPSGPATPQDQARRLRHAAVIERASNLLR
FT                   NDASKLADFRSKVSQYRTSALSPTGLIDAFFSLFDTSSTELGKLIKELAEIYEDESKRN
FT                   ALLKAWNDWRAINEDYPALPGPGGQIPGMSSGTVNGSGVGGKRVLRLKSSTAQSSRSVV
FT                   GRSGSIVSTSSSSSTNPFPPLSSSTARSAPRATTTSSPWATVAPTPARTMASAINPSSR
FT                   PAPTPSRTVQNTNDSEAFPALPAAPKPNVLMAGLTRGTVRWDDRQPPPVNAWASSTGSG
FT                   SASVNGPEDEHGESSSAGGKKGKGKKGKQTLFHFG"
FT   CDS_pept        join(complement(599840..599992),complement(599268..599738),
FT                   complement(599161..599214),complement(598907..599092))
FT                   /codon_start=1
FT                   /gene_family="HOG000213060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269308"
FT                   /orf_name="AFUA_1G02020"
FT                   /product="SWIB/MDM2 domain protein "
FT                   /EC_number="5.99.1.2"
FT                   /function="DNA topoisomerase type I activity"
FT                   /protein_id="EAL87914.2"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="HOGENOM:HBG051352"
FT                   /db_xref="HOGENOM:HBG323848"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniParc:UPI0000F51A48"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL8"
FT                   /transl_table=1
FT                   /translation="MPCAIVSPDVEARYTEVIDSILAKSDLNTISEKRIRKGLQEVVGY
FT                   DLTPQKAAIKQLIMKRFDIFAEQSGIGGSSDAAASSTAPTSNGQLQNHDSVTPAEPSPP
FT                   APSSSPQKRQAESDDQSDPPRKTPPAKKKKPDHDIDADALYAAKLQAEENMRARPTRGA
FT                   SARRSAPVKKKAKAKTSKKVKAEDDSDLDSGSETKKEVNRSGGFHKPLNLSPALSALLD
FT                   GETTLSRPQTVKRLWQYIREHNLQDPNDRRHIRCDDAMRAVFKQDRIHMFTMTKILNQN
FT                   LYSPDE"
FT   CDS_pept        join(600839..600911,600991..601183,601246..602773,
FT                   602835..603263)
FT                   /codon_start=1
FT                   /gene_family="HOG000265546" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904385"
FT                   /gene_name="prt1"
FT                   /orf_name="AFUA_1G02030"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit B"
FT                   /function="nucleotide binding"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87915.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG024617"
FT                   /db_xref="HOGENOM:HBG381136"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000051E577"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKL7"
FT                   /transl_table=1
FT                   /translation="MAPSFDTLSEQDLHEEEEEEIDFSDLKAQYEVKLEEGLDTFVVID
FT                   GLPVVPEESRQKLIKFLLRKLNTVGHTSEDAVFMPLNDKNMSEGYAFVEFETPEQAVAA
FT                   VKQLHGTPLDKKHTLLVNKLMDIERYGREGRIDEEYKPPAIEPFKEKEHLRSWLADPNA
FT                   RDQFALYRGDKVGVFWNNKNHPPENVVDRAHWTQLFVQWSPKGTYLASVHPQGVQLWGG
FT                   PAFSKQKQFPHPFVQLIEFSPGESYLTTWSARPIQVEEGQSILTYEEEGKNIIVWDIAT
FT                   GKPLRSFVSHDLTAGPAGDAEPKKKVQWPAFKWSADEKYVARMLQHQSISIYELPRMNL
FT                   LGKTSVKIDGVMDFEWSPATVTREGVKQYEQLLCFWTPEIGSSPARVAMMSVPSKEIVR
FT                   TRNLFNVSDVKLHWQSQGLYVCVKVDRHSKSKKSMATNLEIFRVREKGVPVEVVDSLKD
FT                   TVINFAWEPNGNRFVLITTGEAVAGAAVAPKTAVSFFAPEKKGGAIGNFKLIRTIEKKN
FT                   SNAIYWSPKGRFVVVATVHSQTSFDMDFWDMDFEGEKPEAEKDFAANLQLMKTTEHYGV
FT                   TDIDWDPTGRYVVSSASVWTHQLENGWNLHTFAGQTLSENPTDKFKQFLWRPRPPTLLS
FT                   KEEQKQVRKNLREYSKEFDEEDRYAVDIANTAVVEKRKRVLNEWIAWIRREKELLAEEK
FT                   DAYGLPEEADDPKLAKDAAATTQEQGETVVEEIVEEIIEESEEVIG"
FT   CDS_pept        join(complement(604151..604435),complement(603587..604090))
FT                   /codon_start=1
FT                   /gene_family="HOG000213049" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904386"
FT                   /orf_name="AFUA_1G02040"
FT                   /product="Extracellular SCP domain protein Pry1, putative "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87916.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="HOGENOM:HBG051353"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="UniParc:UPI000051E578"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL6"
FT                   /transl_table=1
FT                   /translation="MIPTTYLLLAVSIFLWLQLLPSIHASNTAGTTVIVTVTPTIPHPA
FT                   SYTSLEIFKDTVLSTSNAYRREHNASHLTWNETLTKYAKRWAEGCKWKHSGGPYGENLA
FT                   FGYQDPAAAVAAWGDEGQKYDYKLPTGFSEETGHFTQLVWRATREVGCAAFNCGYQNGN
FT                   DAKNKEGRYTRAQGWYVVCEYSPAGNVVGNQNAFFRVNVQPTSTYSGPETAGSATGTSA
FT                   SASGSATATATSGVEELYDGRLRDQYQNAFVGLIVFINLV"
FT   CDS_pept        join(complement(607837..607948),complement(605484..607761),
FT                   complement(605156..605426))
FT                   /codon_start=1
FT                   /gene_family="HOG000213038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208973"
FT                   /orf_name="AFUA_1G02050"
FT                   /product="Secretion pathway protein Sls2/Rcy1, putative "
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87917.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="HOGENOM:HBG059676"
FT                   /db_xref="HOGENOM:HBG323852"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000F51A44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL5"
FT                   /transl_table=1
FT                   /translation="MANARNGPKAGGKPRRDVLASLKMASMEEISRAALPAEIMSSILD
FT                   YLSPADLIRAARSSKLLREMAYDDTRWVQKLKRMGCWNESEARKHIEETFGTIASVESV
FT                   EQQQVAEQIGQPFSEQGPAISLNTISDGFDQIKLSTSVPSEEVHELEKDPVLGALKQVR
FT                   SVRGEARVEYGKVHAALAPFYDDIVTSGPSPDNLLFRKYPDPEHQAQILSQLRLFAKCD
FT                   TTEGWRERNARLQSAISMFETAAMKEFRQGYESEDIDGAMRRYAHILFTLNGGDSAIEF
FT                   FVNHNHLIAQKSDLGRVADCIDGLNQRVKLEHTQAFFTRLSVAYNEEVSIINRAFPPSM
FT                   TVGPTFVEKVAQDVLYPFLTAIFDELHRSNVESYLIAVSGTFAQCLNLSEALLPIQNTT
FT                   DTLDEFLRHIVAKVYEPHIDLYLAEELDHFRKKSAAVVDEWDRQLSEQAASTESFLMSN
FT                   VNRQADKRDFLTSFKKVIMAPVNILPSFSSSKSSETKSDHESIGSEPSSALKSPNRFST
FT                   IASPALTPTVEAPPTTELAAKAAVMKSKLEGIRSLFSIEIALSLIHSAKSSLDRAAQFV
FT                   KIGGETGAAAKQQCEAIFVSLLRILGHQHLIVGFNKAVDHLSNYRPREQGERDQAGVEP
FT                   LVTFLELVNVGDLILQMMDVFYEQELVGAKITDRNDFLDPAVKEKKKFEQILDERVAAG
FT                   LNKGIDVLMEEVDYILATRQQATDFNPDASTDPYRKTMDVAVSEAAAAVVDVVSSHTQM
FT                   LVGSTDKSTLDVFNQEVGLRLFTALCKHLKRQRISIEGSLKLISDMNHYFKFIQSLKNN
FT                   DLLLYFKAFRELAQIYLIDSSDAKELATIIADADRFYGIWRVEEVYEFAERRADWFQVK
FT                   RDVERAMYGIGCNIM"
FT   CDS_pept        join(608894..608977,609037..609112,609159..609417,
FT                   609472..609527,609584..609680,609729..610080,
FT                   610132..610428,610489..610635)
FT                   /codon_start=1
FT                   /gene_family="HOG000234557" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752271"
FT                   /orf_name="AFUA_1G02060"
FT                   /product="Pachytene checkpoint component Pch2, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="EAL87918.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG051354"
FT                   /db_xref="HOGENOM:HBG323853"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0000F51A3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL4"
FT                   /transl_table=1
FT                   /translation="MKLLQQPVLHVEARVKSNRDGIIVRTDLIRDEITQWLIDNFVVLS
FT                   LGQEIKSFEGLKEPHAQALESILITECTGGDLESGAYRLQNVQLDVQAYQLRTHLDQER
FT                   SHHILHDEELVDNVEDLGTTKVLILPSTELDGLWESLQYDQPLQSTLLRAITRMVSFSA
FT                   RKLDKWTINWNRLILLWGPPGTGKTSLCRGLSQKLAIRLGKHYPQSKLVEINAHSLGSK
FT                   YFGESGKLVSKAFESIELLLEEEEDSFVCVFVDEIETLAARRERALSSKEPFDAVRAVN
FT                   ALLTGLDRLKHHHNVIVICTSNLVTALDQAFLDRVDIKQFVPHLSNKTIYGIYKECLEE
FT                   LSWRGIIEGASFDVFQVKPEDPQTALQYVEQPARFLMLPMFEEMLLNYQIFPNAIPKQL
FT                   ADAASASVGLSGRTIRRLPALSLVLHCSSSQCDIRAALQALRRCITSEIQAKTEAM"
FT   CDS_pept        join(611102..611176,611287..611444,611567..611629,
FT                   611708..612105,612158..612423)
FT                   /codon_start=1
FT                   /gene_family="HOG000003867" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208974"
FT                   /orf_name="AFUA_1G02070"
FT                   /product="Cytochrome C1/Cyt1, putative "
FT                   /EC_number="1.10.2.2"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87919.1"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG228389"
FT                   /db_xref="HOGENOM:HBG314262"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="UniParc:UPI000051E7EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL3"
FT                   /transl_table=1
FT                   /translation="MLARTVLRSVPSRGIARQSLSKTTTRASSSTAGTEAASSPFHLTL
FT                   TASVATAAAIGSAAWYYSVYGKEAFAMTPAEEGLHPTQYPWEHAKWNKTFDHAALRRGF
FT                   QVYREVCASCHSLTRVPWRSFVGVMHTVDEMKAFAEEHEYDTEPNDQGEIEKRPGKLSD
FT                   YIPPPYKNEEAARAANGGALPPDLSLIVKGRHGGCNYIFSLLTGYPDEPPAGAQVAEGM
FT                   NFNPYFPGTGIAMARVLFDGVVEYEDGTPATTSQMAKDVTEFLNWAAEPEMDDRKKMGA
FT                   KALVILTGLFALSVWVKRYKWAPIKTRKIVYSPPVPRR"
FT   CDS_pept        complement(612886..614055)
FT                   /codon_start=1
FT                   /gene_family="HOG000213027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208975"
FT                   /orf_name="AFUA_1G02080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87920.1"
FT                   /db_xref="HOGENOM:HBG051355"
FT                   /db_xref="HOGENOM:HBG330073"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI000051F655"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL2"
FT                   /transl_table=1
FT                   /translation="MTVQFPTSDGEADPGATSPSKFNALQTFRRLWELVSPARPEDISS
FT                   RETDCHPPKTTVQRRRQSIADQSLDRDEHLAEKVTSHRIEDTVPPEKTVLYLAYGSNLC
FT                   AKTFLGKRGIRPLSQINVVVPSLQLTFDMPGIPYVEPCFAATRRRAHLSKEAEAGEIGT
FT                   VESPADADTFEQVALLSEGSASMPLVGVVYEVTITDYAKIIATEGGGGGYKDIVVDCYP
FT                   LPKSQSPTDPIPEHPETKPFKAHTLLSPSEDPDPSHLTSKDRKLPPPYRRPKSCYAQPS
FT                   ARYLDLINTGAAEHNLPLPYRRYLSQFQPYRITTVRQMFGKAIFVALWVPALITIISLS
FT                   KLLAGPDGRSPPWLVQGSNLLFNVMWTTYDYFFAPIFGDGERTMEDTCS"
FT   CDS_pept        join(complement(615576..615606),complement(615248..615538),
FT                   complement(615101..615192),complement(614412..615038))
FT                   /codon_start=1
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057634"
FT                   /orf_name="AFUA_1G02090"
FT                   /product="Quinone oxidoreductase, putative "
FT                   /EC_number="1.6.5.5"
FT                   /function="NADPH:quinone reductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87921.2"
FT                   /db_xref="GO:0003960"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51ABA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL1"
FT                   /transl_table=1
FT                   /translation="MAGTRTMKAVEAAIDRSLAVKGGTGPADALYIDDIPVPPISGNQA
FT                   LVKIKAFGLNRMDLLQREGQYPLPPQAPETMGVEFSGTIENLGPDANRDFKVGDEVFGL
FT                   AYGGAYAQYIAVSTNMLIHKPAELSWEEAAGIPETWITATQALYLVGEYKPGQSVLWHA
FT                   GASSVSIAGIQLAKADGAKAIYVTAGSDEKIDFCVKKLGATAGFNYHTQDWSAEIQKAT
FT                   NGEGVNIIVDFIGATYFQGNLDAAAKDGRIVNLAVMGGVKLPEGVNIAPFLRKRLRFEG
FT                   STLRSRDEQYQKKLRNTLVEHALPKFKDGSFKVFVEKVFPMEQIIDAHKLMESNQTKGK
FT                   IICTVS"
FT   CDS_pept        join(616953..617068,617771..621020,621079..621318)
FT                   /codon_start=1
FT                   /gene_family="HOG000213004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208976"
FT                   /orf_name="AFUA_1G02100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87922.1"
FT                   /db_xref="HOGENOM:HBG051356"
FT                   /db_xref="UniParc:UPI0000520443"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKL0"
FT                   /transl_table=1
FT                   /translation="MPPSSLQAVLTDEQLADFTELATRLERIFTGEAKDKESLFFAGVF
FT                   MQTLHLSPKDVERLRHARDCKLLDMLSRSMIVFPEEPIKFFHHYDCEVRRVQPEPGTCT
FT                   ILVPPCDLVLSGNGENRPLAQGSEVLGVVSPESLIFVLAVTRPSGELYQFIDISMRSTL
FT                   ESLRTSRQYTGGGMSRLILQFDVDDSLSVNGKRQISGGSTLSLSSRHDLTDLHTAIEPN
FT                   GKQMKRQSTDLSTLTRVSSSIIISLDTNDDDDDDDASGPFDHSQARFENEEQSLVYCLR
FT                   SNGNLPESKSCESQTTSGTHDRTVLSQQFESARGIMGDNLQGFRPFSFNHNVPNQQGCE
FT                   WPSLAFERKSPGRNMIEEGGNPLTLKVHSDNSAENQHRGLFDCALSETNTGSWKKSPPH
FT                   VHTSRSQVPEESDAGWLPSRTSRPRPRRHPQKRGLTSSKRARGNMPDTQESPIFPMRHS
FT                   TRKIYAHARTSVDWDEDLRPSDEPEKLESQKSIGVTSISSPFPGENFIFGQTSSTGTKR
FT                   KSKRKTSFCKRRKTSRKTGRDTGKGRHEIEESGLGQESDLKGTVDATYMPEVNAQSETS
FT                   KGSHTKADRASMDDSDEECPPRQLESLTDEAPEAALVAVMEVSGVEQSVAFLMDQAQEI
FT                   GCPLIFESSRGTGDQHASQRSNPQIQMPSSNYEGDIISYPDFEEGELGGRGAVVGKKLA
FT                   SAFHPDCTFYLQGEEKEDDNTIRDGVTGSVDKEDDESHAMSASALQHNDFETRAVKVQS
FT                   QAAMGSRTNRTTHLSPDSAQAVAEKQTSREYPGSIQQISSTRLTRRKSRVVQTEKNNAS
FT                   RKKKAQTKPSTVASSEKENQADEIECQSQEICGLGQRKPGLYALKKPGHGNRRAQTSTR
FT                   ERERVTSGYHSLKLIHRIQKPEEGNSSDSDNPKILSRTKTIPRLTPRKAIVDNNGSPRL
FT                   VSRHIAGSQCSTHANLNFTQRSGKLMRAGMNLVSQRSSESGYEADFDEQLEQIPLETHE
FT                   ISSFRTKMDAHRDKYVHRNCETATHEELSENPVTGCREGLVASKVVTASGKEFMMRFST
FT                   KPPKKSPRRLDRSNAEGDGPTQLSSKEEGCFIDSSCDPTEMSPRSEELPRQADLVSSLQ
FT                   SLYESAHDMLLITNEHLLHGLDKERAAINTFLNSYRQQYNRVLDQLVTRQEERIRLCKQ
FT                   HMKAIKSHHSALCQELIHRLQEHEQRLLKDLSEED"
FT   CDS_pept        join(621945..621950,622018..622072,622136..623041,
FT                   623101..623264)
FT                   /codon_start=1
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269309"
FT                   /orf_name="AFUA_1G02110"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="EAL87923.2"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG000409"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000F51AA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK9"
FT                   /transl_table=1
FT                   /translation="MSFFIENPNVGNSDHLEDSRIRGYNPLTPPNLLQHEIAMTEKSRQ
FT                   TVLEARREAVAIVHGTDTDKQRLLVVIGPCSIHDPDMALEYCDWLLKMKEKYNDELLIV
FT                   MRAYLEKPRTTVGWKGLINDPDIDNSFKINKGLRTSRQLFVDLTNKGMPIASEMLDTIS
FT                   PQFLADCLSVGAVGARTTESQVHRELASGLSFPVGFKNGTDGSLDVAVDAIGSVKHPHH
FT                   FLSVTKPGVVSIVGTVGNPDCFVILRGGKKGPNYDAQSIAEAKAKLTSKGLPPRLMVDC
FT                   SHGNSQKNHKNQPKVAAVLAEQIAAGETAIMGVMIESNINEGNQKVPPEGKAGLKYGVS
FT                   ITDACINWEDSEIVLETLAQAVRSRREKLAVNGASQ"
FT   CDS_pept        complement(624468..626594)
FT                   /codon_start=1
FT                   /gene_family="HOG000212993" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752272"
FT                   /orf_name="AFUA_1G02120"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87924.1"
FT                   /db_xref="HOGENOM:HBG051359"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051FB19"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK8"
FT                   /transl_table=1
FT                   /translation="MMSTMLSRPAANITPPEVLLQIFYLLNPRDFDNARRTCSQWMRAS
FT                   LDKNLLESMLKRAGWWDAWKQDCHNYRVDPSASEQSLVWRMSRRFATECTLSGSKSNVE
FT                   RAGFLTTGVVDFSRLSQGQSLAKHGASAPHSVAGSVMNPDSRPLATSRFHVSKCANYLL
FT                   VTSGRMIYVYHLLYRKSGSDVFTTMDALTDLDIAPVTSIICPVEVISASIDTSTPRIVI
FT                   AALLRDRLGFVCDLNASSERSSAQSEVMQLLDPSFIHYFRDICSPEDPPRSVSICPGRR
FT                   CVAFGSGTSIELHWVDEKTRENRRKRFPMSQPSEILHFLPNRPETPMEMRLISSLAGPG
FT                   MPGCECHKVSYGEMRAPCQLHLLTDVQSLTRWTPSNNDSLSIVRATHCHHYRAIPINDG
FT                   LHILFIEPRTGLLCIGSDAPIGGPTSLTQALVCVPPFGKDCLNVSKDDLAPTVFASGWN
FT                   LDWGLRVVAAYGDRIVLYSVPVDVYNVIRKERERQGDGVMGDSDLARDFFLDNSRSAKR
FT                   RDSLVQDQSGDWEFLLSVSWRPTVMMWPFKIYGKEIARMENVAELALQSAFGGARVWAF
FT                   GANGETNIIDIDTFSSSNQQSFSIPCKSVTIAADGNIASAQWVDRSDSWLLSSESSSKR
FT                   KLSDSREDFGGQQSAICPLPRFLHEGYVPTNTILPPALPGAAARRPSFAACIVDFKIPE
FT                   LGQRECTWVDGACA"
FT   CDS_pept        join(complement(631749..631922),complement(631528..631692),
FT                   complement(630298..631465),complement(629243..630243))
FT                   /codon_start=1
FT                   /gene_family="HOG000212982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269310"
FT                   /orf_name="AFUA_1G02130"
FT                   /product="DUF221 domain protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87925.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051360"
FT                   /db_xref="HOGENOM:HBG395921"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI000051E7FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK7"
FT                   /transl_table=1
FT                   /translation="MSLTESAVTALGTVAAATAVETGDHGRRWTDQTKNQRDTYTQLVI
FT                   SLVLGLSAFMSFCILRPKWRELYAARRRQRCAAFHLPELPDTFFGWMPVLFRITDEQVL
FT                   NSAGLDAFVFLSFFKFAIRFLSIVFVFAVIIIGPVHFKYTGKYGMPDWDHDDGDDGKDG
FT                   KKKLISDPNYLWMYVVFTYIFSGLAIYMLLQETNKIISIRQYYLGSQTSTTDRTIRLSG
FT                   IPKELASEEKIKEFMEGLRVGNVESVTLCRDWRELDHLIDERLKILRKLEWAWTKHLGY
FT                   KRPKHSENSISLTRQQPRGSSLLSDGDSEHTQLLSESGRAHISEHVQRRPTIRLWYGPL
FT                   KLRYRNVDAIDYYEEKLRRIDEKIQAAREKEYPPTEMAFVTMESIASSQMVVQAILDPH
FT                   PMQLFARLAPAPADVVWKNTYVSRPRRMMQSWFITGVISFLTVFWSVLLIPVAYLLELE
FT                   TLHKVFPQLAEALARNPILSSLVQTGLPTLVLSLLTVAVPYLYNWLSNQQGMVSRGDIE
FT                   LSVISKNFFFSFFNLFLIFTVFGTATTFYQFWETLRDAFKDATAIAFALAKSLESFAPF
FT                   YINLIILQGLGLFPFRLLEFGSVALYPFLFLSAKTPRDYAELQTPPTFSYGYSIPQTIL
FT                   ILIICVVYSVFPSSWLICLFGLVYFTIGKFIYKYQLLYAMDHQQHSTGRAWPMICSRVF
FT                   LGLIVFQLAVIGVLALRRAITRSLLLVPLLGATLWFSYFFAQHYEPLMKFIALKSIDRN
FT                   RPGGGDISPSPSSTFSPPSGLERDALPIQIGGQQLGLRLKKYVNPSLILPLDDAWLPGH
FT                   SATREYQGAFDAHETRNGNGSAV"
FT   CDS_pept        join(complement(636976..637193),complement(632299..636919))
FT                   /codon_start=1
FT                   /gene_family="HOG000212981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269311"
FT                   /orf_name="AFUA_1G02140"
FT                   /product="Glycogen debranching enzyme Gdb1, putative "
FT                   /function="amylo-alpha-1,6-glucosidase activity "
FT                   /function="cation binding"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="EAL87926.1"
FT                   /db_xref="GO:0004135"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG028245"
FT                   /db_xref="HOGENOM:HBG447348"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F61C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK6"
FT                   /transl_table=1
FT                   /translation="MASPQQVYLLPLKDDGSPDVPGGYIYLPPPSDPAYLLRFVIEGSS
FT                   SICREGTLWVNIPEAGKPFDRSAFRSFRLEPDFNKNIQLDVPVTCSGSFVFYTTFTPLP
FT                   QFSVDPVPTPEPARTPDYYVDVAPRLTLRGKDLPLNALSIFSVLSKFMGKYPTDWDRHL
FT                   NGISQRNYNMVHFTPLMKRGASNSPYSIFDQLQFDDGAFPNGEVDVAQMISKMEKEYGL
FT                   LSLTDVVWNHTAHNSKWLEEHPEAGYSVETAPWLEAALELDTALLKFGRDLEELGLPTE
FT                   FKTVNDLLAVMTALQEKVISGIRLWEYYVIDVTANAGHILENWKASELKHSASKKYAEV
FT                   DISGFKDRPLKQQADLIRQHAIPTIKQVLGRFGRALDPEFGSLVLTAMFGKYDSSNSDI
FT                   ASIEKALVTILDEVNVPFYEEYNADVSEIMNQLFNRIKYIRIDDHGPKLGPVTDENPLI
FT                   ETYFTRLPLNDITKKHSPKALALVNNGWIWNADAMRDNAGPESKAYLRREVIVWGDCVK
FT                   LRYGSSPEDNPFLWDYMAKYTRLMAKHFSGFRIDNCHSTPLAVAEYLLDEARKVRPNLT
FT                   VFAELFTGSEEADYIFVKRLGINALIREAMQAWSTGELSRLVHRHGGHPIGSFDVELPS
FT                   AGSSHAIASAGVNQNQEKISHIRPCPVQALFMDCTHDNETPAQKRDARDTLPNAALVSM
FT                   CASAVGSVMGYDEIYPKLVDLVHEKRLYFSEFSQSAEVRHDCERGGIGGVKKLLNELHA
FT                   MMGVEGYDETHIHHDGEYITVHRVHPKTRRGIFLIAHTAFPGHSTNAVLAPTHLVGTQA
FT                   KHIGTWNLEVDASDSMRAVILSDKDHLRGLPSRIRKFEGTKAEQQGDDTVISVLDTFAP
FT                   GSIALFETSIAKAEHAAGLENNITEGVDEAFAELSLVDLNFVLYRCDAEERDLSGGQDG
FT                   VYNVPNHGPLVYAGLQGWWSVLEDIIKYNALGHPLCDHLRHGHWALDFIVGRMERAAKK
FT                   EGYTALEKPAKWLHEKFQAVRDLPSFLLPRYFGIIIQVAYNAAWKRGIQLLGPDVRQGQ
FT                   EFIHQLGMVSVQVTGLVKSASLWPTKTVPSLAAGLPHFAVDWARCWGRDIFISLRGLFL
FT                   CTGRFDDAKEHILAFASVLKHGMIPNLLSSGKLPRYNSRDSVWFFLQAIQDYTKMAPNG
FT                   IEILNETVARRFVPYDDTWFAYDDPRAYSKHSTISEVIQEVLQRHAHGLSFREYNAGPD
FT                   LDMQMKPEGFQIDVKVDWETGIIFGGSQHNCGTWQDKMGESGKAGNKGVPGTPRDGAAI
FT                   EITGLLYSALTWVARLHERGLYPHDKVDIAEGRSITFKEWAAKIKQNFERCYYVPESPE
FT                   EDGQYDVDPSVVNRRGIYKDLYKSGKPYEDYQLRANFPIAMTVSPDLFTPSKALGALAL
FT                   ADSVIVGPIGVATLDPSDLNYNPNYNNSEDSDNFATAKGRNYHQGPEWVWQRGFFLRAF
FT                   LHFDLERRKTAEERTEAYQQVTRRLEGCKRALRESPWKGLTELTNKNGAHCADSVRCLP
FT                   YLLYFHTRKLMQFCYSVPLSHGRQVAYLTYIMTPPDMEFCERSFDIDDLLKRIGYTVCI
FT                   FKVDKVMISVYHRRYSQSHTFISFMEVVHYLCA"
FT   CDS_pept        join(complement(639350..639411),complement(638150..639282),
FT                   complement(638033..638088))
FT                   /codon_start=1
FT                   /gene_family="HOG000246855" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269312"
FT                   /orf_name="AFUA_1G02150"
FT                   /product="Glycerol 3-phosphate dehydrogenase (GfdA),
FT                   putative"
FT                   /EC_number="1.1.1.8"
FT                   /function="NAD or NADH binding"
FT                   /function="glycerol-3-phosphate dehydrogenase [NAD+]
FT                   activity"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="glycerol-3-phosphate catabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="EAL87927.1"
FT                   /db_xref="GO:0004367"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0046168"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289569"
FT                   /db_xref="HOGENOM:HBG586392"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="UniParc:UPI00005201F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK5"
FT                   /transl_table=1
FT                   /translation="MGSLSPHLRKHKVAVVGSGNWGTAIAKIVAENTASNDSLFERDVE
FT                   MWVFEEKVEIPKNSRHYDPSSPLCQGPQNLTEIINKTHENVKYLPGIALPENIHANPSV
FT                   VDAVKDSTILIFNLPHQFINKTCEQIKGKILPYARGISCIKGVDVTEEGVSLFSETIGK
FT                   TLGIYCGALSGANIANEVAQEKWCESSIAYDPPHLDSKAPSPNRSPSASTVDVVHFEHK
FT                   DVSGQLSQVKLQPLPSEYPPIDHTVLKTLFHRPYFHIRVVSDVAGVSLGGALKNIVALA
FT                   AGWVDGMGWGDNAKAAIMRVGLLEMVKFGEKFFGATIDTRTFTEESAGVADLITSCSGG
FT                   RNFRCAKLSIERKQPIDKIEETELNGQKLQGTLTAVEVNKFLKKQGLEDEFPLFTAVYR
FT                   ILEGSMSVESIPSYIER"
FT   CDS_pept        join(639720..639872,640226..640774)
FT                   /codon_start=1
FT                   /gene_family="HOG000212960" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208977"
FT                   /orf_name="AFUA_1G02160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87928.1"
FT                   /db_xref="HOGENOM:HBG051361"
FT                   /db_xref="HOGENOM:HBG330069"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="UniParc:UPI000051F61D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK4"
FT                   /transl_table=1
FT                   /translation="MDKGGFGARECGSSCPDSESAARVLREIEISQVDSVQFFGRHEKY
FT                   FTIYVAVCYLKAPIRPNKKSTAATNKLSGGKGAVPSTKSAYFEDDFRTTKRDKRIIKHA
FT                   SFVSKIEKSSQKTPKRRRASKKLVANLESLADALPETETEKNDSSSQVNIIKQKTLQHK
FT                   PGAMKRRQKLEKVERDRFAKNMAQMATIQTNVQPVAETQNEASSISNRWAALRNFISQT
FT                   MEQQPAFKAKP"
FT   CDS_pept        join(641329..641555,641791..642080,642134..643533)
FT                   /codon_start=1
FT                   /gene_family="HOG000010093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269313"
FT                   /orf_name="AFUA_1G02170"
FT                   /product="ATP-dependent Clp protease, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="peptidase activity"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL87929.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG001500"
FT                   /db_xref="HOGENOM:HBG745965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI000051EEDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK3"
FT                   /transl_table=1
FT                   /translation="MCRNLSFSFLDSSVLPFTAFSDLHGAIFLGRVTSCDGPSDTVGRY
FT                   ITHVLRGKLSIPIILSASSSLLRQISRAKLASDFTNQPWSSIYEAGLPTAGPLGSTPAF
FT                   GAPRITPKTLKQYLDQFVVGQDRAKKILSVAVFNHYQRVQELQRREEEKAELLARQARR
FT                   EALEHHPAEDEFPGQQRTVHLPTSPKSTTSNEALLSDSSPLQLEKSNILLLGPSGVGKT
FT                   LMAKTLARVLSVPFSISDCTPFTQAGYIGEDAEVCVHRLLAAANYDVEQAERGIIVLDE
FT                   VDKIAAAKVSHGKDVSGEGVQQALLKIIEGTTVQVQAKQERNAHRTSGTPSSYPSNNPF
FT                   GNSPFSQSPTGNAPQKGEIYNVRTDNILFIFSGAFVGLHKVIMDRISHGSMGFGQPVRS
FT                   QSSPTHRPGDPLATTPNQPVPILPGSEEEALYKKHLPFFTAASPTSPDGEPPYFNALDL
FT                   LNPTDLQNYGFIPELIGRIPVTAALSALSQPLLVRILTEPRNSLLAQYTTLFSLSGIEL
FT                   RFTTPALHKVAANAFAMGTGARALRTEMENILSDAMFETPGSSVKFVLITEAVADRKER
FT                   PIYLSRGQGGRFHSLIAAEESKWEEKVRREKGEKEKRTKGQGSENQPSIASFREYRTRA
FT                   AGF"
FT   CDS_pept        join(complement(646202..647809),complement(645031..646073),
FT                   complement(644531..644881),complement(643901..644477))
FT                   /codon_start=1
FT                   /gene_family="HOG000212949" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269314"
FT                   /orf_name="AFUA_1G02180"
FT                   /product="Chromo domain protein Chp1p, putative "
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87930.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="HOGENOM:HBG051362"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000051FD89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK2"
FT                   /transl_table=1
FT                   /translation="MSDDDDISITSTAPSEQESEYEVETILAELEFDDGIKYLVKWANY
FT                   PIERCTWEPPESFCNEQTLIDWNKKKNSIAEGKRPAFDLVSFENHLAALERAKHDRKQR
FT                   RAAKRRRLGLDGAPQSHPAAESPSSNNVPDPRIPGDTGFNDIEVDRSKASSGQTPRTNA
FT                   STGSAQLQTQQLPKRPPPPVLFGTAPAPTRPKRMNSSETPKLFNLSTRWKYEKAKTYEP
FT                   PPDVNKLQLIRPSDWPARTGLTATKTGLYSVNRPSTENDANTARLGSHKVVSPTRDDSR
FT                   SAKLGTYDVSSPNESDLSSVKAGSHDLNSSKQSNASLVNLGLYNVSSPKSVTWGRLATN
FT                   NVNGSHGISDSALDPQSQDVSSPMDLDSDNETQGQISQTREDWALSSPKRVQDGSYKPN
FT                   DSIPDTYRPACGADTWIPARPLQDSWCASHDSVKPDTIPPIHRQELEDYPIRKLPTREP
FT                   KPGAYIVKSQQQYFWNPGELLVYLYYGLEKKEIGSARLCGLSPESRSRLMSTKRGSRIN
FT                   IWFQHTCNLEEYNVLCENTRNNHKYSDAWLEGFDDTEPSIYRIGEELRRNELVAISYPA
FT                   PDSRMSNVLLAYSPKSSDFAFLNADSAHFRTSEDVFLNVAVRSQLRGFDTITARRERKR
FT                   LHAGSRKPVPFALINTSDPPSRATPTGALATRPRSVGVPDVSAPEAARPVNDMSNHPIH
FT                   ISRDSDVLLPKASAAPDVAKPSDAANHLGSTNTTSVTPELSTQHSGADNLHAAPQNTLR
FT                   ELELVNVAVQDPAQQTGELLSTSQVPLPKHRTPQAATETSPITSEARTAPEAAPGFPRL
FT                   GRHDASMAQSIAGNVKSPSQPSENILDLDAVFKEQFGVTYDLLATVNDAEKPTKAQVFY
FT                   LMFPAGSEVVQEDCADSVKAHESFMNYHALPFIKDLIHRNVSFWSLSLRTPLQYADHPT
FT                   YFQRLFPHGGVILITEDFMLRDPDATLIILAWLKDWIKQKFPGSWKIMFRPNILDWLLK
FT                   QSESKDPFRQGIWLSMYALILQLNSRVASTERTSGNNLSGASGEHNEDPVISLDAIPLY
FT                   GSPTEDDDADIHKGLTQEQRNADHLGEFFAGWAIVNNHRFRRFVMLTAVKPLPRWEAWQ
FT                   HIEIRYGAKDFMKTFKVEYKTYWDKVKPRLGKPGLSSEAKSQNHNPAYTPRTPGANGPS
FT                   ADGLDVSRAGEFSHGPSRLKYPQPYQ"
FT   CDS_pept        join(648793..649198,649264..649344,649398..649525)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269315"
FT                   /orf_name="AFUA_1G02190"
FT                   /product="Ras GTPase Rab11, putative "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL87931.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015595"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000051F164"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK1"
FT                   /transl_table=1
FT                   /translation="MTVLTVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRSI
FT                   QVDSKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDISKHQTYDNVNRWLKELRDH
FT                   ADSNIVIMLVGNKSDLRHLRAVPTDEAKQFASENNLSFIETSALDASNVELAFQNILTE
FT                   IYRIVSSKALDNGDSGQAPLSSGRTIEVSKAPDTESKQGCC"
FT   CDS_pept        complement(650905..651978)
FT                   /codon_start=1
FT                   /gene_family="HOG000212938" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904387"
FT                   /orf_name="AFUA_1G02200"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87932.1"
FT                   /db_xref="HOGENOM:HBG051363"
FT                   /db_xref="HOGENOM:HBG330066"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000052068A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKK0"
FT                   /transl_table=1
FT                   /translation="MDRLATELLLHIFRSCESVSDVLNLASTCRRLRRVFNQSHKLQIL
FT                   IDVAEFEFGPLDEIIQLVTHNASQPAHIPRRVPMSESLLRQVVQVGLVARKWEAIYPVK
FT                   KWKVDFENRRSLTDDERFRLRRAIYRLWLYHRAFHTSNFDRFSRKLRHVISERAQLLHN
FT                   WSTVELAEVEDIRLIITDIVQNHICPSNGTIQRKFRKRYPESNHQLSFDIHLNYPRTST
FT                   PAGLPEWPDKADHTVNHYFYSAHPTSITESPAKYRSRFRNDFFHDPGFEGWGDEIPHYY
FT                   VVQDMMKLDPGQVLWLREHAPMKEQVEAFIRSLGDWFRDNGETFGDTLQWVMNERGDDI
FT                   EEFRAAIADRELGIVCP"
FT   CDS_pept        complement(652793..653923)
FT                   /codon_start=1
FT                   /gene_family="HOG000212937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269316"
FT                   /orf_name="AFUA_1G02210"
FT                   /product="60S ribosome biogenesis protein Brx1, putative "
FT                   /protein_id="EAL87933.1"
FT                   /db_xref="HOGENOM:HBG112663"
FT                   /db_xref="HOGENOM:HBG526758"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000051F88D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ9"
FT                   /transl_table=1
FT                   /translation="MAAVYKTVTKKKPRQIAEDQDEVDVEMEDLLAGADDTSDSDEDED
FT                   EHTAESAKKQLAAGFMPKTRVLMLTSRGVTYRYVEGFRELGLTFQTLTSDSSHRHLLSD
FT                   LCALLPHTHKESKLDTKKKTAGYNLLLNSLADLHSCNVIFFLEARKRGQDLYLWLARPP
FT                   NGPTIKFHVTNLHTMGELNTGFSGNCLKGGRGIVVFDRSFDEQGPVMSSPGNEYRGLIR
FT                   EMLRGVFCVPKRGVKGMKPFIDRVIGVFGVDGKIWIRVYEIRESEGGAKKDEENSKPAP
FT                   KGKNAEPEISLVEIGPRFVLTPIVILEGSFGGPVIYENKEYVSPNQVRSEIRLSKAARY
FT                   AKRRDVQTNLISKRSTLGLAEGERKPGPLDNKSLFS"
FT   CDS_pept        join(654913..655048,655306..655481)
FT                   /codon_start=1
FT                   /gene_family="HOG000048320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269317"
FT                   /orf_name="AFUA_1G02220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87934.1"
FT                   /db_xref="HOGENOM:HBG051365"
FT                   /db_xref="UniParc:UPI000051F157"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ8"
FT                   /transl_table=1
FT                   /translation="MHANVTSGIRPYNLNMSILYALQKMKVADLKVKPGSSGANLICNC
FT                   SPPGCSDSFLRGDERYEKHATSRLLPGSEELCVDGKLLLVCQEDAGDEFPTNVKIVSA"
FT   CDS_pept        join(complement(656332..656708),complement(656092..656194))
FT                   /codon_start=1
FT                   /gene_family="HOG000217103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269318"
FT                   /orf_name="AFUA_1G02230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87935.1"
FT                   /db_xref="HOGENOM:HBG051366"
FT                   /db_xref="UniParc:UPI00005208FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ7"
FT                   /transl_table=1
FT                   /translation="MVSAKRKGLEGEDDSASHRQKMAPGRKRGAKKPKTQSSAPAQSTS
FT                   AAADGSELPQTHASVAFSDQELQSPETPTPQPSKFWTNELRIALLVAVLKELDQTISEK
FT                   IWHQVAETLRPMKPNISWNGARLEVGRLKRENFPNTTSAPSGQPNQPAQNSNDED"
FT   CDS_pept        join(complement(658524..658664),complement(657846..658463))
FT                   /codon_start=1
FT                   /gene_family="HOG000212905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752273"
FT                   /orf_name="AFUA_1G02240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87936.1"
FT                   /db_xref="HOGENOM:HBG051367"
FT                   /db_xref="UniParc:UPI000051E5A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ6"
FT                   /transl_table=1
FT                   /translation="MPASRIRWDDWKDKVMLMAVFEQMNMTSPDFKRVSKVMCGDYSAR
FT                   FEKPLQGLNKEAAAILRDRQRHAELREMTDEILPMMSGAVNSPEDKDVLVVREVTLRSE
FT                   LTPPASEQSPSMQSRRCPQQTERVMPEVITPNSQPSSIGRHTQSSGVQYQHHTSSEYDP
FT                   NVHPARRPRCSHEATSTAGPYTHPRSSPQIPSRGRDFPRGQQERGWDQTLRTKNTGGRS
FT                   FKPRNKNNRQRNFPQMTRVEINHGPVHTRF"
FT   CDS_pept        join(659966..660058,660127..660693)
FT                   /codon_start=1
FT                   /gene_family="HOG000212893" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057635"
FT                   /orf_name="AFUA_1G02250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87937.1"
FT                   /db_xref="HOGENOM:HBG051368"
FT                   /db_xref="UniParc:UPI000051E584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ5"
FT                   /transl_table=1
FT                   /translation="MSTVRRSKAMPTDSPTAKFLYTIIKQLDLKSIDWNLVASQLEISN
FT                   GHAARMRYSRFRQQMEGISSTPRASRPRKTPTKTGKGFASKADMLKDKGSPKPPVKQEN
FT                   AGPAYESNPYIKVDPYGHEVQNLADIPHVSTQVMHPQPIQPQIVPYTPLTAAPGTLTMY
FT                   APVPAFPPSTPVTFHQQAGPSTWAPIKTEPEHEPELEAGGKANDVLVKVELPQKEQ"
FT   CDS_pept        join(661446..661541,661609..662079)
FT                   /codon_start=1
FT                   /gene_family="HOG000212882" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269319"
FT                   /orf_name="AFUA_1G02255"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27327.1"
FT                   /db_xref="UniParc:UPI0000F51A94"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9R8"
FT                   /transl_table=1
FT                   /translation="MSANPETNGGDISSADAHFIIECLKNLNGSKQVDIGKVATVFKYS
FT                   NVLSARNRLRNLSKRYGFPNLECRFPSTPTKAGKAGAIVEAAKDDTAGDDPSSSGETVQ
FT                   STPSKPARKPAGRKGAKVNSKPIPATGPVSADGSTSPSKKRGPRGKGKLAVAQEAAVME
FT                   SVEIPVKKDNGNVKMEDGGAIKVEA"
FT   CDS_pept        join(662922..662993,663046..663098,663155..663500)
FT                   /codon_start=1
FT                   /gene_family="HOG000212871" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057636"
FT                   /orf_name="AFUA_1G02260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27328.1"
FT                   /db_xref="UniParc:UPI0000F51A62"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9R9"
FT                   /transl_table=1
FT                   /translation="MAPANPDETVKFLLSCIRYSNSGKVDFNEVAKACNIVSRGAAAKR
FT                   YERLLKAYIESANTGATAKAGPPKKSKAKGAGESSGSSSPAKRKPAGESSKGRAKKARM
FT                   LKEGVLESAHRMIEQRLSPVKEEEGSDAEEEKAQGANADATAVDDETLLGQF"
FT   CDS_pept        join(complement(665777..666424),complement(664029..665723))
FT                   /codon_start=1
FT                   /gene_family="HOG000212860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269320"
FT                   /orf_name="AFUA_1G02270"
FT                   /product="ARS binding protein Abp2, putative "
FT                   /protein_id="EAL87939.1"
FT                   /db_xref="HOGENOM:HBG051370"
FT                   /db_xref="HOGENOM:HBG330060"
FT                   /db_xref="InterPro:IPR018562"
FT                   /db_xref="UniParc:UPI000051F16D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ3"
FT                   /transl_table=1
FT                   /translation="MESSFTSVIPQSEPNDIGGTPAVIQQYARYSSTLEPGLQSGSSLG
FT                   SARSRLGASKSPPLHRKATPRSLQSSPTGLRPVAPATSATRSGPSMSPPVYDTVRQRQA
FT                   REPMDQAVSRGLPSRDIRDETIDDAYVSFILYCNPNVPMSTDTTELRKTFRSPPRSDGK
FT                   SFSIFTLWELIRKLDNKELKTWIQLAIELGVEPPSAEKKQSTQKVQQYAVRLKRWMRAM
FT                   HVDAFFEYCLGHPHPYYTQLPASNAAVSDTRDGVPLEEDLALRALVPEWKPKRGRKRAD
FT                   EREQANEKPTKRPQLDTSVGVLQAGSFTDQSATFPQSAIPFSAFPDNDPWMTAASSFPA
FT                   DGSTDNQQGQELRWRPLERDASPAGYPQSAIIPRGHHPSEVLLPTAEPRSAIDPSSGEK
FT                   SRSRRRHGPAVSSAWPNSNASITGKTRGRPPQRGVVSGPFSTFPVNPSRTDSRPSQGPG
FT                   SRSSPAMVVERNSTTRADSQYQQSPTPFPHATARPNKLQLQVPQHLGGPVRLATPPTLM
FT                   VNGMSTPSASLKVEPSHRNGSSAHSSDFFGGSTVQNVMPHTNTNSLSGNNATLDISLDD
FT                   VARVLSDELLRAKLTGRAVPLSAEEARALAFSILRRLSANYMRLPSGLSALASALYLGL
FT                   GAHFGFTNPVLSSMTVNVERVPVAAGEGPSMAADRTSPNLTYTISHEYRHDSQFSTKVV
FT                   YSDTGISTTDVSKPEGSSRMTEDMDNSVIELDSMTDADYEVDGAESTASEMTWKQRYMK
FT                   LRAQMQKRERSLSQYKRKILESVMADI"
FT   CDS_pept        667288..669402
FT                   /codon_start=1
FT                   /gene_family="HOG000212849" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904388"
FT                   /orf_name="AFUA_1G02280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87940.1"
FT                   /db_xref="HOGENOM:HBG051371"
FT                   /db_xref="HOGENOM:HBG330058"
FT                   /db_xref="UniParc:UPI00005201E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ2"
FT                   /transl_table=1
FT                   /translation="MSSSMRSSRQRISSLSRPIRTSRTRVQSYLEDSSSDDRLDEDTDS
FT                   DQERSRRMSLSLRPRSSNRAPVSYREESTDDDFERSSNEDHSAVAPVEAPTRYTYPFPQ
FT                   SAGNGTSSRPKRNRTVKTRSQTSKSKRPPAKNRLELGRPLNKRPKVQADDMLPIGSGVI
FT                   PPWHTLPYHILFDIFFRASFPLMDEKTTTRNSSTQWLVSVALLCRAFHEPALSALYHSP
FT                   PLIPIKCHALLNLLCQPQETLSTNYRNKIQELHIDVEILLLHKSGPTLGYFDLPKLIEK
FT                   TPQVKKVRLYHKDDFIVGLAPWQIQRSKWVYPESLFESINTSLIHLRSWDWNSRFMEAK
FT                   QLIPFLLGKHHDQAFRGLRELRLLHVASEDIDHDGSAEPSNEREVILATAIKELPYLRR
FT                   LEFSECSIVNEHLLLNMPSALTSLTINNCDEVTTSNLSAFLAAHGQHLRELNLNHNRHL
FT                   SMSFVVGLAEYCQVLERFKMDISMHDWSSYHDVEPHFRELLGPSEVPTWPSTLQEIELI
FT                   QLRKWDDMTAEVFFTSLIDSARELRNLRRLIISAILKIGWRDRATFREKWIGRMERVFL
FT                   RRSPPPNPDLRSLRKGTPQLELNDAATQSETHHSGLSTPSKRKSARLAKRKHSETEDNM
FT                   ELSAPDRASDGGDGDLFIQGMCDIVMVRIDNLRPTELQFNEQDFLDDELSGDEDWNGND
FT                   FDATAAGHAW"
FT   CDS_pept        join(complement(670180..670312),complement(669933..670120))
FT                   /codon_start=1
FT                   /gene_family="HOG000185320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269321"
FT                   /orf_name="AFUA_1G02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87941.1"
FT                   /db_xref="HOGENOM:HBG051372"
FT                   /db_xref="HOGENOM:HBG323981"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI000051F89F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ1"
FT                   /transl_table=1
FT                   /translation="MSFHLTAEDIRIEDGHRLVARLRNADGDLQDASIDLNTCLGNDNG
FT                   HFQWDGVDFSHSAQDVHFAIEGGGQVPVLRAQLANQDGEFQDADVNLSERIENINGEFV
FT                   FH"
FT   CDS_pept        join(675170..675322,675419..675595)
FT                   /codon_start=1
FT                   /gene_family="HOG000212827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269322"
FT                   /orf_name="AFUA_1G02300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87942.1"
FT                   /db_xref="HOGENOM:HBG051373"
FT                   /db_xref="UniParc:UPI000051EC95"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKJ0"
FT                   /transl_table=1
FT                   /translation="MTWDHEADAKVRLSLTRSINTNADRNSFSSESSPPVTSSSTTKTL
FT                   PNIWDPRRLQRLRTDPRAGSATNGDSSTPPTPEKRKRGCAKKDANGDGAEKDKASPKKA
FT                   KKAKK"
FT   CDS_pept        join(complement(676773..676875),complement(676134..676708))
FT                   /codon_start=1
FT                   /gene_family="HOG000212816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269323"
FT                   /orf_name="AFUA_1G02310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87943.1"
FT                   /db_xref="HOGENOM:HBG051374"
FT                   /db_xref="HOGENOM:HBG330050"
FT                   /db_xref="UniParc:UPI000051E585"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI9"
FT                   /transl_table=1
FT                   /translation="MRLKTDTRTQTQLLLKILETHDLSVDTNKVAAAWPGTDDNDKPTP
FT                   RAIRERLVKMRQIVKASGSGGFTIGGSDTSTPKKAKKTATPVETPGSKRKRSGKAGTSA
FT                   DDNENITPLKNKENETSLVKMEAAEDEIDTPTKKKPLHPTLSGNQVQVQSGFVKTEESD
FT                   EAVFGILTTPTKRSRKASVLPAGMVNYEDDEQGEDDPESSASEFLPDEAGVKMEDMDTM
FT                   NYA"
FT   CDS_pept        678389..679078
FT                   /codon_start=1
FT                   /gene_family="HOG000212805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208978"
FT                   /orf_name="AFUA_1G02320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87944.1"
FT                   /db_xref="HOGENOM:HBG051376"
FT                   /db_xref="UniParc:UPI000051EC63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI8"
FT                   /transl_table=1
FT                   /translation="MATLFGQGATYDAIEGRFRRYRKMADDVKADALSRGITELPRGRN
FT                   GTTSSTSSSLTPRTPRGPRGGITKPSSSTGKSRKSTVSQVLSTPTKRGQGRGGSNNSNN
FT                   ASGMSFMEAIFLDGGLSEEDKKVKSEAAEILTGLVGNSAVVYDLTSASTPTASSASITS
FT                   MKMEDAAESFSSAFGDAVKQEGRGIGHVTGGDIDVPAIEHDGFDMAGLYFHGHGGYGMD
FT                   DIYGGAA"
FT   CDS_pept        join(complement(680570..680685),complement(679969..680506),
FT                   complement(679650..679910))
FT                   /codon_start=1
FT                   /gene_family="HOG000212794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904389"
FT                   /orf_name="AFUA_1G02330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87945.2"
FT                   /db_xref="HOGENOM:HBG051377"
FT                   /db_xref="HOGENOM:HBG323856"
FT                   /db_xref="UniParc:UPI0000F51A55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI7"
FT                   /transl_table=1
FT                   /translation="MESSPSSSPFLEAVSAVSQDEETPQRFLASISQEWTTQHSVLGGF
FT                   LHALMLSVAKKFIVTELGDGRFPDPVHAFVQFLSMVPPGPVSITCKFLRVSKRQCVVNV
FT                   ELVRSSAALWKKPELPATVGIFTYGDLSKERGLSQASDPALRIPVPPRETECVTIDDPV
FT                   VDSTPVTRKLHWLAPRSANGLWGHRLGGHNREVWISFRDGSKISDCLHLALLSDMPLQP
FT                   AATHQPGFYNHYALSTLCISVEFKQRPDPSTQWVMIRSNSHMVSNGRYDVNLQILAENG
FT                   EILALSNHVLYISELRATKGAKM"
FT   CDS_pept        682116..683450
FT                   /codon_start=1
FT                   /gene_family="HOG000212782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269324"
FT                   /orf_name="AFUA_1G02340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87946.1"
FT                   /db_xref="HOGENOM:HBG051378"
FT                   /db_xref="UniParc:UPI000051F61E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI6"
FT                   /transl_table=1
FT                   /translation="MMLSPAPQHRSGLTPQSPFHHDLHNHHHQHHHNPSASTSKPPSMV
FT                   VPSTQIQEPAQLPTPNQSGPTTMPTDEDGNDGLPQDFSGRGKRLTLEEQKSLFRLCEQY
FT                   MNRYDAHEYPKSFWMKISELLLKSTGRKYSWQSCRRRMQQYVEKRKTYWAAFDADKTLP
FT                   DLGDMDEDLASDIDDWMGRCELRLQNEEKERRDKAQKTELEQAELARALKLQRTFEWAK
FT                   NLPPPEEMERQPTHWGMPPHRFVTMNGRLLQGLDLAFHLSKVRPDESRQLALDAVLLHG
FT                   QFGYPSAAAHDQKPKPDPSGPCLGIFNPGNRKRPFDAIDGAASERPARQPRMDLDPHTQ
FT                   SQSQPQPPTQAQPASGDKPSEKRETPAAMLARKNVDRIVNHLWLQFAKGIAPYYEEHRD
FT                   QPQTNKQFGLVLYDLYRDLGRAFTKAVNRLVDLEWDSECESASQY"
FT   CDS_pept        join(complement(688602..688668),complement(687880..688421),
FT                   complement(687615..687824),complement(687517..687561),
FT                   complement(687362..687457),complement(686113..687297))
FT                   /codon_start=1
FT                   /gene_family="HOG000217101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269325"
FT                   /orf_name="AFUA_1G02360"
FT                   /product="C2H2 type zinc finger domain protein "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87947.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051379"
FT                   /db_xref="HOGENOM:HBG323857"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51A87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI5"
FT                   /transl_table=1
FT                   /translation="MKSLVCRVCHKAFSKAEHLRVVNTGSKPFVCKECRRPFARQDALT
FT                   RHEKLHTRATSSTPTIKVTQGDTAIHLPPQTTASDAHTWDSTRAVTDNAALNPAPSHTW
FT                   NTSPSGQQPGFQQAASDLDFSLIWPDSENLFHSIMSSDTTEHWQMPLGTLPFPPVVQDV
FT                   STINFGSPNSFDDRSSSIGAIPSGGSHQAVRDVTEMVTSSSSSVTAAIKATSITSVFLD
FT                   ECLHMFFVRFIPTFPILHRATFVFRECTHPLLLNAMALGSLYLGPKDSVAKGEALWRLA
FT                   HTAVATSSLITHRGPYDACKGVQLLVTALLGQIYGALSKNRVIRTTSQVFRPLGFFWAR
FT                   HCGMFDTEPFSVNQLPFPSASHAEKDHQWRVWAAREIQQRALLAYHILDGLVAQMSGDG
FT                   ASTRHVANPLVLPSSETAFDASNPDEWLAHVRSQKTEQPSFRLVFRSLFPPIGSLRPLD
FT                   YQFSPFALRVVLEGLQSLVSDSDESDVATVGAPGRPDVRRALAQVHETINMSIHLSAPE
FT                   RLEVLLRWHTICLDTMINSTVLCRHVCSRYNISQQVSGGSRTLRPGFDMVKWVNTEDAR
FT                   RALLHAVAIQDIIEQLPRGRAHVIHMPSSLFAAATIYVVFSLAGVATIHLPRTIVWQDA
FT                   LLSISDLNLGSDSVRPSSTSETRRFVEQGLTDSPAGMGAVRNLLYEMNSMQKLFRCLTS
FT                   QWGIAHDMEEIVDQWIRLCH"
FT   CDS_pept        join(690078..690317,690401..690483,690512..691019,
FT                   691076..691749,691800..691932)
FT                   /codon_start=1
FT                   /gene_family="HOG000203105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904390"
FT                   /orf_name="AFUA_1G02350"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87948.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051380"
FT                   /db_xref="HOGENOM:HBG324525"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EC84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI4"
FT                   /transl_table=1
FT                   /translation="MELRPHRADGDILETPVPAKADINLVESIETGIPSKHADIVASRL
FT                   SRSHRDFLMEHHGTLDLDPIPSMDLADPYNWPAWKKMANLILVAFHACMGTFAASGIIP
FT                   GYSIRPMKVQLLMRHFNSIAEDFGVSINKASYLTSLQIAILGGAPLFWKPLSQRYGRRP
FT                   IFLLSLMCSCVCNIGCAKSTNYASVAACRALQAFFISPASGKSCVDADEEGSRLTTVTA
FT                   IGSAIVMETTFKKDRAKYMGIWTLMVTVGIPCGPFIFGFVAHRAGYVWIYWVLAMINGG
FT                   QFILYLFFGPETRYIGGDENPKEPAWKREYLSLRRIDLTPFMWYEFVKPLTMVMQPCIA
FT                   IPAAAYAMVFCLSNVLATVEVPTLLERRWGLNPEQLGLQFLGPIIGSVLGEQLGGRMSD
FT                   LWMRQRERKTRKRPEPEYRLWLSYIGYFLSIVGLIVFLVCTQLSGNRWEVAPIIGIAIG
FT                   AAGNQVVTTVLITFAVDCYPEEAGSVGVFITFVRQIWGFLGPFWFPAMFENVGVAASAG
FT                   VGCALIVGASVVPTIIVHWQGKKWRPSQ"
FT   CDS_pept        join(complement(694211..694238),complement(693913..694151),
FT                   complement(693528..693843),complement(693371..693455),
FT                   complement(693101..693308))
FT                   /codon_start=1
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269326"
FT                   /orf_name="AFUA_1G02370"
FT                   /product="Fumarylacetoacetate hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87949.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG419601"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI000051FFAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI3"
FT                   /transl_table=1
FT                   /translation="MSKIASTFSRLVRFVPRSNPSKILIGEPVDPQVDVGLAVYQGKDV
FT                   SVRPFTGTSVLNPGQRTNATETIERILSPLSQTEIGSIRCIGLNYVSHAAEMKLTIPNV
FT                   PTLFLKPSTALADPWPAPTILPKITQVDNTGDYESEMVIVIGRDAKDVSEAEALDYVLG
FT                   YTAANDVSSRTSQMNQSQWSFSKGFDTSCPIVSSALIPDASKLHIRGVKNGRVMQDCPL
FT                   TDLIFSVPQLVSFLSQGTTLPAGTIILTGTPPGVGAAKNPKEFLTAGDEFAVELLPHVG
FT                   TLITKIEHQQ"
FT   CDS_pept        join(694800..694932,694997..695046,695166..695339)
FT                   /codon_start=1
FT                   /gene_family="HOG000212760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208979"
FT                   /orf_name="AFUA_1G02380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87950.1"
FT                   /db_xref="HOGENOM:HBG051381"
FT                   /db_xref="HOGENOM:HBG330046"
FT                   /db_xref="UniParc:UPI000051F61F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI2"
FT                   /transl_table=1
FT                   /translation="MATPKGPFRLVTVNTAPERARRLIGRVVDTLKDRYTIIHVDNCEK
FT                   IEEVAPKVKAHMPDVLFSASMWTAEEARQIHEIAREIKPDIRLHAIPTGLQVERGPDAI
FT                   VEYLCEKVPPLLDA"
FT   CDS_pept        join(696859..697612,697681..697900,697965..698160,
FT                   698240..698632)
FT                   /codon_start=1
FT                   /gene_family="HOG000048284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269327"
FT                   /orf_name="AFUA_1G02390"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87951.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051382"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000051FD8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI1"
FT                   /transl_table=1
FT                   /translation="MYSCAVLPELNQLLNSEYAVGEKMQKLRGLLSKQSSPLPSSKDQR
FT                   SGVGEDPALTSSMRVQSHALNPTRDIVKIVQRTNDSREVIELNNGLDKIYIPLLDIAQL
FT                   WLDACKRRAKHVLHTEVLCPLIKIFTIISETHSTKYIAHHHLRSVAFSGMIRSYRLSHR
FT                   FSWTPRSTKTGPRLHLYKSSIFMNIPQCRSQGYKRGLRPASERSQHLVCLGQSSRIRFS
FT                   AQKRNKPPEILLSSCMVSSARNRTTEVLAKFLHVTSNGRSSLWSVSQCILTVDDEIAHG
FT                   LQDLRNHGHSFHHHEHNYSVMAKDVEKFIHQHDLAKCVLIGHSMGAKTAMTVALQSSDL
FT                   VSALIPVDNAPVNAPLKSDFGKYVRGMQEVEAQGVTKQSDADKILKEYEESLPIRQFLL
FT                   TNLVRAEDGQKMKFRIPLSVLGPAIPAMADFPFLEPGSVTYDGPTLFVRGTKSKYVSDD
FT                   TVPVIKKLFPNAEIADVEAGHWLISENPEAFRQGMYKINLIGLSSLLTKDIPAVVKFLQ
FT                   DLP"
FT   CDS_pept        complement(698938..701559)
FT                   /codon_start=1
FT                   /gene_family="HOG000212749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269328"
FT                   /orf_name="AFUA_1G02400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87952.1"
FT                   /db_xref="HOGENOM:HBG051383"
FT                   /db_xref="UniParc:UPI000051FB34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKI0"
FT                   /transl_table=1
FT                   /translation="MDVDNPNTPTSRDPRLVSRNRPAPARTASLDAGIWGSPNGYKLGA
FT                   RSPNNPPPIDRQDEAPGDQFIRTLSELIKAAVDTAAREVEKDKLLKKKDMTEGLLRKAK
FT                   AAPNFPSTTAFFQQARKDEDSELTRMDETISRHQAHYRQLENSLTTKWVPLLLRNHSDS
FT                   DQKINKLQDEIRALKKRAGDSESGASREKYQLLETKMKMLQDRVVLLEKTSDNYATSIN
FT                   TQMRYEKENKERVDKLSSDIAQFASQETILKHFSTEVEELKRITIALDAKLSSLQRAQE
FT                   EYSGSLGRVNEIIDAQRKRLDASNDNSATFEKKFKEIHERLAPIEKVHVIPPEGPATVP
FT                   IDASKIELRLKNVEDNLAMIPRPDSSLRSTVQNLSEQLQQLQSLQAMKDEFHFAEMEEI
FT                   KKSTVDKADIQSLKDNYSRLADETRRISQLDRAGAVGQAEIQSLKDSYSRLAGEIQKFQ
FT                   SDRSGAVDQAEIQSLKDSYSRLAGEIQKIQSDRAIAVDKAEIQSLKETCSRLAENIQKM
FT                   SQWNPAAALQQIHTVDVKINTVDAALKSSNRLLESVRVGLHSLETRYNHLSTEMVVKNM
FT                   VVAMQEMYPSAGQLTEQITTLKNQAEKEISSLKKTIEQLVQTQNSQKALVNCLQDDVGQ
FT                   RSAEITHLRDLFGKVAHQVSALTEQLEEVRALPDKKGKEVADGQNRIELNESFRELKDQ
FT                   VQNLSSGLNQMKVVMSEITLNKKDLQSLDDRFRCLEESVPVNHRVLSEQINTLKDSLET
FT                   HKSIVQALDCLPASGMQSLKREQSPSGSDAAPHTNFVEMTETNPALALREKKRKKKRPR
FT                   PPTLSDNENERSSGSRNESPMIFSSPAHTLDNEVASPSENKRKTKKKKKRRLITEGPIT
FT                   ID"
FT   CDS_pept        join(702057..702065,702121..702567,702621..703574)
FT                   /codon_start=1
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269329"
FT                   /gene_name="rvb2"
FT                   /orf_name="AFUA_1G02410"
FT                   /product="RuvB-like helicase 2 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87953.1"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG015017"
FT                   /db_xref="HOGENOM:HBG749829"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000052042D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKH9"
FT                   /transl_table=1
FT                   /translation="MAVPISTVAETKELRGLNLIAAHSHIRGLGVDADSLQPRTSSQGL
FT                   VGQEKARKAAAVILQMVKEGKIAGRAVLIAGPPSTGKTAIAMGMAQSLGSDVPFTMLAA
FT                   SEIFSMEMSKTEALTQAFRKSIGVRIKEESEIIEGEVVEIQVDRSVTGGNKQGKLTIKT
FT                   TDMETIYDMGTKMIDSMTKERVMAGDVISIDKSSGKITKLGRSYARSRDYDAMGADTKF
FT                   VQCPEGELQVRKEIVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEVRDQINTKVAEW
FT                   KEEGKAEIIPGVLFIDEVHMLDIECFSYINRALEAELAPIVIMASNRGQARIRGTTYTS
FT                   PHGLPLDFLDRVVIVSTQPYSGDEIRQILAIRAQEEEIDLSPDALALLTKIGQESNLRY
FT                   ASNIITTSHLLSQKRKAKEVSIDDVQRSYRLFYDPARSVKFVNAYEQRFIGDQGAVNFS
FT                   APANGDAMEIS"
FT   CDS_pept        complement(703908..705275)
FT                   /codon_start=1
FT                   /gene_family="HOG000212738" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269330"
FT                   /orf_name="AFUA_1G02420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87954.1"
FT                   /db_xref="HOGENOM:HBG051385"
FT                   /db_xref="HOGENOM:HBG330044"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI000051F88E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH8"
FT                   /transl_table=1
FT                   /translation="MISSQPRPKRAGEDFTRTHHHDEDDPNGPSEHKKPRFDLRNPSNL
FT                   APDALDEDPVLDADEIGRRGQQVRRKAVNLDGYDSDSENEGFSARIEAKAKRSRAKHDA
FT                   EDDDMFAELQEDFGAEEIDADEALRKNKKTVRFLRDDEIEGQVASSKGGVTLRADLNAT
FT                   GDTVEEDEVESESDVADEDRARLDEGMDEELGAGAKKKHAPLLDAFNMRAEQEEGKFDD
FT                   QGNYIRKAADPDEIYDSWLEGVSKKDIRRAKEAAEKREAERKERDRLNDSILTADALKT
FT                   LITHLQRGETALEALARIGKGAPKKPKWQAKKKKNRSKQNGTQVEDAEMTEDDPNEASR
FT                   KQAIETITGAADILMTRGQTDIYDIEREMLTRQYRQETGEDWVDPPSESAAPTSAEEEP
FT                   AMWQFRWSDARDGGVEHGPYDSQTMESWKSAGYFGDGVEFRKVGDTGDWTSETTFL"
FT   CDS_pept        join(705773..706060,706132..706998)
FT                   /codon_start=1
FT                   /gene_family="HOG000212737" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269331"
FT                   /orf_name="AFUA_1G02430"
FT                   /product="Ubiquitin fusion degradation protein Ufd1,
FT                   putative"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL87955.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG232237"
FT                   /db_xref="HOGENOM:HBG622162"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI000051EC85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH7"
FT                   /transl_table=1
FT                   /translation="MDGVLGSSMLRHGATIRRFDEYYRCYPVAMLPGPERENVNHGGKV
FT                   IMPPSALDKLTRLHITYPMLFELHNGAKERMTHAGVLEFIAEEGKIYLPFWLMQTLLLE
FT                   PGDLVQVKSTDLPPGQFIKLQAQSTSFLDISDPKAVLENAFRNFSCLTKGDVFTFAYND
FT                   QVYEMAVLETKPSNNTNAVSVLETDLEVDFAPPVGYEEIQRPSGTSTPLSGVSGKLPSG
FT                   GLLHPHGTMAQAINYAAIAPESTDAATGAKAVSSNFLLGGQRLNAKKGSKAPTPKPSTP
FT                   VPGATNPQHPPPARRTNGPQPLRLPPNQLFFGYAIKPVKKRGEDGQAIEKPRFQGTGQT
FT                   LRGKKREPGNSATPTSGSDAENHKGKERNQKSHGSGRTLGGTKR"
FT   CDS_pept        707695..708555
FT                   /codon_start=1
FT                   /gene_family="HOG000212716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904391"
FT                   /orf_name="AFUA_1G02440"
FT                   /product="Indole-diterpene biosynthesis protein PaxU,
FT                   putative"
FT                   /protein_id="EAL87956.1"
FT                   /db_xref="HOGENOM:HBG051386"
FT                   /db_xref="HOGENOM:HBG330043"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI000051EA41"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH6"
FT                   /transl_table=1
FT                   /translation="MTSKVQENPLAPFVKLSASIYLQDPVEAVGYSGKQPRVIVLAFWM
FT                   NASSRALVKYVVEYRRLAPSARIVFILSSSNDFMLRASQKAQHARLAPAVEAIQASDRP
FT                   EGPVFLHMFSNGGVASTTHLLTAYLKATGKPLRVSSMIIDSAPGIATISSGLKAFSFVL
FT                   PKMWPLRYLSKFLLFVLLAVGYLVLRLTRTPDAVSRARNAINDHGLVRGLSQNNSPARC
FT                   YIYSDADELVYWRDVEQHAADAQTKGWVVQCEKFLGSLHVCHMRSDPERYWNIVKTYLE
FT                   EPTSK"
FT   CDS_pept        join(709543..709698,709831..710865,710924..711499)
FT                   /codon_start=1
FT                   /gene_family="HOG000168909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208980"
FT                   /orf_name="AFUA_1G02450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87957.1"
FT                   /db_xref="HOGENOM:HBG051387"
FT                   /db_xref="HOGENOM:HBG396029"
FT                   /db_xref="UniParc:UPI000051FFA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH5"
FT                   /transl_table=1
FT                   /translation="MSSKAQTSLTSWIQHLLRTILTERSQPVLTLREIGMVRVMERITD
FT                   MPDWHKKVFNHDVTETWKKEAMAGPEDISKSMADWIIDELRFKAVIYEHTNVVTLYNGD
FT                   VSKSDHNVPESFRTQFCQAIKVLEDVPPGLKFYNPGSDYVQRDLAPIALFPLVYGRTRI
FT                   LKDRIIGLDDALDSMGQGEVIPVPPETITREDIAWRVAAHADIEAKPFSRRFQILPFDL
FT                   ELKDDGRWHIISYINNLHPVRHRNIYKLIEDVFNMTIPQWNASLTPLKDMLHSRARLEY
FT                   KKAQYHPIAKEVEEQSPQPKPSEAEVDYQDRLNSWRMEHWEAVQPDAGRFIPWAVPPWM
FT                   MCFLPADLPTPVRIEQGVELNRDYGKRGLQMICRITSYDLTPEHPYTETGYHCEGQMNE
FT                   HVAATMAYVFHIDNVEVPSLEFRQISESASLAEVEHDPDDTIWLKQVYGLEDGEPIVQT
FT                   VGRIRTPVGRVIIVPATIQHRVNHCELIDKTRPGSVKVLSLFLVDPNIRIISTANVPPQ
FT                   RLDWSFDDIDPQELEGLDQMLQQLTVRFSERKDSLPISLNEARKLHDEVFWERFQFTKY
FT                   EQVAFESNVVIL"
FT   CDS_pept        join(complement(715651..715716),complement(714784..715511),
FT                   complement(711907..714715))
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269332"
FT                   /orf_name="AFUA_1G02460"
FT                   /product="DNA-directed RNA polymerase III, beta subunit,
FT                   putative"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="EAL87958.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG049456"
FT                   /db_xref="HOGENOM:HBG317648"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI000051EA42"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH4"
FT                   /transl_table=1
FT                   /translation="MPPRRRPQPAAASQARSAQPSESKPPTNSAPAAEDVEQDDRADEP
FT                   SGPTYRYRDPFDALLEPFYYNKSLTDPINTAKDKWNLLPAFLKVKGLVKQHIDSYNYFI
FT                   EVQLKKIVESSSTIRSDIDHTFYIKFTDIYVGSPCRADEPQDVTPDATPSDVSPHECRL
FT                   RDTTYAAPILVNFEYIRGRQRVTRKGVSIGRMPIMLRSSKCVLANKTPSEMTVLNECPL
FT                   DPGGYFIVNGTEKVILVQEQLSKNRIIVETDPKKEIVQASVTSSSNERKSKSYIILKKD
FT                   KLYVKHNVLSEDIPIVILLRAMGIHTEQEMLLLVAGVDSLYQDDFAINFEESIKLGIYT
FT                   QQQALDWIGARIKINRKQSSYRRTHIQEAVEAIASVIISHIEVKNMNFRPKAVYVAHMA
FT                   RRVLMAKNDPSLVDDRDYLGNKRLELAGQLLALLFEDLFKKFCFDIKMNIDKVLNKRNR
FT                   AEQFDAWTVMSMHSNHITQGMNRAISTGNWSLKRFRMERAGVTHVLSRLSYIAALGMMT
FT                   RISSQFEKTRKVSGPRALQPSQFGMLCPADTPEGEACGLVKNLALMTHITTNDEEGPIK
FT                   NLVFMLGAEDIMALGGKQLYIPGSYTISINGTPIALTRRPKYFLNAFRRLRRMGRISEF
FT                   VSIYINHHQCAVHIATDDGRICRPLIVVENGRSLVKDHHLEKLRDGTMQFDDFLAQGLV
FT                   EYLDVNEENDSLIALYEKDITDTTTHLEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAM
FT                   GKQAIGAIASNQFLRIDSILYLMVYPQKPMVKSRTIELVKYDQLPAGQNAMVAVMSYSG
FT                   YDIEDALVLNKGSVDRGFGRCQVFRKYVTNLKSYSNGTKDRLNPPTYENGAPIRKHALL
FT                   EADGLAAVGEQVNAGEVYINKSTPEQSNLSGIGSDAGRPVQYTPTPMTYKLHDPAYIDK
FT                   VMYSVQENENQLVKVLVRQTRRPEVGDKFSSRHGQKGVVGIIADQVDMPFTDSGINPDI
FT                   IMNPHGFPSRMTVGKMLELVAGKAGVLAGHHGYGTCFGGTPVEEASRVLIDHGFSYGGK
FT                   DYLTSGITGEALPFYVFTGPIYYQKLKHMVQDKMHSRARGPRAILTRQPTEGRSRDGGL
FT                   RLGEMERDCLIAYGTSQLLLERLMISSDRHEIDVCEQCGFMGYLNWCQRCKSSRSVVKM
FT                   TIPYAAKLLIQELMSMNVTARLKLDDEFPEWKGT"
FT   CDS_pept        join(complement(718917..719420),complement(718624..718854),
FT                   complement(716470..718564),complement(716366..716415))
FT                   /codon_start=1
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208981"
FT                   /orf_name="AFUA_1G02480"
FT                   /product="P-type ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87959.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="HOGENOM:HBG706356"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051FB1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH3"
FT                   /transl_table=1
FT                   /translation="MSHIVYFYTLYASICLPFPTLLSFTMVGQFGRDPLGALLNQENTV
FT                   PVRRLSGVNTKSPLVASNEKQPIPTDEDDGEPAEEENMDALIDDLQTVDGDVDGDDDIA
FT                   IDTGVITRRVSDEMLQTDPEKGLSEIEAQHRRRKYGHNRMKEEKENLLLKFLSFFVGPV
FT                   QFVMEGAAVLAAGLRDWVDFGVICALLLLNASVGFIQEFQAGSIVDELKKTLALQAIVC
FT                   REGEFNEIDASEIVPGDIVRIEEGTIVPADGRIVSANLIQVDQSSITGESLAVDKHKGD
FT                   TCYASSAVKRGRAIIVVTATGDYTFVGQAAALVNAASSGSGHFTEVLNGIGAVLLVLVI
FT                   ITLLVVWVSSFYRSNGITTILEFTLAITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQ
FT                   RLSAIESLAGVEILCSDKTGTLTKNKLSLSEPYTVAGVEPDDLMLTACLAASRKKKGMD
FT                   AIDKAFFKALRHYPRAKAALTKYKVLEFHPFDPVSKKVTAVVQSPQGRRMTCVKGAPLF
FT                   VLKTVEEDHPIPEEIDTAYKNKVAEFATRGFRSLGVARRRDQGSWEILGIMPCSDPPRH
FT                   DTAKTISEAKSLGLSIKMLTGDAVGIARETSRQLGLGTNVYNAERLGLGGGGTMPGSEV
FT                   YDFVEAADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKRADTGIAVEGSSD
FT                   AARSAADIVFLAPGLSAIIDALKTSRQIFHRMYAYVVYRIALSLHLEIFLGLWIAILNE
FT                   SLNLQLVVFIAIFADIATLAIAYDNAPYSKTPVKWNLPKLWGMSILLGLVLAAGTWVAL
FT                   TTIMNSGEEGGIIQNFGERDEVLFLEISLTENWLIFITRANGPFWSSIPSWQLTGAILV
FT                   VDLVATFFCIFGWFVGGQTSIVAVVRIWVFSFGVFCIMGGLYYLLQGSTGFDNLMNGKS
FT                   FSRSVKQRSLEDFAVSLQRVSTQHEKNNP"
FT   CDS_pept        join(720632..720662,720737..720840,720896..721157,
FT                   721265..721657,721715..722109,722214..722379,7
FT                   22435..722628)
FT                   /codon_start=1
FT                   /gene_family="HOG000212669" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269333"
FT                   /orf_name="AFUA_1G02490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87961.1"
FT                   /db_xref="HOGENOM:HBG051389"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000052042E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH1"
FT                   /transl_table=1
FT                   /translation="MNREIPGFYYDPDKKKYFKIQASHKAPAGAQYSKDAVKRKRVEHE
FT                   KRQRKVQLTRRLAKEKIRRSPFVRSPLLGVEREIGAQPISKPLRQEQQGLTYASQISRK
FT                   QLHRFEPWPSDYTIKHVLRNNSSGILIAILYDAFLFIDTSIRVCFPDTDQEIWTYNRTM
FT                   ERVLFREPYRVCVYIALPNRFSDVKHMLIRHRTISAFFYLLEPYRILAVSPYRTHQGIN
FT                   QLTRLEPRWIVAQMATRSLPLACCLTLVKAAIIAGLLSVRTFAHPIRIRTESSLWCSSP
FT                   CPEGDKALFAIGTSDGLYTLEGLGSFWTLSRKPFANDVSNGKTNFHRRADSSHALVTSV
FT                   EWLSSTVIAAGLKDSTVFLHDLRSGGTATRLQHPHAITKIRNLDSYRIVVAGINSLQMY
FT                   DIRYAPNGLQHNPRPNHPRHTSTRPYLSFFDYSPEVIPDFDISPELGLLASASDERKVQ
FT                   LFSLRTGEQVSSPLTKYQYANPISSLRFESGDGSPYGPLTPTLLVCSSATVDEWVW"
FT   CDS_pept        join(complement(724505..724591),complement(724041..724418),
FT                   complement(722802..723962))
FT                   /codon_start=1
FT                   /gene_family="HOG000212683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269334"
FT                   /orf_name="AFUA_1G02500"
FT                   /product="Origin recognition complex subunit Orc5, putative"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="EAL87962.2"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG051390"
FT                   /db_xref="HOGENOM:HBG323859"
FT                   /db_xref="InterPro:IPR020796"
FT                   /db_xref="UniParc:UPI0000F51A82"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKH0"
FT                   /transl_table=1
FT                   /translation="MLCADNLRSISQRWPCREVQTRQLACLLGPGISSPSTVVVHGISA
FT                   TCKSTIVRAVLSALAVPHAIVRSTECITGRHLLTKILWATLEALGLKDEWEKFGKGRCE
FT                   HVSTLAVLLAECLAPNAGKKTEKFVLVLDEIDRQREAPQTLLAALARLGEVIPSLCVVL
FT                   ILSSTPRPLFLQSAAVPHINFPPYTRKEATTIILNSESPPVYGLPQETAAKLYPHFVSA
FT                   VYDSLVGPTASSIPTFRSICEKLWPQFVSPIVTGETAPGGNEWDFSRLLVKNRALFRQQ
FT                   GEAALVHHIVTEDSAPTTNGAGSSLLKPSLTAASAPSPLPSLPYFPTLILTSAYLASHT
FT                   PQRLDTIFFSKFSSSSLSARNKRAHHRRRLKLLSQAQAEDARTAGQDPSTPGKKGKRQK
FT                   TRITKSTLESAFATTSATTSGGAPGITGPSTILTARPFPLERLIAIYHAIDPNPPANPI
FT                   RMTAVADAIYAELATLRRLRLVVPAAGRDSSSRMGASVGGSGSGNTTSDAGEKWCVNVS
FT                   GDWIGEMAKGIGVEVGEWLAGGLD"
FT   CDS_pept        join(complement(729050..729361),complement(728861..728958),
FT                   complement(728292..728759),complement(727803..728049),
FT                   complement(726702..727650),complement(725524..726638))
FT                   /codon_start=1
FT                   /gene_family="HOG000212694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057637"
FT                   /orf_name="AFUA_1G02510"
FT                   /product="RNA-binding protein, putative "
FT                   /function="RNA binding"
FT                   /protein_id="EAL87963.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG051391"
FT                   /db_xref="HOGENOM:HBG330038"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000052068B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG9"
FT                   /transl_table=1
FT                   /translation="MELVRESCPILPKMAFKNGLSERLDELRFPSPRSPPSESAFPGYN
FT                   SLSPGHTSFVSAFPRSSGDVRANLQRRFTTDSSKLSSWSYLNQVGGPSQVADPLDLLSS
FT                   CLLSIHALCYCLFCIPLLNVPYARPSRYCSHSLACSFVVLTLFQFEKKRQHIEYMREQR
FT                   RRFEEDMKLLDMQHEKEKQEMDQLARDLAKAGLSGPVSEPTTPPEYRERGFAGAFTRPT
FT                   RFSTSSVTSSPGFFNVFAPSQVTSPPSQTTHSSAHTPTNRFSVHSVPGSRRNSEKEDFA
FT                   QETTSPFRPGPSIHRYSMPSTGLGSQIRPNIAAFSNTSGLDSFSAAKYLFQNEDDRATV
FT                   TEEDRIPTPDIKSYLKLTDPDDKFPTLSRRSDSGLLSANSDALDLANSRTPNPETWNSH
FT                   SRHRSSHQSMPQNALNMFRLDQLGNSTSESHAQASNPARHIARHSLEATLLHSQEGGHG
FT                   NIGPAVSSRPTSLQTSYSTNDVPTIKGDGFNPAITPPKAHAESFQQHNTSLGRLPANSI
FT                   GTQQKDAVQHDEPKPQNSLTQQTTLQASAPPFGPQLTAAAVTQNTVTPTAMTAFPAPFY
FT                   GYGIQTYMGNPVQVNGQLQNFSPTAPYGAYPPYGNYRLAEGQAKGVAARRSGDGDSNQL
FT                   SRFTNFPLEHYRGELYTLCKDQHGCRYLQRKLEERNPEHVQLIFDETNMHVVELMTDPF
FT                   GNYLCQKLLEFSNDEQRTALINNAANQLVKIALNQHGTRALQKMIEFISTPEQIQTVIQ
FT                   ALRDHVVELVQDLNGNHVIQKCLNRLSAEDAQFIYDAVGANCVVVGTHRHGCCVLQRCI
FT                   DHASGEQRARLIAQITANAFALVQDPFGNYVVQYILDLAEPHFTEPLCQAFRGNIPALS
FT                   KQKFSSNVIEKCLRTAEFQMRRQMIDEMLAGTELEKMLRDSFANYVVQTAMDFADPETR
FT                   ARIVDAIRPILPSIRQTPHGRRIAGKMMASEGSGRGSAATSGQVTPNEMNSAQLPGPLQ
FT                   GPQKPFLYQHNSFPAPTVGPQFGSQNFMPASGSGSVSNTTSGGASDNSSGIYAPAAQQP
FT                   NGNIGAQSQLYAYF"
FT   CDS_pept        join(736092..736233,736331..736440)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057638"
FT                   /orf_name="AFUA_1G02520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87964.1"
FT                   /db_xref="HOGENOM:HBG051393"
FT                   /db_xref="UniParc:UPI00005206B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG8"
FT                   /transl_table=1
FT                   /translation="MKLPEVRFLEHLHSTFGCIFDIVAEAIIDNPHDESLKGGLLALGT
FT                   ATSPYPASHPSNATRQAPLAFSAYLGLVRISGLLGLQG"
FT   CDS_pept        join(737369..737433,737493..737795,737865..739008)
FT                   /codon_start=1
FT                   /gene_family="HOG000212705" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904392"
FT                   /orf_name="AFUA_1G02530"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87965.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG051394"
FT                   /db_xref="HOGENOM:HBG328342"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EC64"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG7"
FT                   /transl_table=1
FT                   /translation="MQWPPRYVLASILCSCGGLLFGMDTGVIGPVTVMDSFVSKFGSQS
FT                   ATVHGLIVSSILIPAAISSFFAGYLADKLGRPTGISIGALIFGIGAAIEGAAARLAMFI
FT                   VGRCIEGIGEGLYLGTLVVYICEISPTSVRGALATGPQLLITLGLVVGFFTCYGTARLE
FT                   SSFSWRTPYLILACLSVLFSAASFLFLVPSPRWLTLHGRHEEAARTWDLLGVGHAEREK
FT                   VEVEQTREARTQIQILPACPATTLTPDLTPHTPAPPQRPLKLASHKLLDIFSKDVRART
FT                   ALAVFLMGFQQLSGIDGVLYYAPLLFEQAGLTSSTATFFASGVSALVIFAVTIPGLLWA
FT                   DRWGRRHSIIAGGIGLSTTMFLIGALYAADAVHPSSGPGRWLVIVAIYLFAVIFSLTWA
FT                   ICIKVYAAEIQPQRTRASATSLAHGSNWVTNFLVALTTPILLAKSSFGAYFLFGGCTLL
FT                   TALVCALFMPETKGKSLDEIEEAFKSKSLGSHLAKAIRPITRSSN"
FT   CDS_pept        join(complement(743585..743597),complement(743296..743453),
FT                   complement(743104..743227),complement(742839..743027),
FT                   complement(739485..742777))
FT                   /codon_start=1
FT                   /gene_family="HOG000212658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904393"
FT                   /orf_name="AFUA_1G02540"
FT                   /product="EF hand domain protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="EAL87966.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG051395"
FT                   /db_xref="HOGENOM:HBG330036"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000051EEC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG6"
FT                   /transl_table=1
FT                   /translation="MADSAQRHPNLNLTPEEKRVFYQLFQAADTTNLGVITGEVAVPFF
FT                   EKTKLAPETLGLIWQIADKENRGLLTPSGFGVVLRLIGHAQAGRAPTEELALQPGPLPK
FT                   FEGVIIEPTSPTSRSAGATSPPPVSGPIRVPPLNPEDVNKFTALFEKSDVSRSGVISGD
FT                   IAKQIFERARLPNEILGRIWNLADTKQRGALDATEFIIAMHLLTSYKSGAMRGIPQTLP
FT                   PGLYEAAARRGPVRTSVGSRPALDVPPVPAIPRQFTGPQRTQSPLNRSQFGTPLTAQST
FT                   GGDWLITPAEKAQFDTIFGTIDTAKLGVITGDQAVGFFMKAQLPEEVLAQIWDLADIDA
FT                   DGQLTKDEFAVAMYLVRSQRTGKEPLPQTLPPALVPPSMRRPTTAQAVPPPPPSVRSAA
FT                   DDLFGLDAFSAPPAPAAPSQVPQSTGGSNTPFQTPGSPTSRASPPANSTTFKPFIPTSS
FT                   FGQSLQPQITGASAGAPPPVRSPPPPSDDLLGDNDPEESSKLTQETAELANLSNQIGSL
FT                   AKEMQNVQTKRTSAEHELSQTSQQKRDFETRLAQARAMYEQEVKNFKALEERLNASKAE
FT                   TKRLQQEYALIEGSRQDLQTQYNQVSAALTADQQENANLKEKIRQANAAVAQLKPALEK
FT                   ARSDARQQKGLVAINKKQLATVEGERDKIQEEMDTLSKEQPQGSDESAAPALASPALST
FT                   ASQNNNPFFRRTTTASSDGQGASPQVSSEQQRAFDSLFGTAFAPPTTATPPPPTSFRAD
FT                   SRQASLHSPVTSGVPTPSVSPPPSVGTVPEPPQSRQFTPNVLPLAETQSVTSSTKPSPP
FT                   GSRFGGPESSTVGTPAPAGATEIPSASPEHGEVRSPFEEFEESKRFPEVPVVSGETARA
FT                   DTSATANENQTAAKDPSFDELFGGPAHQRSRSQNANDFEEAFAAMKQGAGATKPNGTAP
FT                   AALSEFPPIRELADDDDDDDSSDSEAPLGFDDNFTPTVPPQEQQTSKTDPIEPSQLEAF
FT                   PAPGSITPSQPPSTEAQKSPPKYDESAEKEASGGMPPEFNGLLPKREDPTRAPDAPHSV
FT                   EAGTGAPMVGGEPQRDAPGAAPALAATKPSAPDFEAAFAGMELAPAKEAEDDDDAETEP
FT                   FDNKNTADFDFSFDAPSQQKMGVLGGSTEHANHSDFFSFEQQVNASNQGTAVSPAASNS
FT                   QPAAHDWEALFAPLDNAQGASTGTNGATQPAASGDGKPPGWALQADSVEDDQILQRLTG
FT                   MGFPRDESLAALEKFDYNIDKVSTTTLSGCKRR"
FT   CDS_pept        join(complement(746311..746335),complement(746185..746225),
FT                   complement(746046..746072),complement(745900..745975),
FT                   complement(744885..745839),complement(744583..744805))
FT                   /codon_start=1
FT                   /gene_family="HOG000165711" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269335"
FT                   /orf_name="AFUA_1G02550"
FT                   /product="Tubulin alpha-1 subunit "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="structural molecule activity"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="EAL87967.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG496287"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI00005206A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG5"
FT                   /transl_table=1
FT                   /translation="MREVISLNVGQAGCQIANSCWELYCLEHGIQPDGYLTEERKKADP
FT                   DHGFSTFFSETGQGKYVPRTIYCDLEPNVVDEVRTGTYRSLFHPENMITGKEDASNNYA
FT                   RGHYTVGKEMIDQVLDKVRRVADNCAGLQGFLVFHSFGGGTGSGFGALLMERLSVDYGK
FT                   KSKLEFCVYPAPQNATSVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLGIERP
FT                   SYENLNRLIAQVVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVAYAPVISAAKA
FT                   SHEANSVNEITSACFEPNNQMVKCDPRNGKYMATCLLYRGDVVPKETHAAVATLKTKRT
FT                   IQFVDWCPTGFKIGICYQPPQQVPGGDLAKLDRAVCMLSNTTAIAEAWSALDHKFDLMY
FT                   SKRAFVHWYVGEGMEEGEFSEAREDLAALERDYEEVAADSMDEEVEAEY"
FT   CDS_pept        join(747310..747594,747641..748117)
FT                   /codon_start=1
FT                   /gene_family="HOG000212647" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269336"
FT                   /orf_name="AFUA_1G02560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87968.1"
FT                   /db_xref="HOGENOM:HBG051396"
FT                   /db_xref="HOGENOM:HBG330035"
FT                   /db_xref="UniParc:UPI000051F158"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG4"
FT                   /transl_table=1
FT                   /translation="MKNFNPLVLLSLIPLVVANVEKTIFVAPQPSHIPSTDSTLDDLGL
FT                   ERLSPSYPTLRTFINASFPTPDSPGTDSWFFLENLTPGQRYEVRICYLATQPTSFTLDT
FT                   FTLSSTMEDPSLLSSISLYSSARLAALDSSTSSSNPLVRNGKHHPPPSSRDPAPTSDSV
FT                   LFLRIRAAADYFSLDRALMEHVPPVLVDVILDPFLWNVFPRSLVPTAGYLCVVGMVAVL
FT                   LARWVMGAFGAMVEREVGESTTVDGDEKKTR"
FT   CDS_pept        complement(748596..751439)
FT                   /codon_start=1
FT                   /gene_family="HOG000212636" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269337"
FT                   /orf_name="AFUA_1G02570"
FT                   /product="Aspartyl-tRNA synthetase, cytoplasmic "
FT                   /EC_number="6.1.1.12"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87969.1"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG051397"
FT                   /db_xref="HOGENOM:HBG330034"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI000051F627"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG3"
FT                   /transl_table=1
FT                   /translation="MSIKRALSKIRPKADDDSSKSNLSNGSSPRRSIFSSFLRDRDYVS
FT                   SSDDGSDDSGSGSLSRNQQKRLAREQRRKQRSRLSEEQQSDDSERRHKEEIAQAAREET
FT                   AEMKARYGELPLLQSTSRPREPRIRLEDISSSSVGQEVFFTARLHIIRRMSARLVFLVF
FT                   RQRLTTFQGVLHEKPGAKSIAMVQWAEHLRLGSIVRVRGIVQTPQVPVLGCSIHDVELD
FT                   VEQIHLVVHREEPVPFSVYEAEIRTAEEDKVEGRRSHLPDRTRLNNRILDLRTPTSQSI
FT                   FRLQSALCNIFRSSLDEQGFIEIHTPKLQGSATESGASVFQVNYFGRDAFLAQSPQLAK
FT                   QMAIAADFERVYEIGAVFRAENSNTHRHLTEYTGLDIEMAIEEHYHEMLDVLDAVIKNM
FT                   LKGVYGRYRREIEIVKHQFPSEDVVWLEETPIIRFSDGIKMLNESGWRDEDGNPLPEDD
FT                   DLHTRDEIRLGELVKEKYGTDYYILDKFPVAARPFYAMPDPEDPRFTNSFDIFIRGQEI
FT                   VSGGQRIHDPRMLEESMRRSGINPDTMEDYLEGFRWGAPPHAGAGVGLERLLMLLLKLG
FT                   NIRLASLFHRDPKSFPPKPPALLLRHPESSTIEPPWQREGRGSLAKDESELQPLEHLIA
FT                   NYGDATSTSWGDERFKIWRDMATGAAVSYVPSSNNYAVIPGNPLCDPSQYNRIITQFLQ
FT                   WMRRETKYKPIWLLCSPEVESILGDKLGWRSLSCIAEERVDPSRNQAASDGEIARKIRR
FT                   AENEGIKIVEMKYGEMVPDDVREKIDARIQDWLANRKGTQVHLSEIHPWRDSEHRWYFY
FT                   AVDKSGTICAFVALAMLSPHFGMQVKYSFDFPGSPNGVIEYIVTHAIQTAARAGTKSLT
FT                   FGAGATATLTPGHNLHGAKIKMLQHTYETLAKQFHLVRKSEFRAKLGAHEEPLYIAYPP
FT                   HGLGSRGIRAVLHFFED"
FT   CDS_pept        752758..753777
FT                   /codon_start=1
FT                   /gene_family="HOG000212625" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752274"
FT                   /orf_name="AFUA_1G02580"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87970.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051398"
FT                   /db_xref="HOGENOM:HBG330033"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051F628"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG2"
FT                   /transl_table=1
FT                   /translation="MASHAPPRWWLYIQAVFWRFLMRIGMFFHNLPAPRPPRPAFVRSV
FT                   RSGNSQIRLHFYCPPDYQKIRREGRRLPVVINFHGGGFTLGCPTDDSRWAQCILEDVGA
FT                   VVVSVGYRRSPEHPFPAAVDDGVEALQYLAAHATELGLDVTRIALSGFSAGGNLAVTVP
FT                   LRLRSLMAKEQHGPPLDRANSTQQLLDTSGDISIVALFCWYPILDFEESRAFRRAASIM
FT                   PEQTLPKFLTDLFDNSYLPNHEHRRSPYASPVRATDEILADALPHDIFLYICEWDMLMN
FT                   EGQLFMRRLKDSGKHARAMMIEKARHAWDKSPNPFRDQAKVNVLYRDACADMKAIFDR"
FT   CDS_pept        complement(754866..757007)
FT                   /codon_start=1
FT                   /gene_family="HOG000212614" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904394"
FT                   /orf_name="AFUA_1G02590"
FT                   /product="RNA polymerase I specific transcription
FT                   initiation factor RRN3 superfamily "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="EAL87971.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG051399"
FT                   /db_xref="HOGENOM:HBG330032"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniParc:UPI000051FB23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG1"
FT                   /transl_table=1
FT                   /translation="MVSFATTACNPTGAIKSVNPPKMLANPSPVPILKNSKTNSAAAAG
FT                   AKHKLADMDLSLSPSSSVASDGSDGTPSPRKRVRVQFDKDVEMREASWSGQEKEMAVST
FT                   EKSAAVVREEVRRAIQRHVSGTDSEAYDRIKEIFSADPRRLDEDGLPPEDLPTHTTLKH
FT                   HLMGLLSNVASLDRNCNGLVNAVLHSEWLGRDESYIKLYIRFLGNLAAAQGSYLGAVLK
FT                   MLANNFGEIPKGTGKLPGYAPVQAAEIYSRTHMALRHVMQLIPSGSGTLSPILSMQFPF
FT                   DTDSAKANIAYTRNLLKVISYAPELQADILALITEKVVKIDVQIQVDMEDIEDEVGEDV
FT                   LHAVSPEATMLEDDENEVDDNASVASDDSLDVESRRVKAIKDNILKLDGMIDSLFEYYA
FT                   PPFTTGTLDDKENALDLLLSHFQSIILPTYRSRHSQFLLFHFSQSSPILVDRFAATCVQ
FT                   LIFNKMQPGILRQSAAAYLASFVARGAHISGEVVRDVFDLLGTHLNNLRLDYEATCRGP
FT                   DLRRYGPFYSTAQALLYIFCFRWRDLTTAAMEGDTPEQIDELEPEDITFPPSVKEVLHQ
FT                   AIHSKLNPLKVCSPAIVSEFARMAQHLNFMYVFSILETNKRLRVSSFRSISAMADPRFS
FT                   HVERETRAGDDLGYQLDAYFPFDPYQLPRSRRWLEDDYVHWRGIPGVDDQDEGDSDSDL
FT                   DGSESEGDLSDVTETDEDD"
FT   CDS_pept        complement(757996..758754)
FT                   /codon_start=1
FT                   /gene_family="HOG000212603" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269338"
FT                   /orf_name="AFUA_1G02600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87972.1"
FT                   /db_xref="HOGENOM:HBG051400"
FT                   /db_xref="HOGENOM:HBG330031"
FT                   /db_xref="UniParc:UPI000051FD79"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKG0"
FT                   /transl_table=1
FT                   /translation="MSTLTRAFTKRHKRPEVSAPMPYREGQVKFTAGTIKRGKISGPVE
FT                   LISTTNMLAYNAPDLHSAVSSSSSSLQSPDDSELSFSQRSFGSPITTPDDSPVEPNPLS
FT                   SYFPKRSATVTSHPRSSTSTTSSTDAPLVPKRALSHTKRSHQELARQRSLSRLSPPPLN
FT                   SMRSSPSIRTTQDFFKSEPHPFGKELEQVNEVAEEFNSGANRVLDEEEMILLNKGLRKF
FT                   TANDYLVEIEELYGSIFDDHLGPVATGSWL"
FT   CDS_pept        join(761928..762015,762087..762176,762241..763040)
FT                   /codon_start=1
FT                   /gene_family="HOG000212592" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752275"
FT                   /orf_name="AFUA_1G02610"
FT                   /product="RRNA processing protein, putative "
FT                   /protein_id="EAL87973.2"
FT                   /db_xref="HOGENOM:HBG051401"
FT                   /db_xref="HOGENOM:HBG562115"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI0000F51A39"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF9"
FT                   /transl_table=1
FT                   /translation="MRAKRSKKYRKLMHQYEMAFGFREPYQVLVDSNFLRAVHTFKMEL
FT                   IPALERTLQGKVKPLLTKCSLAAIMASQPINPKTNNPYRPTHLPPPTILPLRHCSHNED
FT                   STPIDEVECLLSLLSPSKEVKRNKEHYTLATADPPAPAKADSGDGKKRKRGADEGRDAL
FT                   QRAQKLRIGARSIPGVPIVYVKRSVMILEPMSTPSEEVRDGVENRKFRVGLNDEAVLGK
FT                   RKRTEDGEEKKKKRGPKKPKGPNPLSVKKPKKKPAETASGPKQEKRKEQKLDEAPDRTN
FT                   DDGESGAPKPKRRRRHHKSSKGDGNDDHAGEPSNGADAATASNE"
FT   CDS_pept        join(complement(763767..763989),complement(763378..763622))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904395"
FT                   /orf_name="AFUA_1G02620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87974.1"
FT                   /db_xref="HOGENOM:HBG051402"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI000051EA2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF8"
FT                   /transl_table=1
FT                   /translation="MKNLTPKGYVASYSTIDASPDFFSRFYFFLWSTILPARQNPLSWL
FT                   SPLGIAFGYFLEAETLLLLEDRFKTVIEKNCEEIMTALDECHARGFLHKALGNCNDIKR
FT                   DVNKCLAAERYQRAKKNRDQARDNRKRIEKIWAEERALEQGISLNGESKQQ"
FT   CDS_pept        join(764137..764402,764471..765833)
FT                   /codon_start=1
FT                   /gene_family="HOG000212580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269339"
FT                   /orf_name="AFUA_1G02630"
FT                   /product="RRNA processing protein Pwp1, putative "
FT                   /protein_id="EAL87975.1"
FT                   /db_xref="HOGENOM:HBG266723"
FT                   /db_xref="HOGENOM:HBG748186"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051F161"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF7"
FT                   /transl_table=1
FT                   /translation="MSSMITTTAWVRRGVAAQFPTKYEIDEEEMNRISKLARMQLEEAQ
FT                   GDLEAAREGKDQDGETMEEDQKEEAQDAMEDDSEEKKGKTSFNDDEDLKEYDLDHYDSD
FT                   EVDEDGEKITMFGNVKSLAYHQPNEEDPYLVIPEEEEDEEREELQILPTDNLLLAGKVE
FT                   DEVAHLEVYVYEDQEANLYVHHDIMLPAIPLCLEWLDFPVGAHTDDRTTGNFVAVGTME
FT                   PDIEVWDLDIVDCMYPNAILGQGGAELEGDMKKAKKSKKKTKANDEFHVDSVLALAANR
FT                   QHRNLLASASADRTVKLWDLNTAKCAKSYTHHTDKVCSLDWHPKEATVLLTGSYDRTVV
FT                   AADMRAPDAKARWGVDADVENVRWDIHDPNFFYVTTDAGMVYRYDVRNIPATPKESKPV
FT                   WTLQAHDTSVSSFDINPAIPGFLVTGSTDKQVKLWNVENGRPSMVVSRKMDVGKVFSTT
FT                   FAPDNEVGFRLAVAGSKGTVQIWDTSTNGAVRRAFVSRMPALEGEVKERTIGVQADDDE
FT                   SDDDAAGEEIGAQQGGDGWESMDED"
FT   tRNA            766126..766213
FT                   /gene_name="tRNA-Asp"
FT   tRNA            complement(767268..767355)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        join(complement(768957..769408),complement(768205..768883))
FT                   /codon_start=1
FT                   /gene_family="HOG000212558" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752276"
FT                   /orf_name="AFUA_1G02640"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="EAL87976.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG051403"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="UniParc:UPI000051F8B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF6"
FT                   /transl_table=1
FT                   /translation="MVTQDTVTTILLMIRSPQWTAARTTSSRRLIRPRTPVRQYRAAVL
FT                   PSYGITTPVPDRHPHSKSPFCFQTGYALCAKRPSRPFPPPFLSPPSSSFSDPLTTHYQS
FT                   QDKRLSVGGELVRGLNNGDDAVLVADNFIGVNDGVGAWATKERGHAALWSRLLLHFWAL
FT                   EAEREVDRTSKLDPIEYLQRAYEETIRATTSPNEWLGTTTTVTALLHFTGDNAENAKPL
FT                   LYVTNLGDCKVLVIRPSEEKVLFRTTEQWHWFDCPMQLGTNSVDTPRKDAVLSEVQLEV
FT                   DDLVLAVSDGVLDNLWEHEVVTITLDSLKKWDGGHLEEKDIDWATPAHLADRRMVFVAR
FT                   ELLKAALAIAQDPFAESPYMEKAIEEGLAIEGGRFL"
FT   CDS_pept        join(complement(771233..771547),complement(770956..771159),
FT                   complement(769847..770875))
FT                   /codon_start=1
FT                   /gene_family="HOG000212547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057639"
FT                   /orf_name="AFUA_1G02650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87977.1"
FT                   /db_xref="HOGENOM:HBG051404"
FT                   /db_xref="UniParc:UPI000052042F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF5"
FT                   /transl_table=1
FT                   /translation="MRRSSSSSHSWQSALQKVFRRRSSESKGKQPALDDDFKIGEHKDG
FT                   FYKYSQEVLEKKNRKFEPPTMRALDSAEVYDMRAYSTVSSTVRVSRVRGSDSTETSYAS
FT                   AQMPPNEIPTLPYTIGSSEWRSFASREQLLDNPCGGTTAERIGSAISIFSKVYTIAKIF
FT                   AWAVRMYGVELDDTPGDFLARLRDAEAAVKTESLVELIDVTEKLYYSLYARLVMEIANV
FT                   ELCSHFDLNLRRMLVKETFTLPETSHLRDIFITFKDILDAPEICSGLDYDLVKQHQDSI
FT                   IRNATDKLAITGFSAHDLIGYRTSTLKIVSDETHPFVLKWRGLVYLYQMPGVETITAMS
FT                   EKYLTIMPQVSATEDFPAIELPFIDRDSIQPEIWQRENVLDNRQATLAKLEGRSVGDMR
FT                   RDDSRRRLLDFVKEKKCICRSSCSCATDCTMDVVLPCPCSERILCIAQAKRYERAGEQD
FT                   FGPRCGSLARAFFEGLAMVGREVAHYELVAELHRAMQLFEELVGKQRQAAATGTRLA"
FT   CDS_pept        join(complement(772561..773356),complement(772369..772535),
FT                   complement(772134..772280))
FT                   /codon_start=1
FT                   /gene_family="HOG000212536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269340"
FT                   /orf_name="AFUA_1G02660"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87978.2"
FT                   /db_xref="HOGENOM:HBG051405"
FT                   /db_xref="HOGENOM:HBG323861"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0000F51A74"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF4"
FT                   /transl_table=1
FT                   /translation="MSDKISFLPLEVLLSILAYLPFESLLAFGETSRANFKSHTLCLRR
FT                   LRVGVFEKRVHSMISLLQAGWATPDQLSSSSENDGSKSDYTISVIQPGIYAQQEFDREP
FT                   HAKCKLQKRGDISPQDAQEQTVQAQNKVLARLVDRYGPSLVKLEFMAYDLDVNGAKALG
FT                   TRCRHTLRYLALRFEHPHIRDGPMRPTAWYYPAPGSTAWNLLAGIGNPKDIGVTGLETL
FT                   ILERSGITPWQLAMLVERNPRLRVLKLRTCRGAQPEFFELARGLIKRQRLAPGATLEVL
FT                   WLENCHDLLSPPIDEQKVKQLPARPSDEGFEWVRNLSNLQSLSFRECACISSEYVDRAN
FT                   KAIWKIAEVILPYAFVTQNSAIEVDPLLS"
FT   CDS_pept        join(complement(776821..776882),complement(776055..776725),
FT                   complement(775904..776004),complement(775801..775849),
FT                   complement(775673..775752))
FT                   /codon_start=1
FT                   /gene_family="HOG000212535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269341"
FT                   /orf_name="AFUA_1G02670"
FT                   /product="ARP2/3 complex 34 kDa subunit , putative "
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL87979.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG340103"
FT                   /db_xref="HOGENOM:HBG591001"
FT                   /db_xref="InterPro:IPR007188"
FT                   /db_xref="UniParc:UPI0000520917"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF3"
FT                   /transl_table=1
FT                   /translation="MLLLDYQNVLIQNLLTERFSGGAPVSIDQVVSDFDGVTFHLSTPE
FT                   SKTKILISIHVKCFKELVQYGAQEVLEREYGPYIVTPEPGYDFSVQIDLENLPAEQEAR
FT                   DELIMRLALLKRNAMAAPFERAFDEFAKLSEEASRYTSESAPQGVKEGGELMAIHYREE
FT                   EAIYIKASHDRVTVIFSTVFREETDRIFGKVFLQEFVDARRRVVTLQNAPQVLFRSDPP
FT                   LELQGVPGLQTAGDGKMSYVTFVLFPRHLTPQRRYENISHIQTFRDYFHYHIKASKAYI
FT                   HTRMRKRTADFLQVLNRARPENEERERKTASGRTFRVHG"
FT   CDS_pept        join(777002..777144,777227..777481,777556..780160)
FT                   /codon_start=1
FT                   /gene_family="HOG000212524" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269342"
FT                   /orf_name="AFUA_1G02680"
FT                   /product="Small nucleolar ribonucleoprotein complex subunit
FT                   Dip2, putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL87980.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG379828"
FT                   /db_xref="HOGENOM:HBG522343"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051F620"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF2"
FT                   /transl_table=1
FT                   /translation="MTAGGGDLSGVVALAARSFFLAHFGLSIADSFGALKFSLLSTWAF
FT                   QRWKFEHSSTFGLVASGSSNAIWTRDDDLTGTVRRTGAGRAIVGAGEEVLCWDVKKGDL
FT                   LGRWRDTSCKAQVTVITQSKADEDVFAVGYDDGSIRIWDSRTETVIISFNGHKSAVTQL
FT                   AFDAAGVRVASGSKDTDIIVWDLLAEVGLFKLRGHTDQVTSLHFLNLSSELLHAAGLSE
FT                   HAGFLLTTGKDSLIKIWDLSTQHCIETHVAQSNGECWSLGLSPDQSGCITAGNDGELKV
FT                   WSIDESAMLEISREKVGSEGRKILTDRGTFYRNGKDRTIGISFHPRADYIGFHGSEKAI
FT                   EIWRIRSATEVQKSLARKRKRRKEKEAQREGAVAEVDNEKVDDVSSAPVTEVFVPHVIV
FT                   RTGGKVRSFDWIRTKTTGNLQLLASTTNNQLESYSVTTANKKKDDDGSDYNRNLAVDIP
FT                   GHRTDIRSIALSSDDRMLASASNGSLKIWNVRTQSCLRTLECGYSLCSAFLPGDKIVVV
FT                   GNKNGELEVFDIASSTLLDTIKAHDGPVWSLHVHPDGKSMVSGSADKSAKFWNFQVVQE
FT                   EIPGTKRTTPRLKLVHTRTLKVADDILSLRFSPDARLLAVALLDNTVKVFFTDSLKLFL
FT                   NLYGHKLPVLNMDISYDSKLIVTCSADKTVRLWGLDFGDCHKAFLAHEDSIMAVAFVPT
FT                   NKEGNGHNFFSASKDRVIKYWDGDKFEHIQKLQGHHGEIWALTVSHSGEFIVSASHDKS
FT                   IRIWQQTDEQLFLEEEREKELEEMYDNTLTASLEQDEDADGEKAEAVDAGKQTTETLMA
FT                   GEKIMEALDLGMADLEVMRQWRAVKASQPNAAPPARNPLYMALGNISAEQHVLSVVQKV
FT                   PAAALQDALLVLPFSKVPALFTFLNIWANRAWNIPLTCRVLFFMLKTHHRQIIASKMMR
FT                   PMLDSIRSTLRRVLTRQKDEMGFNLSALQIIGQQVREASTKDYVDEETWEQEHPQVAGT
FT                   GKKRAFVQIAS"
FT   CDS_pept        join(complement(782239..782522),complement(781230..782190))
FT                   /codon_start=1
FT                   /gene_family="HOG000212503" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269343"
FT                   /orf_name="AFUA_1G02700"
FT                   /product="Zinc metallopeptidase, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87982.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051407"
FT                   /db_xref="HOGENOM:HBG330025"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI000051E5A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKF0"
FT                   /transl_table=1
FT                   /translation="MRELDPLVSEYQHDKHRPREAEALLMLRKIASLVKPIMRQRAWRV
FT                   GTLCEFYPQQRNLLGLNINAGQKICLRLRYPSDERQFLPLEQVVDTMLHELCHIVHGPH
FT                   NQQFHALWNQLRDEHEELVMKGYTGEGFLSQGKRLGGRSMPIDEARRVARAAAERRRTL
FT                   AAGSGQRLGGAPVLRGTDMRRVIADAAQRRIDVTKGCASGADNSVELAEEASRNGFRTK
FT                   AEEDDANERAIMEAYIDLIQEEERERYGPSYIPPSQEIPAGPRSAPSPPPVLENTRSTS
FT                   SAEPQDPIDLTYDNASYEQPWTCPTCTLENPANFLCCDACASERPRPSATRSLSGPPAT
FT                   GSCRTDNHNKKKRPISQSASQTIFKNRTRAVETLAALDSSIAKRPLGWICQTCGTFMET
FT                   EWWTCSNCGMMKQNS"
FT   CDS_pept        join(783419..783451,783513..783861,783922..784085,
FT                   784139..784990)
FT                   /codon_start=1
FT                   /gene_family="HOG000212492" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269344"
FT                   /orf_name="AFUA_1G02710"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL87983.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051408"
FT                   /db_xref="HOGENOM:HBG330021"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EEDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE9"
FT                   /transl_table=1
FT                   /translation="MTSDDQFFFDYLASIPHDVRRYSLEVADSIDRQVDHIATVVRDTL
FT                   SHQSWLPPAIRPSPKTYSSFHAPRSQSFTDRAYDWMIRNRAWSAALIAFFGTTSVLYFG
FT                   SSKLHGRRRKARRAGNGARKEIVVVAGSPHEPMTRAIATDLERRGYIVFVTVTSAQEEQ
FT                   LVRSENRMDIRALWLDLTTTPSPSEIHPSLRDIHSLITQPQWPMPGVPPHTCQLSGLIL
FT                   IPSPIYTTGPVATIPPSTWADTINTRLLSPILTTQIFLPLLTLRNTNSTILVLYPSISS
FT                   SLSAPFAGPEVTTARALSGFATSLRTELRLLQHKNIDVVELKLGNIDLGPQFRDAQSHV
FT                   TGTEVLAWSAQQRSLYGPQYLSSIEQRPVASAGPRTVRGSPARTLHYAILDALEPASKD
FT                   IFGRKVPKKRVIYAGRGARSYSIIGEWVPAGLVGWMMGLRGGHPTASDSASNSSSETGW
FT                   EKVNEAR"
FT   CDS_pept        join(complement(785660..786103),complement(785212..785574))
FT                   /codon_start=1
FT                   /gene_family="HOG000212481" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904396"
FT                   /orf_name="AFUA_1G02720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87984.1"
FT                   /db_xref="HOGENOM:HBG051410"
FT                   /db_xref="HOGENOM:HBG330020"
FT                   /db_xref="UniParc:UPI000051E7EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE8"
FT                   /transl_table=1
FT                   /translation="MKLSKPSFGVDSSLDSRHCYETSWLLPPLPFALLRALIALYIFVT
FT                   IFFIWGWNGTHGDSDAIGQSFSYFTWLTYWGLGFYYLVAAIHTACYARTGRSVLFDRLP
FT                   RALRALHAIFYTTITTFPFLVTIVFWAILFEPPWYTRTFQAWSNISQHGLNSLWALLEI
FT                   ILPTTNPHSLLAFPVLVLILLLYVALAYLTYHTEGFYTYSFLDPGPDGEHSGRVTGYCF
FT                   GIFAAILVIFILSWAAIWLRRRLTHGKIKRSVYDKEDVPEMRYVGV"
FT   CDS_pept        join(complement(789237..789373),complement(788751..789170),
FT                   complement(788249..788687))
FT                   /codon_start=1
FT                   /gene_family="HOG000164438" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752277"
FT                   /orf_name="AFUA_1G02730"
FT                   /product="Mitochondrial phosphate carrier protein (Ptp),
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL87985.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG526109"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051F87D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE7"
FT                   /transl_table=1
FT                   /translation="MAASPAAIAPTAPESKVEGLGLYSRFAFAGAVCCSVTHGAFTPVD
FT                   VVKTRIQLDPKTYNRGMIGGFRQVIQNEGAGALLTGIGPTFAGYFMQGAFKFGGYEFFK
FT                   QQSINVLGLETARQNRTAVYSVSAACAEFFASIALCPLEATRIRLVSEPGFANGLFSGF
FT                   GKILKHEGVGAFYRGFGPILLKQVPYTVTKFVVYEKVAEAVFARLDKSKLSNSAQTGVN
FT                   LGSGLIAGFAAAIISQPADTMLSKINKTKGLPGESTVSRLIKIAGELGFRGSFAGLPTR
FT                   LFMIGGLTAGQFAIYGDIKKALGKSDYFLGGSQRLTFVPLGATNGVEIAK"
FT   CDS_pept        join(complement(791440..791488),complement(790950..791365),
FT                   complement(790340..790817),complement(790042..790286))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269345"
FT                   /orf_name="AFUA_1G02740"
FT                   /product="Polyketide synthase, putative "
FT                   /protein_id="EAL87986.1"
FT                   /db_xref="HOGENOM:HBG051411"
FT                   /db_xref="UniParc:UPI000051FB35"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE6"
FT                   /transl_table=1
FT                   /translation="MCIQRKSSPRTLGTPYYVGRNNRLHSGRHPILVNQDPEEAWALGY
FT                   DDNSNNESFFGFHGERFVPLAVEETFVTVQAETEYSLAKALGIGQLGYFYLIQDRVAGI
FT                   DGTVVALSETCVQVPFHRLVTITNQADLNSPCFQASHETSSHRLCYQTSPQIQLREKET
FT                   QRNRCQKLVLHASVSYDLAPGKGPASLNQRLERCLPCSCSIRRLDYLFQNVATLTSAES
FT                   IRNATQCLVDAVTVANKVSNDHNGSVLKGNEIVSLKRGPKINAVVDWKSGQIIPSRIRS
FT                   MEIDQTFVDNKKYLIIGLAGDLGRSIARFMVERGSPYDITLEMSHNPNKNPLITVKLQK
FT                   ERYGPKDAEAVTDAHLLIVSIFSRNPVLRVEDEMLDQGPNRGLDVPTVQGIYFFS"
FT   CDS_pept        join(791703..791845,791951..792156,792188..792369)
FT                   /codon_start=1
FT                   /gene_family="HOG000048285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269346"
FT                   /orf_name="AFUA_1G02750"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87987.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051412"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniParc:UPI000051FB16"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE5"
FT                   /transl_table=1
FT                   /translation="MYYGPNRPKRRRTPNGLAKCASGEHAGSFPLATASPGSFSRREHN
FT                   VMRSSRPGRTPLRMESVDTVAPVLPTTQRTVIIEAGDRVRVRDDMPLPTLEKHQFLIRT
FT                   EAVVINPSDTKTRPDYTATVVACRPEVTEVKVGDRVCGAQHAMNANTPHRGSFGEHDIS
FT                   SMIIKEDAASSSP"
FT   CDS_pept        join(795096..797212,797270..797423)
FT                   /codon_start=1
FT                   /gene_family="HOG000212470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904397"
FT                   /orf_name="AFUA_1G02760"
FT                   /product="Cell cycle inhibitor Nif1, putative "
FT                   /function="binding"
FT                   /protein_id="EAL87988.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051413"
FT                   /db_xref="HOGENOM:HBG330019"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051EEDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE4"
FT                   /transl_table=1
FT                   /translation="MASRPQFGETRSQSYDALRSPSPRIEHFDGEIPPALSPLDAFAAQ
FT                   GRLLARQLEESKRGERRMSRLPPSSVARSLSQGRPGYFRAPSSGDSHNSQGGRGGELAR
FT                   RPTQKNNPEVEEPKFRPQSEHPRISAVSFLASEDGFAEDDEEATPTEGPPSLSTEPDTF
FT                   GVPRAESPDEDMSTGSAPEAPPRFYASGPSSPVSSVGLAIAAPSRNSSTDSASRLNVPR
FT                   SLAPPPSPLSRPSTSSRTTQPESSDDDYSSSNAGSTFSKPRKLSSCSAMSLPYSPMSAN
FT                   PRSHPRSPSLSSETSNTTGYLPRPSFNFSRPLSRSSTSLSAPVSIGGMDQTNQPSTMHR
FT                   QHKPSPIIVPTQSDLANHAHEEPSSAVSSYIYTKYSLPRGRKVSRDSVVFSGLQTPNFE
FT                   WKEPLFESPPPASTEAHLRPSRTPSPPPSGHESVYSQSMYSQRAHSMCGTPTTTGPTPS
FT                   ANEPGLRSQGAEATPEPEVDQVEPPSVEKQKAVAPPPGLTTSNKEDKEDTTSSADSAST
FT                   IRPQTGRAASSSGIITAEEHVAKGIECHEKGSLKESTYHLRIAAKQNHPTGMLLYALAC
FT                   RHGWGMRPNQREGVQWLRKAVDCVGLELMDDSNGTIPQRAKEMQKAYRAQFALSIYELG
FT                   VSHLNGWGIEQDKSLALRCFEIAGQWGDADALAEAGFCYAEGIGCKKDMKKAAKFYRQA
FT                   EAKGISMVGNSWIYKDKYKSDDESAPRSRGRGRQGGTPEKNARSKSRTRSLFHRKKSLA
FT                   AEA"
FT   CDS_pept        join(800203..800360,800431..800846,800910..801034,
FT                   801082..801369)
FT                   /codon_start=1
FT                   /gene_family="HOG000212459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269347"
FT                   /orf_name="AFUA_1G02770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87989.2"
FT                   /db_xref="HOGENOM:HBG051414"
FT                   /db_xref="HOGENOM:HBG323862"
FT                   /db_xref="InterPro:IPR022185"
FT                   /db_xref="UniParc:UPI0000F51AAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE3"
FT                   /transl_table=1
FT                   /translation="MAGDKPEVSEIGFVEGPSSKPSFGRRVLNHYKRWWWVHIIAIIVV
FT                   VLVVTLPLVYVGYPNIAQGDINDSTLEIKEMIISDPKPDSFYLDQTQVIGSHSMFHPTI
FT                   YAFDAAVSLLGAATFATVKVPQVKANDGTVVHISQTLDLSDVGAFGGFATAVMQNEEIK
FT                   LNIYGKPDLKQGGLPKIDVTYNKTVTMKALNKLEGFAITEMHALSGKSANGANFGGTVY
FT                   IPNPSPMTISMGNVTLDLSCEGTSIGTSYLNDLKLVPGNNTLPMTTAVKLSAIAPFFDK
FT                   YPNGLPVSISGSSTNSSVYNGQAIPYFSEALASNTLEVTLDLAKLLT"
FT   CDS_pept        join(802462..803343,803406..803663)
FT                   /codon_start=1
FT                   /gene_family="HOG000044165" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752278"
FT                   /orf_name="AFUA_1G02780"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /function="asparaginase activity"
FT                   /biological_process="asparagine metabolic process "
FT                   /protein_id="EAL87990.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="GO:0006528"
FT                   /db_xref="HOGENOM:HBG348837"
FT                   /db_xref="HOGENOM:HBG497495"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="UniParc:UPI000051EEE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE2"
FT                   /transl_table=1
FT                   /translation="MTKLSFKIITLAAMIAVGNASPFVYPRATSPNSTYVFTNSHGLNF
FT                   TQMNTTLPNVTILATGGTIAGSSNDNTATTGYTAGAIGIQQLMDAVPEMLDVANVAGIQ
FT                   VANVGSPDVTSSLLLHMARTINEVVCDDPTMSGAVITHGTDTLEETAFFLDATVNCGKP
FT                   IVVVGAMRPATAISADGPFNLLQAVTVAAHPTARNRGALVVMNDRIVSAYYVSKTNANT
FT                   MDTFKAVEMGNLGAIISNKPYFFYPPVMPTGKTTFDVRNVASIPRVDILYSYQDMQNDT
FT                   LYDAVDNGAKGIVIAGSGAGSVSSGYYDAIDDIASTHSLPVVLSTRTGNGEVAITDSET
FT                   TIESGFLNPQKARILLGLLLAEDKGFKEIKEAFAKNGVA"
FT   CDS_pept        join(complement(805549..805739),complement(805438..805462),
FT                   complement(805098..805332),complement(804381..805045))
FT                   /codon_start=1
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269348"
FT                   /orf_name="AFUA_1G02800"
FT                   /product="Class V chitinase, putative "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="EAL87991.2"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG051415"
FT                   /db_xref="HOGENOM:HBG741095"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000F51AB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKE1"
FT                   /transl_table=1
FT                   /translation="MFSGSIFPHWRRKAAQRSNNFSSSYEVPFFMNAAYYANWRIYRKQ
FT                   PPSSLRLGFISHIFYAFAWVKEDGTVYLSDEWADSQMPVDGTNGCLRAFTQLKTQYSKL
FT                   KVILSVGGGGKGSENFAAVAGSQSSLETFVRTAKGLVDEFGLDGIDIDWEHPSTPAEGS
FT                   DYVRLLARLREVLPSPRYVLATCLPAGEWALRNIDLCKAQNYVDLINIMAYDFSGPWTS
FT                   ETGHQAQLYSPSRDPTGGISCQSAIAYVIAQGVNPKKILLGIPAYGRSFLGSNHIGQRY
FT                   SGCGGEDGVFDYCDLPRPGAKEYYDEKSGAAWCVGGDGGFVTYDTPETVQQKAKFATKT
FT                   KLGGLFYWHIGGDARGPRSLIETGYKTLHDM"
FT   CDS_pept        807987..808751
FT                   /codon_start=1
FT                   /gene_family="HOG000212457" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208982"
FT                   /gene_name="yth1"
FT                   /orf_name="AFUA_1G02810"
FT                   /product="mRNA 3'-end-processing protein yth1 "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87993.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG210860"
FT                   /db_xref="HOGENOM:HBG330017"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI00005206A5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKD9"
FT                   /transl_table=1
FT                   /translation="MTADVKSAAARILSTDSSRDPSFNNFSFTPFLRKSFGFGLASDVP
FT                   VCKAYSEGHCPLGPACPDRHPTPSRVTTSTTTASGLAPSTTHGSLVCKHFLKGLCKKGL
FT                   KCEYLHEYNLRRMPECQSFSRSGYCPNGDDCLYQHVREQARLPPCENYDQGFCELGPLC
FT                   SKRHVRRRLCKYYLAGFCPEGKACPDAHPRWSENLPKPTMRVEKTEEELERERALIREE
FT                   QEREKEREREWRSERGRGGGFMRGRYRGRGRG"
FT   CDS_pept        join(809705..809731,809792..809877,809941..810337,
FT                   810402..810503)
FT                   /codon_start=1
FT                   /gene_family="HOG000030539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208983"
FT                   /orf_name="AFUA_1G02820"
FT                   /product="NADH-quinone oxidoreductase Pst2, putative "
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="negative regulation of transcription "
FT                   /protein_id="EAL87994.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016481"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG341443"
FT                   /db_xref="HOGENOM:HBG686708"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="UniParc:UPI000051EEC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD8"
FT                   /transl_table=1
FT                   /translation="MAPKVAIVFYSMYGHILKLAEAEKRGIESAGGQADIYQIAETLSD
FT                   DILAKMHAPPKSSYPVVQVDTLKDYDAILFGIPTRYGNFPAQWKTFWDRTGGIWASGGY
FT                   WGKYAGLFVSTGTLGGGQESTAIAAMSTLAHHGFIYVPLGYKTVFPMLANLEEIHGGSA
FT                   WGAGTFAGADGSRQPTQLELSIAEAQGKAFYETVAKVNFA"
FT   CDS_pept        join(811363..811464,811532..811662,811718..813176,
FT                   813265..813531)
FT                   /codon_start=1
FT                   /gene_family="HOG000008139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904398"
FT                   /gene_name="npl4"
FT                   /orf_name="AFUA_1G02830"
FT                   /product="Nuclear protein localization protein 4 "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="perinuclear region of cytoplasm "
FT                   /protein_id="EAL87995.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0048471"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051418"
FT                   /db_xref="HOGENOM:HBG330015"
FT                   /db_xref="InterPro:IPR007716"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR016563"
FT                   /db_xref="UniParc:UPI00005206A6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKD7"
FT                   /transl_table=1
FT                   /translation="MAAARPIILRFESRNGQFRLSVSPQEQFPFLKEKILENLPKDVEP
FT                   SSLVLSNKPIGTGGQERQLKDLTGVSIERVGLKHGDKLFIGYQDKQASQAAPAQKHVTA
FT                   DVSRRLNGAPVPETETVAFHPPTSPSATIKNPWEVVQQSPLDDMLDKKDGKIYRPRDPK
FT                   MCKHGPKGMCDYCMPLEPYDPKYLAEKKIKHLSFHSYMRKVNASTNKAELKSSFMPPLT
FT                   EPYYRVRRDCPSGHPPWPEGICTKCQPSAISLQPQEFRMVDHVEFASPDLINSLLDFWR
FT                   KSGAQRLGFLYGTYEEYTEVPLGIKAVVQAIYEPPQVDEIDGITLHEWPNEKEVDEVAR
FT                   QCGLEKVGVIFTDLLDAGRGDGSVVCKRHIDSYYLSSLEIAFASRMQAKHPKPTKWSRT
FT                   GRFGSNFVTCVLSGDEEGAITVSSYQASISAVEMVRADIIEPSAEPSVMLVQSEDEDTD
FT                   NKSRYIPEVFYRKINEYGVSAQQNAKPSFPVEYLLVTLTHGFPTEASPIFPASTFPIEN
FT                   REVIGESQELRHVAKKLVSHGDPDKAIREVSDFHLLCFLHSLSMFSKEEEALLCRVATT
FT                   HDPTEGLKLLNTPGWATLVTVLQESGERPPKRPWLNPADPPRPLSQQGKRHLPSRPESP
FT                   KSESEQLAKRFKGASLE"
FT   CDS_pept        complement(814520..815977)
FT                   /codon_start=1
FT                   /gene_family="HOG000212221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904399"
FT                   /orf_name="AFUA_1G02840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87996.1"
FT                   /db_xref="HOGENOM:HBG051419"
FT                   /db_xref="UniParc:UPI000051F621"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD6"
FT                   /transl_table=1
FT                   /translation="MAAAGAAGAGLAELFRRRSRPKERHEDSQMSYSEDKYSDEESRRG
FT                   GWGNKLLKLGAIGGGALLVKRLFDRRRDRDSDTESGRYSRAHTRTDSMTEATMSRLEDG
FT                   RRPEPSYQTPLNRPPSRPPSRPPSRPQSPGSSYYYNTTYLTEPEPQPSHGVRNALFGAG
FT                   AFAALRGLFKRRNKDDEQRRVEEMRRHDIEEERIARANSKRRYTGDGFYPRKHRRADSY
FT                   TATDLSSTDMTRPPRGPLHGESAISAGAATPGPGDVPYSGAPPAPPIHQEPISEMPTPV
FT                   QSRHELPEVVPGLAAGATAMDASSSHRRQRSTSRQRDDHVESPPVSVKVKMHNDGRHVT
FT                   LRRLTEEEAAASREARRRERRNSRRRAGSASSLSGNEGGYDRWRRVEELERQQQEQIQR
FT                   EQQAAVAAAGSAAPLGAAPPPSFVPPSSHFSPPPPPVPSSLPYGSIGSPGTFTGTDASG
FT                   DYANNRRRRRAERARARQERQQSVDFT"
FT   CDS_pept        join(817835..818272,818341..818700)
FT                   /codon_start=1
FT                   /gene_family="HOG000192503" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269349"
FT                   /orf_name="AFUA_1G02850"
FT                   /product="L-cystine transporter, putative "
FT                   /protein_id="EAL87997.1"
FT                   /db_xref="HOGENOM:HBG344102"
FT                   /db_xref="HOGENOM:HBG716305"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000051F3D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD5"
FT                   /transl_table=1
FT                   /translation="MFCWSASFYPQPISNFRRRSTVGLAIDFPTINVLGFVCYTAYTSA
FT                   FLYSPVIRRQYAARHPSDEESTVRFNDFAFALHAVILSTLVYTQFWPKIWGFKVSRFQT
FT                   VSKPVLGLFWGSNAAIGIVVCIVLVKSPDRGYDPSTWAWIDVIYALSYVKLIITIVKYV
FT                   PQAWVNYKRKSTEGWSISQILFDLTGGVFSLLQLVLDSSFQSDWSGITGNPVKFLLSNV
FT                   TILFDLVFVVQHYILYRDSMEGKIDRHPDLVTPLLSDPRGASA"
FT   CDS_pept        820661..821485
FT                   /codon_start=1
FT                   /gene_family="HOG000212235" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269350"
FT                   /orf_name="AFUA_1G02860"
FT                   /product="C2H2 transcription factor, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87998.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051420"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051EC65"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD4"
FT                   /transl_table=1
FT                   /translation="MTLFTTNHQTAFAMSSHQYTFPGMHDVPETYPYHMSQVDSEEDMD
FT                   SLYLSSAPEPSYTRLDFEPTIPAMPTSQAYNTTMRAPMSGSYLPYSDQWTSQVPPTAAA
FT                   APTTTLYHPTDIYPSSTMTYNPQRTAPTALNPNPQTYFYPDPSTNTNLDLDLKLPSSDL
FT                   DTKDLTNYGIPNPDGSWSCAYPGCTSTATFHRGCDLRKHFNRHRKHLFCRHEGCPQAVT
FT                   GGFSSKKDRSRHEAKHNPGVVCEWPDCGRVFSRVDNMKDHVRRIHKRGEVYS"
FT   CDS_pept        complement(822526..823728)
FT                   /codon_start=1
FT                   /gene_family="HOG000212246" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904400"
FT                   /orf_name="AFUA_1G02870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87999.1"
FT                   /db_xref="HOGENOM:HBG051421"
FT                   /db_xref="HOGENOM:HBG329990"
FT                   /db_xref="UniParc:UPI00005201FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD3"
FT                   /transl_table=1
FT                   /translation="MTDTYEPDDDRLTPGLEVQKPNYKPDEQLPPFLTQDSLSKSDVTA
FT                   KYSGDEGTSSDFPRKLSPTSKPETAEGDSVLISHLDPNRPDIANYELEHRRLRDPWLED
FT                   QSSLQKTKIDPQPREDAKFQEPASSVAERALQLLSSEPPENLVSPQTLKSASPLQSIKD
FT                   LLEPPVSQAEPISIKVDVTSPKESHPPGAPNFTAERKSPVLSPLKKFAISPSDGPVQAL
FT                   LPALQTSPPLATAKSPENHQQHSLPSIQTALAEISGPYSLPPVSTSPPSIPRNESAWDH
FT                   QRPGQFAPPQVPPSPYSHLSPASSKGMSAVSSPASQQQSQWRHTRSDITYLTTPHYEPS
FT                   PSAAKSPATNYPTPTDQTPTGERAPFNPGPPPTAPVPPGTFKCRHPGCTAPPFQTQYLL
FT                   K"
FT   CDS_pept        join(complement(829563..829661),complement(829215..829510),
FT                   complement(828467..829166))
FT                   /codon_start=1
FT                   /gene_family="HOG000131666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904401"
FT                   /orf_name="AFUA_1G02880"
FT                   /product="Phosphotransferase enzyme family domain protein "
FT                   /function="transferase activity"
FT                   /protein_id="EAL88000.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG172419"
FT                   /db_xref="HOGENOM:HBG400850"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000520444"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD2"
FT                   /transl_table=1
FT                   /translation="MAGAVRQPIDIPSLERYLDQNVPIIKTPIDVKQFGFGQSNPTYLI
FT                   TGSDKQQYVLRKKPPGKLLSKTAHQVEREYKIIHALEKTDVPVPKAYCLCEDSNVIGTP
FT                   FYIMEFLDGRIFTDPAIPGVSAEERTALWRDAVRTLAKFHRVVPKSVGLERFGKPSGYY
FT                   DRQIATFTAVSNAQAQAVDVETKKPVGELPHFMDMVRFFSNKATQPLDRGTLVHGDYKI
FT                   DNMIFHKTEPRVIGILDWEMATVGHPLSDFCNLTSPYFLDGTDHKTEQFQPGVVPGLPR
FT                   REDCLRWYREVAGWDPTPDIPWGDAFFSWRSSVIMQGIAARYALRQASSARAQEYAQKT
FT                   GPFALEAWERVKKVQEQVRQKGKL"
FT   CDS_pept        join(829952..830447,830509..830681,830735..830818)
FT                   /codon_start=1
FT                   /gene_family="HOG000028966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269351"
FT                   /orf_name="AFUA_1G02890"
FT                   /product="DUTPase (Dut), putaive"
FT                   /EC_number="3.6.1.23"
FT                   /function="dUTP diphosphatase activity"
FT                   /biological_process="dUTP metabolic process"
FT                   /protein_id="EAL88001.1"
FT                   /db_xref="GO:0004170"
FT                   /db_xref="GO:0046080"
FT                   /db_xref="HOGENOM:HBG051422"
FT                   /db_xref="HOGENOM:HBG436079"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="UniParc:UPI00005201E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD1"
FT                   /transl_table=1
FT                   /translation="MPSQLNSAVRVHRQTRLTNTCIFLLGQLATLLDKYTAISLSSIHL
FT                   TISTQVMTKETTPPPQQSKAPTHEPPSLPASPLAKRTKPDSNNTANSNKMTTGTAPAVT
FT                   SISQPLPPLLVKKLTESAQAPTRGSAFAAGYDLYSAKETVIPAKGKALVDTGLAIAVPE
FT                   GTYGRVAPRSGLASKHFIDTGAGVIDADYRGEVKVLLFNFSDVDFTVKVGDRIAQLVLE
FT                   RIYTPDVMVVEELEESVRGAGGFGSTGV"
FT   CDS_pept        join(complement(832108..832156),complement(831673..832057),
FT                   complement(830977..831613))
FT                   /codon_start=1
FT                   /gene_family="HOG000258174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057640"
FT                   /orf_name="AFUA_1G02900"
FT                   /product="Pyridoxal kinase, putative "
FT                   /EC_number="2.7.1.35"
FT                   /function="pyridoxal kinase activity"
FT                   /protein_id="EAL88002.1"
FT                   /db_xref="GO:0008478"
FT                   /db_xref="HOGENOM:HBG096859"
FT                   /db_xref="HOGENOM:HBG661459"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="UniParc:UPI000051E7F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKD0"
FT                   /transl_table=1
FT                   /translation="MQLLGCDVAALNTVHFSNHTGYRQFKGTRSTAQEIRDLYEGLCQS
FT                   HLTDFDVMLSGYAPSAAAVEAIGAIGLDLQRKAESNPGSFFWGMRNPILVELPANGERS
FT                   TVLDPVMGDQGRLYVNDDVVPEYKKIIHHADLILPNQFEAEVLSGIKITSLSTLAEAIT
FT                   AIHATYSIPHVIITSVRISLFSSSPEATTDSLTVIGSTIKSDGSPRLFRVDVPALDCFF
FT                   SGTGDMFAALTVARLREAVFAADSTLRSTKSWVSPDDVKATDLPLAKATVKVLASMHSV
FT                   LERTLEARDAELRAAASAEETEPGLSEEEKQKREYLRRTKAAEVRVVRNGRFLREPDVE
FT                   FQAQEWKKEDLPEGLQ"
FT   CDS_pept        833711..834865
FT                   /codon_start=1
FT                   /gene_family="HOG000212257" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752279"
FT                   /orf_name="AFUA_1G02910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88003.1"
FT                   /db_xref="HOGENOM:HBG051423"
FT                   /db_xref="UniParc:UPI000051F162"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC9"
FT                   /transl_table=1
FT                   /translation="MKSFSHFSPYWPSRPSQWGETMGPDVCSTSQHHQSGNPKTTSRLS
FT                   TLITLLMVLLLSSVVSAAAIPDDSPPLAHGAFLSRTEAFPGDHLDSGQARYGKTWVIES
FT                   SLADEAATLPILVAPEEVVEEHTSSHLHARSYPGSDSLPTPFDTNLSNNFTAESCPQFF
FT                   NDFLSNSTVTSCYPISLLLHDSTSFFHTLTSATATSHVLDLSCAASVDTCASIFNRLAT
FT                   DLLKADACGKDYELGNPLVASAYTGFITYEPVYRAACLKNPDTKDYCFVDAATNASSPQ
FT                   NLDTYSIPAGYTTDEAPWPTCNECLQASMDIFSRWAQVDGQPLTTSYLPSALALNRHCG
FT                   DNFANVNITVGEKAKTTSGAWKPAAVDWRLVGWTVALSLGTSLL"
FT   CDS_pept        join(complement(837259..837855),complement(835392..837053))
FT                   /codon_start=1
FT                   /gene_family="HOG000212268" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269352"
FT                   /orf_name="AFUA_1G02920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88004.1"
FT                   /db_xref="HOGENOM:HBG329996"
FT                   /db_xref="HOGENOM:HBG435345"
FT                   /db_xref="InterPro:IPR013925"
FT                   /db_xref="UniParc:UPI000051F635"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC8"
FT                   /transl_table=1
FT                   /translation="MATTLPFRPSDDAAHSFPSVLNPSKSNGLPRLSPSPSVIKNRSPS
FT                   SSRSLRRPSGDHLAAPRASRPRRCKSQYPLDSSERHVEYILVASFHIDRGPIMEHQYPA
FT                   PISGDESMLAELMLPDQTHVRSQDWTIFFLHKDTSAEGEDEDSTTAKKKRRKRARAEQN
FT                   PNDESQDEDTDALTEESSDEEDDGGEGPPLMYVLNLPLLLLALEDYFKSPYPETLATLY
FT                   NAVNEMDLSLMPKLSLLERQILQASNAKDMFIEKFEQMIQQRLIEEGEPVEDSPPSPKK
FT                   PAPRYALPRDTHEFESRVIYNDIPIPVKVPTVIWPEIVGDFSLIKLIQTFSTVHATAPQ
FT                   AFPLHPHLTTNGSYTHPIIVLVNAMLTQKRVIFLGHNRPSGEVAEAVLAACALASGGIL
FT                   RGFTRHAFPYTDLTKIDDLLKVPGFIAGVTNPTFANHPEWWDLLCDLPTGRMKISSHIE
FT                   PAPVTEGLLYFQQSSFLQNYTPSAHPDPTGDNAFMEDVQRSITNRHGENAIRAKWRAYI
FT                   TKFTRVAAAFEETVYGASNLYIIGPNEELSPESPSGVQADPLDPTTLRGHGYVWPDEAT
FT                   KQRELIASVSRIEGWRTTRSYYSFIQDIAAMYYPARPIQKPDLHHHHDRLRTLRLSHAD
FT                   AGAIYLAFSKAVKDYAGICQLLTVTPESQAGLFYISMGLFHPDQTVREATADLLDRIAA
FT                   HPAGRHFWAQLSRFNKLAYFRVRRERDAAQSPVSGTGSSPGAPQSLIGIATGNASRRS"
FT   CDS_pept        join(839865..839931,839988..840147,840193..840616)
FT                   /codon_start=1
FT                   /gene_family="HOG000212279" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057641"
FT                   /orf_name="AFUA_1G02930"
FT                   /product="Calmodulin, putative"
FT                   /function="calcium ion binding"
FT                   /protein_id="EAL88005.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG051425"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000051FFB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC7"
FT                   /transl_table=1
FT                   /translation="MTMGPLRRAMTESHNPGLPGRYPNTTNMMAASSDAAARLAPAQLR
FT                   EIREAFQVLDRDNDGSVNKDDVADVLVNIGNYNSGQDASIISQFFPPGSDQTINFPTFL
FT                   NILSSLLAPLSSRQELMNALAAFDDDDSGQIDVAELRDTLLHTASEDGQLPLTEKDINE
FT                   VLSGFTGRRVFSSKAGKLSTGGKRGEVFRYQEFIDSAIGGSASGRRDPDTVAR"
FT   CDS_pept        join(841245..841685,841760..842535,842645..842768)
FT                   /codon_start=1
FT                   /gene_family="HOG000212290" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269353"
FT                   /orf_name="AFUA_1G02940"
FT                   /product="Mitotic check point protein (Bub2), putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88006.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG177607"
FT                   /db_xref="HOGENOM:HBG329998"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000051EEDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC6"
FT                   /transl_table=1
FT                   /translation="MSQPTQAQLDLAALVGSSSPRTMRALRKIQSHQILSSKTSAFSGP
FT                   TSHLSTARSSVNAEAQQAHLDSPVRLRHRRARSNSDAGSGERPILQAQKRSGRKTGSGF
FT                   GIKRSVLETLLRDGPQNGDVEDALKELRYLVLSTRVEADGDGMSTYRVYLWLTLLNIPP
FT                   LPTDEYLSLIHRGRSPAYTKIRNDTFRTLATDPLFKRRVTEASLIRLLNATAWKIHDAK
FT                   AKKRSKSRLSTSRRREMELLINTPPSIAEEEPTDDHANFTATPSSEAITSESAIYVQGM
FT                   NVLCAPFLYVARSEVEAFALFHYFMTSECPGYIRGAMDGVHRGLRLVDRCLEIVEPKLA
FT                   AYLFSKGMQAELYAFPSVLTLCACTPPLPEVLHLWDFLFAYGPHLNILCIVAQLIRMRD
FT                   TILDSPSPNKILRSFPPLDAKEIIALTVLIVRKIPDALYAELIDHAK"
FT   CDS_pept        join(complement(844658..844729),complement(844443..844599),
FT                   complement(844197..844392),complement(843296..844148))
FT                   /codon_start=1
FT                   /gene_family="HOG000212301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269354"
FT                   /orf_name="AFUA_1G02950"
FT                   /product="RNA binding protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL88007.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG051426"
FT                   /db_xref="HOGENOM:HBG323863"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000F51A73"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC5"
FT                   /transl_table=1
FT                   /translation="MPSRDRGRARARASDEEFVLFLQGIPAHCRWQELKDMVRQTALHI
FT                   RQAVVYDDQHGFPTGLGQIIVKNEDEAWRTYHRLSTNGWDGQSLVVTLARTSSPTRPVA
FT                   GPTKSPSCVIPPAYVAGYSTPPRVAQNLAIPPSPISPDTPLVSMTPAAAPAPAYQGQGP
FT                   EYAPVINPVAMPPPPPPYLQPFIPIFTDQLPSIPHSPSLAHSFCDTLAFAMLPTYPIPP
FT                   LHLPHPGHSFTNTNGNNSNTNPRPRTTFHPRKPSSSDQTQQNPRFSPRRTIFIQNLSPT
FT                   TTPHDLTLFLQDAGTIEQCEMPLNPDTGRCKGFARVTFRSADEAKRAISLYNTAFFLGA
FT                   KIRVKIDRSGYFPSGQSQGYPARDGYYLPNRPNQPERKSVENDITPAPGTVDRKSSGPQ
FT                   RVTERDRCQPLVVNGSGLGNKTAVAI"
FT   CDS_pept        join(complement(845227..845455),complement(845182..845198))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752280"
FT                   /orf_name="AFUA_1G02960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88008.2"
FT                   /db_xref="HOGENOM:HBG051427"
FT                   /db_xref="UniParc:UPI0000F51A5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC4"
FT                   /transl_table=1
FT                   /translation="MHDISSSLWNAPLIALCRTDGLDFLQQEIDTSHLWTGKSPISLHT
FT                   RRVDELVAVDARSHPVYYCHYRRLSIIGFISENKTT"
FT   CDS_pept        join(complement(847497..848456),complement(847116..847439))
FT                   /codon_start=1
FT                   /gene_family="HOG000185699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904402"
FT                   /orf_name="AFUA_1G02970"
FT                   /product="Salicylate hydroxylase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88009.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051428"
FT                   /db_xref="HOGENOM:HBG327530"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000520918"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC3"
FT                   /transl_table=1
FT                   /translation="MGKSIIIVGGGMCGLASAIAISKAIFPSQSNLTITVYELRSVPST
FT                   LGGPVNLTPKALRCLDMLGVLDELKQAKAGCEVDTIQILSLRTGKEVGTIDYTGPEGTG
FT                   FGGYKGWRVMRYDLLQAMLRVIARLPAVKIEYGKKLVRVEERPGATAVSVYFEDGTSAT
FT                   GDMVLGCDGIHSAVRWLHIQPDRKPTYSGVAAAYGFVEAKGVLGETGKPFFKDTALLMS
FT                   RYGSVMTTFCDHARELVYVVVLMRTEEQGSREGWKLLEKDQEMVRKEGRRITQQSAIPD
FT                   AEKFIEAVEDWTFYPIYLLPPNGQWATDRVLLLGDAAHAMPPKGESIGHALEDAIKFAE
FT                   VLSRYGVDDPKASFRFFEDIQRKKVEAAHQAAVRGWMPAHDMGAVFSRVFEWITPLFLW
FT                   WMTKEQQQDFLEDPTDIPFPDRDESARL"
FT   CDS_pept        854826..855623
FT                   /codon_start=1
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269355"
FT                   /orf_name="AFUA_1G02980"
FT                   /product="6-phosphogluconolactonase, putative "
FT                   /EC_number="3.1.1.31"
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="EBA27329.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI0000F51AB0"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S0"
FT                   /transl_table=1
FT                   /translation="MTGTSPNLYSLPNTDALAPHLRAYVLRCQNSAINRHNTFRVAVSG
FT                   GSLPAVLAKALLAPSNGSPEDTVRFDKWDVFFADERAVPLDHPDSNYRLLKDELLSKIP
FT                   AEMGTPKVHPIDADHVNDDTQELADLYQEELMRSFAAKDSVKLPVFDLILLGCGPDGHT
FT                   CSLFPGHKLLREKDAWVAAETNSPKPPPKRITLTLPVVTHAVSIAFVATGAGKKEILKQ
FT                   IFDAEEGRELPSALVNQGAGEKVSWFTDHAAVDGVSFPRRGSL"
FT   CDS_pept        join(856246..856293,856392..858170)
FT                   /codon_start=1
FT                   /gene_family="HOG000212323" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057642"
FT                   /orf_name="AFUA_1G02985"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27330.1"
FT                   /db_xref="HOGENOM:HBG323865"
FT                   /db_xref="UniParc:UPI0000F51A83"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S1"
FT                   /transl_table=1
FT                   /translation="MPIPTRSLSLRGQSKQNILLTITKSTAGRTAASKIPPEEGDGDGS
FT                   ADSHSSTSASTSASTSTTDRRKSLLPQRSIPSGDRDRDRDGAAPVRQQQQLETRLQRGS
FT                   RILTKTPGAQKKQEEGVSVSSTAVPATATLANTRRQSLIRPSPLKTGTATATATGAGTR
FT                   TGTNPGGRAATTPKSATFSVQGLSTFPMKRDGVASMSPKRTEMPPPARPTRSASMRQPL
FT                   KAGTGTGTGTGTGAGAGAGSGTPATGVRHVRHRSQIVAPSSSQGQVSRRSDSESSGSTP
FT                   MTTPGLAAGTRPSGQFTTYQQQFSPRKVVRPAASSVASASAHGEDSLIPTSWPEIAALQ
FT                   TELLQLSLLHSSSLQQMAALEAESEEQLQTKYDAVAKTYRAMVGEEKKRQRLLNGQALN
FT                   RWLENASEHGGRPNFAAQIQAFSQLVQEVCDLTDSLEGKYTMLVQKFEEWFRKVQAIES
FT                   MRLHRQQGDANHVVFIDPLDRVWKDEVHVMIVKLEQGLRQLQSLDITDYDGPEPALADA
FT                   ALVRTAKGLDVMIASMVDELKVIRRFEAQIVRSERQWVSQSARSQIGCNPPTRCEGCEG
FT                   REAWNVENCTVEVIDDSIWIFLMDRPWNSLNM"
FT   CDS_pept        join(860186..860343,860417..863187,863240..863496,
FT                   863565..863744)
FT                   /codon_start=1
FT                   /gene_family="HOG000212334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904403"
FT                   /orf_name="AFUA_1G02990"
FT                   /product="WD repeat-containing protein "
FT                   /protein_id="EAL88011.1"
FT                   /db_xref="HOGENOM:HBG051430"
FT                   /db_xref="HOGENOM:HBG330004"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000051E5A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC1"
FT                   /transl_table=1
FT                   /translation="MKDSLYYRIWRRESGYTSPSKSIRGIYGSKEWIDDLDIVNELGGH
FT                   TGCVNALCWSRSGQLLASGSDDLHLNIYSYQPESSSAPFTLNTTVYTGHKANIFSAKFM
FT                   PHSNDRTLVTCAGDSQVRVFDIEYSAGNSNVAATSAFSASARSRRFNNFFSNARYLNER
FT                   NTNCRVYRSHADRVKRIVTESSPYLFLTCSEDGEVRQWDLRQPSSAYPQPRGGQGFMAY
FT                   RPGLEHDDSNVPPPLISYKRYHLDLNTISCPSSQPHYIALGGAHLHCFLHDRRMLGRDL
FT                   LAEKGHPGGLSDSGSHHDDELMGQATRCVRRFAPDGKRRMRPRDNGHITACKISDANPN
FT                   EMVVSWSGDHIYSFDLVRSPDANDPASAAQRSVHGSPCSRRRRNSKNRKRKRQKGASLS
FT                   SQSSGNRHQSRRRSAEHDDSGELAFRVRYGNGEMEDIPFPSLSETVSSAPPNVLEQAQY
FT                   SVLNEAQRLSMRIAKGLVQLRKALFSLEASVREATEAAGPSDLTPYTASFSTVLTLAAE
FT                   HLPRMGEVMRTWRYPLDPSPEVVSFQQSLRRNRESAWRFVQAAGTLARFLGGEIQSLPE
FT                   IEDSTMNLFQQIVPAPGENNVIDTKEQFGYDFIKTILLFFEGGRAAVLAGFKSNPFHRR
FT                   NLARYPIPETADDSDIESVLIPYLQSLAGDYPVVNVDASRFEHDSTRTLFPTQHAAVAA
FT                   FANALQLPLEDLGHTAARVNGDGGTSHQVRSLDRASATRFWVLRVGRGILMETGTGVNY
FT                   AFVNRAFGGLRTEIEDNSDSAFPQERLQEDIDGSVEEEPIQDVNLVTLGTSLNGDSRTS
FT                   NARERRTSPTNGRSGVEDGDSIEHGDAAVVSEDGSDVATEDEGEDEEEDENEEEDEDEG
FT                   GFDMELDSSDEEEDEDEAEEHLINRYGFRRTRREDVELDVPCSSHTKVYRGHCNIKTVK
FT                   DVNYFGLNDEYVVSGSDSGHIFIWDRKTTNLVNILEADSEVVNVVQGHPYEPTIAASGI
FT                   DNTIKIFSPDRHAQDNARRGINILDPDNPANTLGSNVASIGGLKSCKRIHDSYRIMSQN
FT                   DVDRQGGMSEAYITRSMLARLAATLRQRQTTGGTLVDGAGEGATIVLDENCTVSTWLIL
FT                   GILPGMKTKNILCR"
FT   CDS_pept        864409..866082
FT                   /codon_start=1
FT                   /gene_family="HOG000212347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904404"
FT                   /orf_name="AFUA_1G03000"
FT                   /product="MYND domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL88012.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051431"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI0000520445"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKC0"
FT                   /transl_table=1
FT                   /translation="MDTDTNLLLRERSEVTAQLYSDPHNPHRYLARGRIHERLGFSDLA
FT                   SADAYRALSLLESVVDPDGCEFQARRRVDSQHEDQEDEDEEGEFEEISQEEYDGMIGSI
FT                   YGLLVRNLVRCGCYRDAYEFCVRGLALLEDGDRSVVAENEIAGLKEQLRILKKVYAAKH
FT                   GRKEGEEEEEVVVDASVLNAQGYARRVLYPWNTHEPDRKVPETLNLLNERLKDVAPKCE
FT                   VRAVALPALHGTTTAPASSDQSPAEVSVQLGLFAKEDIAPGEILLRESSLLTATNRLHD
FT                   DLCDACNAPLPELSSAEPPVACDGCADTIFCSQKCHDTAQTIYHGAVCGLMDNLESIGK
FT                   DIPDPKDKADYLYLLLLGRAIAMAATQDMHPLDLPEVKYIWGDFHDLDINNPSNSDDPT
FT                   ATLPFSFQLNILQPMRILEEMELDPYANLARYDTWVLNTLYAKFRGTASGRLSTWDGGP
FT                   ELCAVHPLWCLANHSCDPNVRWEWGGEITFRARTEAERAVWKGEGAPVRRSGEGIKADE
FT                   EILNHYCDIGLDVKERREWARGALGGLCQCERCVWEAATA"
FT   CDS_pept        complement(866374..869019)
FT                   /codon_start=1
FT                   /gene_family="HOG000212368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269356"
FT                   /gene_name="cwc22"
FT                   /orf_name="AFUA_1G03010"
FT                   /product="Pre-mRNA-splicing factor cwc22 "
FT                   /function="binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL88013.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG371314"
FT                   /db_xref="HOGENOM:HBG525721"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F656"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKB9"
FT                   /transl_table=1
FT                   /translation="MTDSVVLQSAVRVPTPPPGTSYSPQPSVSRKRSPPSRSPSPRRRR
FT                   SPPGDSLKENGDAPRIDPERAVERERQLAERLRQHEKREAARKPMTEEEKQAAAKAEYE
FT                   KLLNMRSGGTYIPPARLRALQAQITDKNSKEYQRMAWEALKKSINGLINKVNVSNIKFI
FT                   VPELFGENLVRGRGLFCRSIMKAQAASLPFTPIYAAMAAIVNTKLPQVGELLLNRLIVQ
FT                   FRKAFKRNDKAVCISSTTFIAHLCNQQVAHEMLAAQILLLLLHKPTDDSVEIAVGLTRE
FT                   VGQHLEEMSPPIALAVFDQFRNILHEADIDKRVQYMIEVLFQVRKDRYKDNPAIKDELD
FT                   LVEEEDQITHRIGLDDEIDTQDGLNVFKYDPQWEEHEEAYKKLKAEILGEGSDDDEEDE
FT                   DETDESSDEEEEERQMEIKDQSNTDLVNLRRTIYLTIMSSIDFEECCHKLMKISLPPGL
FT                   EPELPSMIIECCSQERTYSKFYGLIGERFAKINRLWSDLFEAAFAKYYDTIHRYETNRL
FT                   RNIARFFGHMLSTDAIGWHVMSVIHLNEDETTSSSRIFIKILFQDLGEHLGLAKLQERM
FT                   RDEILRPSFEGLFPLDNPRNTRFSINYFTSIGFGILTEDMREHLKNLPKPTVPALPARD
FT                   AESDSESVSSHSTCSTCTGSSRSRSRSYSYSRSPSRSRGRRRSISRGRSYSRSVSGSSR
FT                   GRSYTPSYSRSRSPVPKSRRRSVSYSRSRSPAGRRRSSVSRTPPRRVRGKSYDSRSPSR
FT                   SVTPPRRRTSYSRRDRSYSRSLSRSVTPPLRAVDARARGRRYSSQSLSPPRRRAERSVS
FT                   PQRPPPGRRPRGDSLSRSPSPPPRYAREQRRRRNSSSASASRSPPHRDSNRRRSLSRTP
FT                   PRRGRASDYL"
FT   CDS_pept        join(869373..869429,869489..869671)
FT                   /codon_start=1
FT                   /gene_family="HOG000212369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269357"
FT                   /orf_name="AFUA_1G03020"
FT                   /product="Dolichol phosphate-mannose biosynthesis
FT                   regulatory protein Dpm2, putative "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="integral to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="EAL88014.1"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0030176"
FT                   /db_xref="HOGENOM:HBG174270"
FT                   /db_xref="HOGENOM:HBG320519"
FT                   /db_xref="InterPro:IPR009914"
FT                   /db_xref="UniParc:UPI000051F15B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKB8"
FT                   /transl_table=1
FT                   /translation="MLLVATAIFLYYTAWTLLMPFVDTGHPLHDLFPPRVWAIRIPVIL
FT                   TLLGSAVVGTFIGLVMINSNRKKAAKAAAAKKKT"
FT   CDS_pept        join(871248..871441,871515..874638)
FT                   /codon_start=1
FT                   /gene_family="HOG000212380" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269358"
FT                   /orf_name="AFUA_1G03030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88015.1"
FT                   /db_xref="HOGENOM:HBG051433"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000051FB25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKB7"
FT                   /transl_table=1
FT                   /translation="MPPAASDDLFRQQGRDSGDLSPLPPEFTRPSPENNDNIGKTKKKG
FT                   KNGKGGKGAKAVAKSPPDDLIDTSPPVLPEPASYSDPPSGPPSDPVASAIPDAFGSLMG
FT                   TAENDLAVRTGTWAKSIPYGKSPPNDGINGELAGGSPLSFPTHLDKGGFSQPSSTSPPP
FT                   RRRPLSYGNGYLSSNLSRQQSVDRQKSHSLSGPYDGHIPLPHLPQPHFYGAPDIDLPPF
FT                   TGSHRPAGDEGYSFCCFDTLSGPAFKSSKMGGTVMLVGTDGALDVLAIEDRKTRLVGKL
FT                   SGLRGRVIEAKILASTSSNDPFISSRPHVAIIIHGPCASCEDECRISSAGSETNEIPPS
FT                   QTGRLPPGEKRVSKDEPKLYQTRVEIYSLRSGDQIATLFTTKPTPCFENIPGLPALAPS
FT                   PIGNLKLLVSGNYIVLASGVSGEVYVYGLNPFSQSCAYQCLGKTWTSVQTREARRYSTS
FT                   SSSTDPDASRNDSPHGSAVSDYPVVALRGRWLAIVPPSSTYRASICGRVPASLIQGKAF
FT                   GLETRSPPAKPPVTSATDVGEGESLFDKVARGVTQELVRGARWMGDQGLQAWNSYWNKD
FT                   QSQNTSSRRSPNFMDLPQQGYSLFPPTHAQETQTTSSTEPDFVSILDLRRLDDGGEAKN
FT                   AILNPIVTFQAPNGCSFLSFSPNGLMLLTASKKGDVQYVWDLMQARHCRAGVFFSEDST
FT                   PPSANVRQVARFARLTTSSIVDVIWSPPSGDRLAVITRKGTVHVFDLPRSAFQWPPFRR
FT                   ARPQPHKSQANNSPTDEATDRGAVTNPLSAAFKLVGGKTQPILAAVRGRTPSASSAFPA
FT                   VSAFAMPSAAGVRSGRAVAAGLSKSMGAATGTVNTLRHAGENRLHLSGLARDPAASRVV
FT                   WISNKGLSFLGVVDNGFFRLYRVKRSMSSHRNRQLQSVIGNKEIEYKLPANLQIPCGPL
FT                   LIGTFAHEHTVSAILTLPSLNSRPHNTSKIRCQPLSQAEIETNAPYQPFHTDHRVNLFV
FT                   FSNENEVCDPLTGGPGGQWIFGDSISLTKLHVRPFSAGSGTGDEDDIVHEQHHGYGGEM
FT                   ENLISLGNSTGNVEEVVITTRRKKRHSTAVSATPGASVDDGFFEDDCEVLDFARDRV"
FT   CDS_pept        complement(875093..875824)
FT                   /codon_start=1
FT                   /gene_family="HOG000034252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057643"
FT                   /orf_name="AFUA_1G03035"
FT                   /product="HD superfamily hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EBA27331.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG684073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniParc:UPI0000F51A51"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S2"
FT                   /transl_table=1
FT                   /translation="MAPPTELHHLYTTMAAFVTSCMSAHDPSHNPAHVHRVVTLARTIL
FT                   EKEQLLHPDITYDEDVVKLAALLHDIGDRKYLTQVAAATSAAGEQQQQQAAVDPGRMVE
FT                   QALLAHGADVALAARVQTIVTHVSYSKEVKDPATVRRLIDEEGYVELAVVQDADRLDAL
FT                   GAVGIGRCFTFLGAQGRKYLSPEEPWDMNNAIAHFQDKLERLEGMMKTQTGREMARVRT
FT                   QRLIEFRKWWEEEMEEATHIP"
FT   CDS_pept        join(complement(877289..877409),complement(876946..877224),
FT                   complement(876725..876873))
FT                   /codon_start=1
FT                   /gene_family="HOG000212391" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269359"
FT                   /orf_name="AFUA_1G03040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27332.1"
FT                   /db_xref="HOGENOM:HBG323866"
FT                   /db_xref="UniParc:UPI0000F51A57"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S3"
FT                   /transl_table=1
FT                   /translation="MKFNIIAVSSLLVLATAQSTTESAPSTTTSLSPEASCAAKCGSND
FT                   ICCVAGCYNVPCPSDQQANDTISCVAACPQGSGTPSDTDKYAACQNSCYSSHFFPATMT
FT                   NAGSAKTGVSSNTATTTGTGSSSSETGTSGSDSTASGSGTATSSSTATSTPNAAVVSQM
FT                   QLGVSAAGLLGFVLAAWAL"
FT   CDS_pept        join(878846..878963,879059..882246)
FT                   /codon_start=1
FT                   /gene_family="HOG000076770" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270332"
FT                   /gene_name="mph1"
FT                   /orf_name="AFUA_1G03050"
FT                   /product="ATP-dependent DNA helicase mph1 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88017.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG051435"
FT                   /db_xref="HOGENOM:HBG330009"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051E58E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKB5"
FT                   /transl_table=1
FT                   /translation="MSVSGDDFDDYFDDEIDDVIVPGTSDTVESVQTNNRPAKQSDISI
FT                   SQGNEEDEFQSPDRLSGNAVQFEDVERTSKYNVFIPKCKNVQENIFVTQLTQPPSPPEM
FT                   IRGPRWKKPGPEPLAPEPATTRVGANHQSDQYHDEDKEMEAAIAASLRSFEEENGGDVP
FT                   STASGSTPARTAAAPCAAPKGTAADVPFDLDDIPDDAFDSDLSLSPPRSTSQATRGPPV
FT                   QSQFRTNRPLGLRQSTLFDMAARNPDISSQRGEQIFSPPEKSEPPTHHKLNEEALNTWV
FT                   YPTNLGKTRDYQFNIAQRGLFHNLLVALPTGLGKTFIAATIMLNWYRWTKSAQIIFVAP
FT                   TKPLVAQQISACFQVAGIPRSETTMLTGEAAPGIRAEEWKSKRVFFMTPQTLVNDLKSG
FT                   IADPKRIVLLVVDEAHRATGGYAYVEVVKFLKRYNKSFRVLALTATPGSTVESVQAIID
FT                   DLGIAKVEIRTEQSLDIREYVHARDTEVQTFQNSDEMVLCMELFTRTLQPLVDQLRNLN
FT                   AYWGRDPMALTAFGLTKARQQWMGSDAGRNANLALKGKVNAIFTVLASLAHAIDLLKYH
FT                   GITPFYRHLLHFQSNTDGQKGGKYQRQIVQDESFKKLMNHLQPWTKNPDFIGHPKLEYL
FT                   KQVVLNHFMDRGEGTAANGDQSQSATRIMIFVHFRDSAEEVVRVLKRHEPLIRPHVFVG
FT                   QSSAKGSEGMDQKTQLSIVQKFKKGTYNTIVATSIGEEGLDIGEVDLIVCYDSSASPIR
FT                   MLQRMGRTGRKRAGNIVLLLMQGKEEESYIKAKDNYEKMQQMIASGTRFTFHDDKSPRI
FT                   LPPGVRPVAEKRQIDIPVENTQADLPEPRRRARPPKRPPKKFHMPDDVETGFAKASSLT
FT                   GKVTKKAETKRAVRKPTPEPVEVPALEEVLLTPRQQQDLERRYCHIAGTSPEFIRNPRV
FT                   DAYPRLQSVPRPTKAVKHGSLTSRMIGTLQKMGKVSVDCESRYRKVLALDSSKEIVDSV
FT                   LSRDPWPPAKNSGRLGEKTHAFKRPSATPRPNNVHVREDENEDNCTPELVSPEKLMSSF
FT                   LEPHTERPPYSSQRSQDAFELDFPDVETLLNRSAERHVSRKRNRFVLDDDSDE"
FT   CDS_pept        join(882423..882562,882713..883092,883154..883423,
FT                   883494..883672)
FT                   /codon_start=1
FT                   /gene_family="HOG000041208" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270333"
FT                   /gene_name="cap2"
FT                   /orf_name="AFUA_1G03060"
FT                   /product="F-actin-capping protein subunit beta "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /biological_process="actin filament capping"
FT                   /cellular_component="F-actin capping protein complex "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88018.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008290"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="GO:0051693"
FT                   /db_xref="HOGENOM:HBG016210"
FT                   /db_xref="HOGENOM:HBG445391"
FT                   /db_xref="HSSP:1IZN"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="UniParc:UPI000051EC96"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKB4"
FT                   /transl_table=1
FT                   /translation="MPPPLSPRARTLVGQVKRNVQFHVELHQYNTNPTPHTMADIQFDS
FT                   ALDLLRRLNPRDTKQNLQAITSIVPDLTEDLLSSVDQPLEIRRCPKTNRDYLLCDYNRD
FT                   GDSYRSPWSNEFDPPLEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVYFWDLDD
FT                   GFAGVILLKKGVTPGAKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANENEALGEM
FT                   DLSGNMTRQMEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGELRSK
FT                   PLLCHGRTKAMDADKNTGLAPLSETNKEKAAHLEMIRSMQR"
FT   CDS_pept        join(884975..885160,885417..885555,885612..885655,
FT                   885705..886519,886572..887625)
FT                   /codon_start=1
FT                   /gene_family="HOG000212424" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057914"
FT                   /orf_name="AFUA_1G03070"
FT                   /product="Transcription initiation factor TFIID subunit,
FT                   putative"
FT                   /function="transcription regulator activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88019.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG027600"
FT                   /db_xref="HOGENOM:HBG559818"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051EA2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKB3"
FT                   /transl_table=1
FT                   /translation="MSAPGGAPSPAPRSASIGPGGGGMSMPPQQPMGNTTPVGAPTPGP
FT                   PPPPPSGAMSQQNLNQIVIDYLAKKGYSRTEAMLRMESANQEIDGRPLPPLGEDARPKY
FT                   RMGFDILKAWVEDNLDLYKPELRRVLWPLFVYSFLNMVTSFYPQEAKQFFDINKNLFLP
FT                   EHTDDIRKLEPISLPEHVQDNATAKLYRNNKYRLVLSNPAFSNLMQFLENKSKEGGSVM
FT                   SAILSSYCTIITKERASDDRFSFAAMLGQAGAGQTFPAEDEGIPGHHPGSAYTGDNPAM
FT                   AGTLPRLRLGKLPMESTLETDVRGELADEDVKNPPAPGHNSLVQEFDQMIKKEEDEEAP
FT                   SRADIPYPPSTARDVALEVQKVKENRDRFRIEGRTGGVGPAVSVCMFTFHNTYDGINCL
FT                   DFSDDNMLVAAGMQESYIRVWSMDGKKIQTTYDNVDDAPPSNSRRLIGHSGPVYAVAFA
FT                   PSATRSEGAVAPTNARWLLSSSADKTIRLWSLDLWQCMVVYKGHDQPVWDLQWGPFGHY
FT                   FVSGGHDKTARLWVTDHIRQQRIFVGHDQDVDCVCFHPNSAYVFTGSSDHTVRMWAVTT
FT                   GNAVRMFTGHTGNITALACSRDGKLLASADDQGSILLWDLAPGRLLKRMRGHGKGGIWS
FT                   LSWSVESTVLVSGGADGTVRVWDVTGPAQDPSQGRVVGDGGAGTKVDGGNPSAASTQPS
FT                   TSVAPGMGKKKGKDVVVTPDQISAFPTKKSPVYKVKFTNMNLIIAGGAYLP"
FT   CDS_pept        join(complement(889295..889488),complement(888696..889180),
FT                   complement(888547..888637),complement(888221..888474),
FT                   complement(887920..888158))
FT                   /codon_start=1
FT                   /gene_family="HOG000212435" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752512"
FT                   /gene_name="ppe1"
FT                   /orf_name="AFUA_1G03080"
FT                   /product="Protein phosphatase methylesterase 1 "
FT                   /EC_number="3.1.1.-"
FT                   /function="carboxylesterase activity"
FT                   /protein_id="EAL88020.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG011241"
FT                   /db_xref="HOGENOM:HBG736614"
FT                   /db_xref="InterPro:IPR016812"
FT                   /db_xref="UniParc:UPI000051EECA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WKB2"
FT                   /transl_table=1
FT                   /translation="MSDLHKAFAKSKLAKLPPEAPLLSESSSMNHPAESSHDEDSSSVS
FT                   STGTVIPSPSRQLFARASQGSSDSSSLSWSDFFAKELFLTRETDTLRIIHHVYLTPPTD
FT                   SGPLFVMHHGAGSSGLSFATCAEEIRKILPKAGILSLDARDHGRTSVQRTDGGAAELDL
FT                   SLETLNQDLVYVARKTQAEMGWEELPDLVLVGHSLGGAVITDVAKKGELGNKVLAYAVL
FT                   DVVEGSAMDALQSMEKYLSTRPSRFPSLTSGVEWHTRSRTIRNRASARVSVPSLLYKEE
FT                   TPSDPAKPWVWRTNLSATKPFWEDWFIGLSRKFLEARGGKLLLLAGTDRLDKELMIGQM
FT                   QGKYQLQVLPEAGHFIQEDMPAKTAQILVDFYKRNDRSALVLPPKVADMRASAAMQKGA
FT                   GAGASFSALHGGSSAGHLHKP"
FT   CDS_pept        join(891235..891390,891460..892887)
FT                   /codon_start=1
FT                   /gene_family="HOG000212436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270334"
FT                   /orf_name="AFUA_1G03090"
FT                   /product="Mitochondrial integral membrane protein "
FT                   /protein_id="EAL88021.1"
FT                   /db_xref="HOGENOM:HBG123898"
FT                   /db_xref="HOGENOM:HBG330014"
FT                   /db_xref="InterPro:IPR019431"
FT                   /db_xref="UniParc:UPI000051FFA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKB1"
FT                   /transl_table=1
FT                   /translation="MVSLWRRSGDSEREEQGRDGDDRSRGQYQEADERTRLLPRENHGY
FT                   LSPDDPAVSPYNLWSVRALRAFSSFCLAVSFVWWTFLLVSIFVSPPMMHSRGSGFFSFA
FT                   YTTLTVGYLVIALLFFTIPSKAMTISGIVLAVFLFVDMCIILGVPQLRVEEGWVGIASV
FT                   VWATLISIFNVLQNRTVAWGKREEEERLTGREETRRSLREWIAVLIDTIFMVVFAIVSI
FT                   LFTATLIIRARDASLPAPGQKYLVHGEKYQVHLACVGPLNGTADGNGKKPPTVLLEGGE
FT                   GPVEHSLQPFIDDVYKQGLIDRYCYWDRPGYAWSDNAPSPHSAGMAADALSEALALAGE
FT                   EGPWILVSSGIGSIYSRIFSSRHLLETQGIMLIDAMHEDYLGQVGNAGRGFLLWLRGVL
FT                   SPLGLDRLFGALFKGRTREDRVYGRSAYQTDKFLKAKLQENLVAESMTASEIQTARHVQ
FT                   MPDTPLVVVSSGIEVRRSDKWAKTQEDLTKITKNLKEWDIVKGAPHEVWKTTEGRQVLG
FT                   KRLKEMVKGE"
FT   CDS_pept        join(complement(895827..895958),complement(895730..895752),
FT                   complement(895515..895645),complement(895321..895409),
FT                   complement(895168..895257),complement(895076..895108))
FT                   /codon_start=1
FT                   /gene_family="HOG000216023" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270335"
FT                   /orf_name="AFUA_1G03100"
FT                   /product="ATP synthase delta chain, mitochondrial, putative"
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="EAL88022.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG343819"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI000051F8B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKB0"
FT                   /transl_table=1
FT                   /translation="MSSLRFARSALRARPSALRVPLQRRGYAEAVSDKIKLSLALPHQT
FT                   IFKSADVVQVNIPAESGEMGVLANHVPSIEQLKPGLVEIVEESGANKKFFLSGGFAVVQ
FT                   PDSALSINAVEAYPLEDFSADAVKSQIAEAQKIANGSGSEQDIAEAKIELEVLETLQAV
FT                   LK"
FT   CDS_pept        join(897008..897014,897122..897173,897364..897466,
FT                   897539..897574)
FT                   /codon_start=1
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270336"
FT                   /orf_name="AFUA_1G03110"
FT                   /product="60S ribosomal protein L29, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88023.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG242797"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI000051FB1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA9"
FT                   /transl_table=1
FT                   /translation="MAKSKNASQHHRSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRH
FT                   ALHGTMKALKERKEGKREVA"
FT   CDS_pept        join(complement(899398..899647),complement(898105..899321))
FT                   /codon_start=1
FT                   /gene_family="HOG000212199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209223"
FT                   /orf_name="AFUA_1G03120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88024.1"
FT                   /db_xref="HOGENOM:HBG051438"
FT                   /db_xref="HOGENOM:HBG329985"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00005206A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA8"
FT                   /transl_table=1
FT                   /translation="MTTTTQLASVLVARFLRSNNYTETLNVFIREAGLPADAGQLSGKT
FT                   DKNEWTIEGVLQEKQVFDESVKFERYGQSEEENVWTVPAPSTPNVIQTPSSANLLACSV
FT                   EPWQNPSQEENQEGASHYIVATDADRQVHLFKADKGNDVVTSFAGHSDSPVLSYATIQN
FT                   GKYVLMTNMSGQLLLQRGAEILSRRKDHAKYAVKVIAYEDEQPGETASNAVWVATAGWD
FT                   SKILLYRLRIPSRAGDPAPVELKEPITSINLLTNPESILFVRHPDTKELVLLASRRDST
FT                   YLFYYAVPPSTPTEAPTECKLLGKQNLAPHSNAWVAFSPSCLALSPHDPGLIAVAASTL
FT                   PHMKVIIVRLLFPNQGPSEPTPSMGGTSAQPETQATQAFEALALQNREDAAIMIQANTF
FT                   APQTVYSTPQVVWRPDGSGVWVNGDDGVIRGVEARTGKVTATLKDGHQVGSKVRAIWAG
FT                   WVQVQRDGKVVKEEWLISGGFDKRLIVWRV"
FT   CDS_pept        join(complement(901337..901471),complement(899971..901266))
FT                   /codon_start=1
FT                   /gene_family="HOG000212188" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270337"
FT                   /orf_name="AFUA_1G03130"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL88025.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG051439"
FT                   /db_xref="HOGENOM:HBG329984"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniParc:UPI000051F3F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA7"
FT                   /transl_table=1
FT                   /translation="MEVASMTQPDPTNGAHLTSIAMDASMDIDMDIDLGPLPEPESIEI
FT                   EPATTTVTTQDGLVDPTTAEAQYEKVHIRGVDDLTTDNIKQFATDYFSGETPSRIEWID
FT                   DTSANIIYSSPEVGLQALAAFTQASEEEDTSSFPPLRLRSAKALSTHPESVLQVRSAVK
FT                   TDRKKPRAYEASRFYLMHPEHDPREKLRRELAERRRQGGQGSSDGDYQRRRFDGRELRR
FT                   RRDRDADDNFSANMYDDEGPRASTDYSDSERGRNGRTRRGQRELFPDEGRLSGRLRNRS
FT                   ASPGRDTLAESGRLEQEERGTRSRFRERSPQLIRRNEGKELFPSRTSDSDSNARELFPN
FT                   KPASSYLKKELFPSKQSNHRRSDAIDAADETADLFSRRISVPRADGARDQNSSRNKNIE
FT                   LFPDSEDQTGVSIRGAAGQDQGISIRGAANGMSIKGRGSSVRELFPSKYNSNAGKELFS
FT                   DKIEGRGGPRRRAEDMFG"
FT   CDS_pept        join(903122..904004,904065..905146)
FT                   /codon_start=1
FT                   /gene_family="HOG000212187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270338"
FT                   /orf_name="AFUA_1G03140"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL88026.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG329982"
FT                   /db_xref="HOGENOM:HBG502063"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000520919"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA6"
FT                   /transl_table=1
FT                   /translation="MLYAEGDKLIYRFDDHILWIQPWSENAFRIRATKLASMPSEDWAL
FT                   SAKPSTQQPIIETPAGKEARISNGKIKAVVSQRGKITIYNSNGKKLLEEYARHRRDPMD
FT                   PKCSALEIEARELRPILGGDYHLTLRLESLDPKEKIYGMGQYQQPYLNLKGADLELGHR
FT                   NSQASVPFALSSLGYGLLWNNPGIGRAVLGTNIMSFEAYSTKVLDYWIVAGDTPAEIEE
FT                   GYCKVTGYVPMMPEYGLGFWQCKLRYWNQEQLLNVAREYKRRNVPLDVIVVDFFHWKHQ
FT                   GEWSFDPEFWPDPDAMVKELKEMNVELMVSIWPTVENLSENYPEMLERGLLIRHDRGLR
FT                   VAMQCDGDVTHFDATNPEARKYIWEKAKKNYYDKGIKIFWLDEAEPEYSIYDFDIYRYQ
FT                   AGSNLQIGNIFPREYARAFYEGMEAEGQKNIVNLLRCAWAGSQKYGALVWSGDIASSWG
FT                   SFRNQLAAGLNMGLAGIPWWTTDIGGFHGGNPADPAFRELFTRWFQWGTFCPVMRLHGD
FT                   REPKPEGQPTAPGADNEIWSYGEEVYEICKKYIDIREELRNYTRSLMKEAHEKGTPVIR
FT                   TLFYEFPEDKKSWEVETQYLFGSKYLVAPVLEAGQRKITVYLPEGALWKLWGEETERPG
FT                   GQDVEVACPIETMPVFVRV"
FT   CDS_pept        join(905914..905999,906054..906358,906409..907514)
FT                   /codon_start=1
FT                   /gene_family="HOG000193296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270339"
FT                   /orf_name="AFUA_1G03150"
FT                   /product="C-14 sterol reductase"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL88027.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051733"
FT                   /db_xref="HOGENOM:HBG592488"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniParc:UPI000051E7F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA5"
FT                   /transl_table=1
FT                   /translation="MAPRKDFEDKATVPIQPVPGKRGYEFGGPLGAFVFIFGLSTLIYC
FT                   LTFLCNDVSGCPVPSLLNPSTLSLDKLKEEAGWPQEGLKAFFDVRVTVWVLSYYVLSLV
FT                   LYVFLPGEVVEGTELACKGRLRYKFNALPSAILILGGLALGTYMHGADFVVWTFLWDNY
FT                   VQIITANLIICVVLAIFVYARSFSIPAPGQPNPELRELAPGGHSGNALYDFFIGRELNP
FT                   RVQLPIPFVDEASRTIDINVWCEMRPGLLGWIILNLSNIARQYRTYGYITNSIVLSTVF
FT                   QTFYVLDALYMEPAVLTTMDVIMDGFGYMLSFGHLVWVPFIYNIQTRYLAVFPLELRLR
FT                   EILLILAVTGAGYAIFRGANNQKNRFRRDPSDPRMMHIKYIQTSSGSKLMISGWWGLAR
FT                   HINYLGDWLMSWSYSLPTGIAGYTIIESINSSGDMQKQAIQTPEVRGWGMIFTYFFLVY
FT                   FGALLIHREGRDEEKCKSKYGTDWERYTSIVRSRIIPGIY"
FT   CDS_pept        908917..909597
FT                   /codon_start=1
FT                   /gene_family="HOG000048289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057915"
FT                   /orf_name="AFUA_1G03160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88028.1"
FT                   /db_xref="HOGENOM:HBG051440"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000052091A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA4"
FT                   /transl_table=1
FT                   /translation="MPQVETYSSKILSGVGILLSPLRSFLDHPHAIPYGLSLLLYTAVQ
FT                   AHLFPAIMVFASIRLHFSAFQNGLLVSIAAACASVSLFLKVFIMPRVRWLRLNSERPTD
FT                   STAILAALVIQMHALIGITQVRNAGQLYLAVSVAAAGLALPAFFKGHFVSLTPDASRAI
FT                   SALTFMENLGGLVSPFVLGSWQSFAPGPSVFIFAVAVLGVSLGLFLWGEVLRFITPTAQ
FT                   QSDD"
FT   CDS_pept        join(910844..911173,911261..912146,912215..912913,
FT                   912974..913875)
FT                   /codon_start=1
FT                   /gene_family="HOG000048290" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209224"
FT                   /orf_name="AFUA_1G03170"
FT                   /product="Esterase, putative"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL88029.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG051441"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000051FD97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA3"
FT                   /transl_table=1
FT                   /translation="MAHLLFFTVLNLFLSLLSSMVTGAAASATRSTTHSRNIDFDAAGW
FT                   HPSIAERDDAPKVPLRILPLGASITWGYLSSTGNGYRKPLRDKLRFEGWEVDMVGSKSN
FT                   GDMRDNDVEAHSGDVITQVHTAATNSLVYKPNVVLINAGTNDCDRNIDPANAGARMRSL
FT                   IETLIHAPDMARTLIVLSTLIPSGSTSVEANRPSVNAQYRALVSNMRAGQNVSIVLADM
FT                   DPPAPSPGNNWIKYPDSYADNKHPNDYGYSQMADIWYNAIYDAAKAGLIVEPADLSISP
FT                   PGTCDKEYGSGVYAGGFTQQGTGEDDGIYRHDSEYSGALFSVRAGKGALDPYRDDDELF
FT                   FFFGRLYTREYDDLIIFQKDTESGAVTFVPYTNHVHTEKKEFTKGGSFSTHNNCNPGGV
FT                   HFIDVNGDGLDDYICIALDGTTYASINNGDGDAGRNKPPSFTDIGLWKSSEGHDQAHVR
FT                   LADIDGDGRADYCVLADNGDITCWRNGWIEDVPAYWQPLGKRFTGKGMGDPRGVRFEDI
FT                   NGDGRDDWMWVDDDGATTTYTNSRSCIKGEVGDGLNVVWRQGFYQDANSGPTHPGMGGL
FT                   FGTSGLRDQVYFARIYGEAADFGELGRQDYVFIEKDTSDKNLGPMYRIHVWKSKGAGGA
FT                   KIKADGDRYCNMMGHNNGMMDYVWIHSTGRMRLYPNRGLVEVPTDGSSFWGGNQIIFDP
FT                   TKEQIGTKLDRRDLHLADWDGDGACDIIWTDPDNQNKVQVWRNMIKETGRFNWEYHSSA
FT                   ATQLYCPEHRGLGFFDRPVHFADVSGNGKADYLCVEKDGRTWGWVNGDDGWEYIDQFKS
FT                   SEQKDRANLHWADVNGDGKADMIWTDKFSGDGSVWYNLGRRDIKGSRYEWGPQGPRYQG
FT                   AVEGSCTYFPDLDGDGRADMHSIWDSINNTAQTWYNQCAIKDHTGDDGPITDPNLPVSP
FT                   ASIDVVPH"
FT   tRNA            917096..917192
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        join(complement(918485..918565),complement(918175..918401),
FT                   complement(917954..918050))
FT                   /codon_start=1
FT                   /gene_family="HOG000256797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270340"
FT                   /orf_name="AFUA_1G03180"
FT                   /product="DUF636 domain protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="EAL88030.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="HOGENOM:HBG051442"
FT                   /db_xref="HOGENOM:HBG684755"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI000051E58F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA2"
FT                   /transl_table=1
FT                   /translation="MATPTTATGGCFCGNVRIEYSGQPMTSGLCHCRDCRKLTGSLYSY
FT                   NLVVKRTDLKITGSPKELPKIADSGRHIKNYFCGDCGVSNPVLSYPPPQPPLLELERRK
FT                   PEAEIFTCGRVSWLSPVEGTDQFVGMVPLP"
FT   CDS_pept        join(complement(921283..921675),complement(921086..921224),
FT                   complement(920587..921020),complement(920349..920523),
FT                   complement(919916..920331))
FT                   /codon_start=1
FT                   /gene_family="HOG000217099" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752513"
FT                   /orf_name="AFUA_1G03200"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL88031.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051443"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005201F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA1"
FT                   /transl_table=1
FT                   /translation="MTSNKKSRLPPYQPGEHVSPSVHLNCVLLTTTVVNFLDLFQLSSV
FT                   LFALPNIQQALGFASEDINWVLIVYNITFAAFLLIAGQLGQRFGLEKIFIAGTATLTIS
FT                   NVINTTAPNKGALLAGRAISGVGAGLTAPNGLAILSNTFPDPESRNKALAIYTACGPLG
FT                   STIGTVVGSHLACMSGWRSIFWLCLILTGLSTILACLFLPRFAKRKDMPIDIPGTVVFT
FT                   AGVALLVYGLNDSSRRGWTSAAMLTGIILGVCLLFVFLWVEAKVSNPAISSYLWKSGPF
FT                   LVMLVAIFAFGGSFSTWFFISTQLCVNLLGYSTILTAVYFLPAAFAAIASGVFATPLIR
FT                   LAGEKNILVAGLAITAAGAVAWAFAGPRIGPAVPTTGRDTAIIFVIGSPVALVPTQSIL
FT                   LREVEAGNHAVAGALFNTAYQVGASVILAGANALMDRSRANVQGVRQVTIDGYLNAFWL
FT                   IAGVLGAAALTVMVCYWPGKDDLVERQTEEANAVGPLAVDKVDTSKDATASARSVADTR
FT                   L"
FT   CDS_pept        join(931344..931486,931651..932038)
FT                   /codon_start=1
FT                   /gene_family="HOG000048291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270341"
FT                   /orf_name="AFUA_1G03190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88032.2"
FT                   /db_xref="HOGENOM:HBG051444"
FT                   /db_xref="UniParc:UPI0000F51AAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WKA0"
FT                   /transl_table=1
FT                   /translation="MPCREDDGVWPSHPTRLVSSRLSLNQPALQGDRPTCLFALASAVA
FT                   TRTQIAWYTFGQPLGAPRVVTVKNGTPKPTACASSQQPLRVYKTRATSNLSGFCTRDKT
FT                   EEKKPIYHPHRPSPALQQSPLAYSSSDPTPSRLELWLSRTGLGVYLWSEVSYPSLSDQK
FT                   KNESNKRVTGVRK"
FT   CDS_pept        complement(932976..933920)
FT                   /codon_start=1
FT                   /gene_family="HOG000212166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270342"
FT                   /orf_name="AFUA_1G03210"
FT                   /product="MYB family conidiophore development protein FlbD,
FT                   putative"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88033.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG051445"
FT                   /db_xref="HOGENOM:HBG329977"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00005201D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK99"
FT                   /transl_table=1
FT                   /translation="MAPTHRRGPWVPEEDQLLLQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISTEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKRRGLSATTTSPSRTFQGRVEAPYPRASTALGSPIDRPRFSLSHNRPLTSWTNSSIQ
FT                   TRRESSAASVDCPRQLSPIYTLPALNRPVETPLTSPSFSDVSPPSMVSDHNSVSSASPR
FT                   TVASPQMLPLPVDLRRPSHASEDGYVSHHAYSSLKTVEPFSDVASKPRWVPDQQPWSHP
FT                   TASSTPTWAPPEPCRSEQQPQRDARMGLDNLLN"
FT   rRNA            942834..942949
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(943147..943387,943593..943615)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057916"
FT                   /orf_name="AFUA_1G03220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88034.1"
FT                   /db_xref="HOGENOM:HBG051447"
FT                   /db_xref="UniParc:UPI000051E7FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK98"
FT                   /transl_table=1
FT                   /translation="MMVVWTPKMADIYIFTAQRPRPLIVSCFSVGPRLYFAAAKASTLY
FT                   ILVTMARMWSQYLSTAPRLCARDAEVQARLAEALTTTTPGLL"
FT   CDS_pept        join(complement(943891..944293),complement(943857..943873))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270343"
FT                   /orf_name="AFUA_1G03230"
FT                   /product="ABC multidrug transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="EAL88035.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="UniParc:UPI000051FFC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK97"
FT                   /transl_table=1
FT                   /translation="MVRCCKNANIYDFIVSLPNGFDTLVGSKGNMLSGGQKQRLAIARA
FT                   LLRNPRILLLDEATSALDLESEKLVQAALDTAAHGRTTIAVAHRLSTVQKAGMICVFNH
FT                   GRIIESGTHSELMQKRSAYFSLSASRLWAEWILSD"
FT   CDS_pept        join(944467..944559,944614..944703)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209225"
FT                   /orf_name="AFUA_1G03240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88036.1"
FT                   /db_xref="HOGENOM:HBG051448"
FT                   /db_xref="UniParc:UPI000051FB26"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK96"
FT                   /transl_table=1
FT                   /translation="MQWLWLLIQSVPWRDARSPVADRTFAAEIHQLTASRKEVHLATGG
FT                   ARPTGQLATPRFVRG"
FT   CDS_pept        join(complement(946753..946983),complement(946147..946719))
FT                   /codon_start=1
FT                   /gene_family="HOG000216984" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904676"
FT                   /orf_name="AFUA_1G03250"
FT                   /product="Short chain dehydrogenase/reductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88037.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051449"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EA2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK95"
FT                   /transl_table=1
FT                   /translation="MHDITLDPLLLGNLTGKTAVLTGGAGGIGTAIAKLLLEHGANVVV
FT                   ADLEHTRPIVETMIVDLPGSCKGRVQFVATNISAKERFGSIELVIANAGVMERTPVLDM
FT                   DQIDEHGNLEESHEFCKVIDINVKGTMNCLRHAIFSMKGNQPCYPDGSRGAVVLVSSIS
FT                   GYFGGTGVSGYITSKHAVTGMLRGSQLVASQYDIRVNAVAPFVTPTAMAGGFSEAWQAK
FT                   GLPINTTEGVATVVLTLAVNPAEKGSCYIVWRSIWHRDNGALLDP"
FT   CDS_pept        join(complement(948171..949046),complement(947968..947973),
FT                   complement(947484..947811),complement(947293..947364),
FT                   complement(947201..947244))
FT                   /codon_start=1
FT                   /gene_family="HOG000048293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270344"
FT                   /orf_name="AFUA_1G03260"
FT                   /product="Tartrate MFS transporter, putative "
FT                   /protein_id="EAL88038.1"
FT                   /db_xref="HOGENOM:HBG051450"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E806"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK94"
FT                   /transl_table=1
FT                   /translation="MHECLLIQPRTLTRSTGSVGLINFEVINPLYSRCTRVLVLWTPTT
FT                   ENAGTPEQRIRASSHSPVLALFSTRRALVSRQTWRRNQSTKHIPGTPDAETIPIRHQQL
FT                   LRKLGWRLLPLCALIYLLNHLDCSNIGNAKVLDAETGEQTGMTDTGYSITLTQFAVAYA
FT                   LFDVPSNWILKRYARPAYWLGTLMLCWGAVTLGFARVDNRFTVMVLRVVIGVLEAGNLP
FT                   WNGLPHHLLVPTGRAFHPHCLHSRNRATLAGAFGGCIVCGVAFLNGKGGLEEFRWLFII
FT                   EGGSTVLIAPLLLAVGFVISILLAWSADRFNARGLHVGLAGVLTGTGFLASRLFPAEAY
FT                   WLRYGCRIVASYGALPSLAPSTAWVTCNAPSARTLGLVAAMNNSLVGLASIPALWIWRS
FT                   VEEDQALGDLNQSALARTYRLHGRNDVILLRVKRIITMGISR"
FT   CDS_pept        join(952523..952674,952711..952987)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270345"
FT                   /orf_name="AFUA_1G03270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88039.1"
FT                   /db_xref="HOGENOM:HBG051451"
FT                   /db_xref="UniParc:UPI000052091B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK93"
FT                   /transl_table=1
FT                   /translation="MRWKYVEFAPKLGDCHPLHDHDLLNDISMAFACRVWRHMHMARHS
FT                   RLCVERRVIDMASAEGLESARNAPSRREGVSGGGSGAVHYTDSIGEQESEFDRRHAGMA
FT                   NSWIVGEIYQVTMAGWYVSVQMVTKIDRLIPEKYSNAK"
FT   CDS_pept        join(complement(954459..954865),complement(954161..954404),
FT                   complement(953713..954093))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057917"
FT                   /orf_name="AFUA_1G03280"
FT                   /product="MFS alpha-glucoside transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL88040.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051452"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F88F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK92"
FT                   /transl_table=1
FT                   /translation="MIVGGQWLASLTVYGSTFRSDADAWRVPLICQIIPPGIVFLAAGT
FT                   ILPESPTWFLIKDRRDEARKAFQRFNGLHFDGGPALDHTLAAIVVEKENASGNHSWIEC
FT                   FQQPNLRRTTIVVMTYLAQQLIGVNFIAGYLAYYYALAGVNHPVAIAQQSYAIQVIGNM
FT                   CSWALIERVGRRRLMVGGCLMMTTMLPVIGGISILNTPTALKVTVALMTVWGFLYQATL
FT                   GACAYAIGGEIPSPALRQKTYALNMVTTTISSTVVYQLMPILINSEKANLGGKIVFVFF
FT                   APSVPLCFYLFFCLPETRGRSFAELEEMFQARVPSRKFKSYQTSLTPAAVLAGKLQGDI
FT                   GTA"
FT   CDS_pept        join(complement(954938..955270),complement(954898..954915))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270346"
FT                   /orf_name="AFUA_1G03290"
FT                   /product="Myo-inositol transporter 1 "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL88041.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051453"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F8B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK91"
FT                   /transl_table=1
FT                   /translation="MIRFGHQVNGTWVLSARDQQILNGALSVGVFCAAIITGFLSDAYG
FT                   RKKAMMIGSIICCAGVMVQYYATSILMLFGGKLVATLGFGIGHSVAPVFVSELAPSSLR
FT                   GICLALIHFGDA"
FT   CDS_pept        join(955980..955995,956032..956104,956226..956460,
FT                   956481..956700,956760..956965,957010..958004,9
FT                   58056..958095)
FT                   /codon_start=1
FT                   /gene_family="HOG000216978" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752514"
FT                   /orf_name="AFUA_1G03300"
FT                   /product="Carboxylesterase, putative "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88042.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051454"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00005208FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK90"
FT                   /transl_table=1
FT                   /translation="MTVPMTPFRGRVLINSCLTASPDLLWNLPRLNPHTAARCSSSCLQ
FT                   VMSTPQSAQAGMQTSSISVRISDKSEFHGIVSALGVAHFLGVQFARIPARFRQAELVHP
FT                   LVMMYGPISPQPPDNSRESRQHLFVGAPAANPKQSEFDCLRLNIYTPRVVISSEEKVPV
FT                   LVWIHGGGWAIENGNADFSGDFLVRHSVENKKPIVFVSINYRLGLLGFLSSSELSEEAA
FT                   QYGEVGWANQGLHDQRLALLWVRQLFHEVRNHIHLFGGDGSNVTIAGESAGAWSVLAHL
FT                   RSDQPLFQRAIIQSAPSWTMILPEEAQLKFNKLLQWAGVPQGATADEKIAALRSVSAEQ
FT                   LIAWNDLLMSPIWDPKWFVGHSSPTSPLDSAEPFPNWVQGIVVGTMRDELSIFGLERFW
FT                   QTKAMVKSSLNHSLSLPSDPDFSTEVLNEYGILEAGSDTEAVRGFIRVATDACFSRLPY
FT                   NLARACDSPDSPYLYVYRFDQVDEERNSPLRGKAFHVLDNTYLCRYPAVAGPAAPRSCQ
FT                   ATADAFSRMILCHTYGEAPWEPYNIRRLQNVFDGTDTRLEEVRLDDQCWRKFLTTEERV
FT                   SIFGRFNNKLFSGLIANW"
FT   CDS_pept        join(complement(958631..958685),complement(958404..958570))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057918"
FT                   /orf_name="AFUA_1G03310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88043.1"
FT                   /db_xref="HOGENOM:HBG051455"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI0000520418"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK89"
FT                   /transl_table=1
FT                   /translation="MSPSSPNRIVPIGLSSVTNHVMLDLTMPVFAHGQLYTSLSRVRRG
FT                   ADICILRNPCENDKPTLNVVYRDLLLPI"
FT   CDS_pept        join(960957..961350,961423..962027)
FT                   /codon_start=1
FT                   /gene_family="HOG000048294" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904677"
FT                   /orf_name="AFUA_1G03320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88044.1"
FT                   /db_xref="HOGENOM:HBG051457"
FT                   /db_xref="UniParc:UPI000051F63D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK88"
FT                   /transl_table=1
FT                   /translation="MGSRNALRKELWRDGLLIAVKNVDSMDTRGSNLMLGQYHTQNFEA
FT                   AFLRDLDMKQHIAAWVVAVELSFAFIAHYLGLRSCKWWVSVGELGVCLTAAFARSLTKD
FT                   RQQRYRVVEKRLDKRCTSTGVIKCQQGGQPMSAENISWYAAKLCHQDYHTTATQILKIT
FT                   GMLIKSTKMAGQLGHRAMIVSFLGGILVTEGLAYPNVRMCAGFRATVSQLAAHTCLLVR
FT                   LILRQPQWMTMHPEFGNGRVPLGSVYIPPINSIVDWWAMSEDRNDALDLQKNLLWSFTL
FT                   VNLAFYPSLLRNHGDDIQLMDAINAAHQGIDMEAEMIAKHLVTFVDESLEG"
FT   rRNA            complement(962754..962869)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(971865..972125),complement(971232..971811),
FT                   complement(969587..971163),complement(968822..969439))
FT                   /codon_start=1
FT                   /gene_family="HOG000217095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209226"
FT                   /orf_name="AFUA_1G03352"
FT                   /product="Alpha-1,3-glucanase/mutanase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="EBA27333.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG323868"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI0000F51A7C"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S4"
FT                   /transl_table=1
FT                   /translation="MLGLLVQAALVGLVLGSRAHLHHVHLHQRQTNSSIHHGYTDLSVP
FT                   PEGAGPSGQLNQTFLRTTSKMMLSDLKVSTPKKSKGVFAHFMVENARDWIELEWAYHIM
FT                   AAKEAHLDAFALNFAASLKDLKPLKSAFAVAEANGFQLFLSFDYVGAGPFDKATVITII
FT                   NEFKSSSAYYTYKGKPFVSTFEGPGNAADWKDIKAETGCFFIPSWSSLGAKEALKLGTP
FT                   DGLFSWAAWPWDNQDMDTYVDASYLDYLGQAGGKEYMMPVSPWFYTNLPGYEKNCLWRG
FT                   DDLWRDRWEEVMVVQPDFVQIISWNDYGESHYIGPLYNIDKYEAFSVGEAPVNYAHGMP
FT                   HDGWRLFLPYYIDIYKNGKASITKEGVVGWYRPNPSSECNDGGTAAITASQLQYEFRPA
FT                   EVVQDKIFYSALLTSMATVTVTVGGVSIPATWQDIPDGGVGVYHGSVGYGTFYGDVKIS
FT                   ISRAGSTIAKFSSAAITTSCTDGYANWNAVVGSAEGPSISAVSPKLAIDEQACIEGTAP
FT                   GNFQGLCKFTCQYGYCPIGACVCTKMGAPRVKPKATGMKGYPIAGEGSSYIGLCSFACN
FT                   YGYCPPEACGPVEVPLTEPTVSPFLPSACTAGTGQGDLAGLCSYACTCTGTGALHQPPA
FT                   ANSTFTAFYQGDGDDAGLCKFACQHGYCPDACASTEGEVPSCDEDDDDSPDCALEDTPD
FT                   LCDLSLHFSSWEALQAATDIPELCMPMYAMQVLMDTLNTALRNYTDVNNGYDEKFGYYV
FT                   KYLRGMVPEVINKVIADNGKYVQYSQAINGGWSKPRSCFIPLVSDSWTVKYTFVNQNMP
FT                   HAKADFTISNPKDSIANALPRFQALQRDVVSTWADLSFFLWDGDEADAVEALSTPVFML
FT                   LQAVESMATVKEVGEQEKEKEEKEKRNLIITIISAVLLILPFAGEIVGPVTGIAWITDA
FT                   ALLADVTASLAMVGYDLIADPKSAPMDLLNILFAGTGRTAGNLSKAASVRRAIKAEDLA
FT                   KFGKVFKENDDLLQGLIRSCKA"
FT   CDS_pept        join(973908..974101,974149..974791)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752515"
FT                   /orf_name="AFUA_1G03360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88048.2"
FT                   /db_xref="HOGENOM:HBG051461"
FT                   /db_xref="UniParc:UPI0000F51A88"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK84"
FT                   /transl_table=1
FT                   /translation="MKYLFFLSPLVSSLSEQGRCGPRSIRSRSTFTKPTWSNSRQGIAN
FT                   GEKLQKHAQRLMLPAHTQNLQRFKSIRTIIKTADPTDVISTSRSLREKGCKPIYDFSQL
FT                   LEGTAKLSEFGPIFEKIDGLIRDWLGFDKVAEHRKPMADALDLIQKHRIAGNMKFFIAE
FT                   LKKELGIEKLALQNPKPMTPDGLPYDAYDTEKTVDQLRKSAENEADPEKKAKIEAQADG
FT                   LAANIQELVIKMRSPDYKEKVKDDVKLAKFKRHQAAIFRAKNTLKLLQKIEKGGKC"
FT   CDS_pept        join(975394..976566,976618..977406)
FT                   /codon_start=1
FT                   /gene_family="HOG000179515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904678"
FT                   /orf_name="AFUA_1G03370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88049.1"
FT                   /db_xref="HOGENOM:HBG051462"
FT                   /db_xref="HOGENOM:HBG396029"
FT                   /db_xref="UniParc:UPI000051FFB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK83"
FT                   /transl_table=1
FT                   /translation="MVPGFNGVPFDAEISDRGFAGSDLCGWFPSPFTVRELEMLRLINS
FT                   LTDRPGWEELVFDASTMQTWRSEAMAQFPLISPKTWDWCEAELRDKAQRWQETGLIMVL
FT                   NAASGVCKSDTIIPPSVAMEIQGFVNSALKESDGQMDWAPASNQQVWNLIDPSLYPLVR
FT                   ERTRVLVSSGSVPLEKTLDAYGQGEAPPPLHEDRHDWEVEKYIYSLRYQWLPCEVEFCG
FT                   PAGSTDVRITSYVNNLHPREQRPFYRVLESVISKTIEPWNQALIRLAFAGPLWAGREPM
FT                   RIRTFGVEWDNRYPQWAEDLPTTLDVDKSTEDYPRALARLKEYLSLPEYGLKVQWSYNS
FT                   TREIPADWEATLSLREVVNIKYSRMFRFQHSEPGTTYSYEDWKAGRTAHAIKSHEIKDP
FT                   MVHNEILRAKDEVDHQFQTVKLQDEFREKGLQIIVKLGGIELAPDNPSFLGEDWHVDGL
FT                   ANEHIAGVALYCFDLGNVANPRISFAHEISMDADDFSFSYFNWDIPYLERLFGVQNEKP
FT                   SFQELGSVSIRQGGLIAFPNCIYHRLESFELVDKARPGRCRFLTLWLVDPYYRIRSTRN
FT                   VPPQRLDWWEQEARSHLSSAHPLPQELADQIITEAGLWLMNLPEAQHHRRERAKEEALA
FT                   YEKIRSQIERNTICLLKQ"
FT   CDS_pept        join(complement(981797..983547),complement(979803..981746),
FT                   complement(979145..979724),complement(978458..979087))
FT                   /codon_start=1
FT                   /gene_family="HOG000212155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209227"
FT                   /orf_name="AFUA_1G03380"
FT                   /product="UDP-N-acetylglucosaminyltransferase "
FT                   /function="binding"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL88050.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG051463"
FT                   /db_xref="HOGENOM:HBG329970"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000051F175"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK82"
FT                   /transl_table=1
FT                   /translation="MLPSVASFPSVQPHHHLHPYYTADTATPPYDSNSTSFAPSLPGSD
FT                   INKDHSQSFSRTRLQYPHPVQRFGLHDTASPQPSPKHAAEHALRRKTPNGTLAAGYDGT
FT                   PGDTTIQPPATKHILVSPLDSGHLVPPQTGFVSDNWQQASLDQSSAAKHVVFPPVFKND
FT                   ASRGNIAPGDMVTDVNGTGWVRSLNYIPGADSMLNQSLPMQSAQQRFYVQNGAYVPTVL
FT                   PATLQPCLGPTASAGSGPYGPYWPDGVYIPYRPAAFRDTRFNHLNQTGLPFFDAAQQSF
FT                   NNANTALPGSHGEAGGWSTAPPGILSHGTAVKGNFPPRHSEQKSLDSSLNHRVLPLHIR
FT                   TNPSTGFSTNQGGESFSVLPASNGPGLPGAFPSAHSRAANVEFKEKILSWAHGVYVDLL
FT                   ASIHQARRNSISQAGSDGQPLRLKPSIYPKPPRQPGLDFSQSNSPEFHRHNSYPSSHYD
FT                   GRHQKTNILGYSRPVDTTATFQHSRRPSMGQFQQYATSDSQMLDRLRHTGRVTVPGPAP
FT                   RLSFSATGENSTTANAMSALEMLSHLCMESGWEWIDGMLLGGCLAYGLGDYPKAMRWYS
FT                   RIIARDATHVEAISNLAATLLALDRREEAMQHWLRAVKLRPSFFEAVEHLIGLLCSSQR
FT                   GKEAVNIIDYVQNSLRFPKNGDCFATDEHASETESDADSGASSVGSYEKASFDYDDDFG
FT                   RSLTGNQKPSEASAVGFGSSGYAIPGCDNGRMLALVHAKGNMLYALGDNAGAAAAFEDA
FT                   VLIAAGRRRHGIQSLIKQIYTAFSQGSHQAYSPLNSHESQEIILLYPDKALQTSKLVFA
FT                   PCGTPPGIKFVAEGLARKAALSTTSNSLLSLAKIYQDGMSNISGSGIPKKSPGVRDILA
FT                   LYYLSLSLQPSPSTANNVGILLAGIQNNAAGKSLPRSSGEAQHPEVPGVVPGSGISLAL
FT                   AYYNYGLHLDSRHAHLYTNLGSLLKDIGQLQAAIRMYEQAVQCDGNFDIALANLANAVK
FT                   DAGRVNDAITYYKRAVKVNPEFAEAVCGLANALNSVCNWVGRGGIANGYGFRDRWHVTE
FT                   QGMLRDASTSETGSGWIQRVVDIVNRQLKEGESWGLGLLSPNTIEQLCVQIAPALESRR
FT                   SACGSLATILQSWAGQRWEGSRIVKLIERANRSITWQWYQDRYIYGKEYPLTKYQRPQL
FT                   PSGLTVPNAPTVLPFHTFTCPLSAKQIRQISQRNGLRISCSTLRSPWLPATVYPPPPPP
FT                   NPYLKVGVKAYCYATTASDKSVHRQQIEKEAPVFHDASCWPIERLVKQIVDDGIHILVN
FT                   LNGYTRGARNEVFAARPAPIHMSFMGFAGTLGAEWCDYILADEISIPVDTLGPGRRNAR
FT                   IEDRLLEQDHGEELEDWVYGEKIVYTRDTFFCCDHRQSAPDAKDARITWEQEQERRWRM
FT                   RKELFPNLSDDTIILGNFNQLYKIEPTTFRTWLRILARIPNAVLWLLRFPDLGEQNLRE
FT                   TAIAWAGRETASRIIFTDVAPKNAHISRAKILDLFLDTPECNAHTTATDVLWSGTPLLT
FT                   YPRYKYKMCSRMASSILSSALPDSDAGRKARDELTAVSDEDYEDKAIRLCLSLRYNPGC
FT                   GGRASGRLFDLRRMLFEERMGSRLFDTKRWVRDLENAYDQVWKRWVNGEEGDIWL"
FT   CDS_pept        join(complement(988281..988333),complement(988088..988208),
FT                   complement(987678..988016))
FT                   /codon_start=1
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270347"
FT                   /orf_name="AFUA_1G03390"
FT                   /product="60S ribosomal protein L12 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88051.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG023340"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniParc:UPI0000F51A5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK81"
FT                   /transl_table=1
FT                   /translation="MATNITPIGQLPSSIPMSHLRVTGGEVGAQSALAPKIGPLGLSPK
FT                   KIGEDIAKSTGDWKGLRVTVKLTIQNRQATVSVVPSASSLVIKALKEPPRDRKKEKNIK
FT                   HNKSIPFDEIVEIARKMRHRSLAKELRGTVLEILGTAFSVGCQVDGRSPKDVSDDIKAG
FT                   EIDGKSC"
FT   CDS_pept        join(complement(991359..991451),complement(991166..991296),
FT                   complement(990814..991108),complement(990282..990755),
FT                   complement(989131..990228),complement(988825..989076))
FT                   /codon_start=1
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270348"
FT                   /gene_name="sec23"
FT                   /orf_name="AFUA_1G03400"
FT                   /product="Protein transport protein sec23 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="EAL88052.2"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG021213"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="HSSP:1M2O"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0000F51A54"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK80"
FT                   /transl_table=1
FT                   /translation="MDYEALKDQWSDVEDRDGIRLSWNTFPSTRMEASRLVVPIAAVYT
FT                   PLKEKPDSPLLQYEPVTCKAPCRAVLNPYANVDVRARIWICPFCLMRNPLPPHYKDITE
FT                   NAIPPELHPQSTTIEYQLARPAPAPPIFVYVVDTCQEEDSLKALKDTLILSLSLLPPNA
FT                   LVGLITYGTMAQVHELGYTECAKSYVFRGSKEYAAKQVQEMLGLLAAGPRPNMPQQPTR
FT                   PPVGPAARFLLPVQQAEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLETSF
FT                   QNAGGRIMVFTSGPATEGPGHVVGPELKEPMRSHHDIDRDNIKYYKKAVKFYDALAKRA
FT                   ANNGHVVDIFAGCLDQVGLLEMKNLANFTGGHMLLTDSFTSSQFKQSFVRVFDKDANDN
FT                   LLMGFNASLEVLTTKELKVTGLIGHAVSLNKKSSSVGETECGIGNTCAWKMCGIDPSSS
FT                   YGVYFEIANQGGPAAVQPGPQRGMMQFLTYYQHASGHYHLRVTTVARPLSGPAGDPTLA
FT                   QSFDQEAAAVLMARIAVYKADVDDGPDVIRWVDRMLIRLCSRFADYRKDDPTSFRLEKN
FT                   FTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVGDALVMIQPTLDSYSLEHEG
FT                   SQPVLLDSASIQPTHILLLDTFFHILIFHGETIAEWRKAGYQDQEGYENLKALLEQPKE
FT                   DARELIADRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVTSQTIFTDDVSL
FT                   QTFMDHLMKYVIRKCFTNVMNEANPPI"
FT   ncRNA           991837..991953
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR32"
FT                   /db_xref="Rfam:RF01247"
FT   CDS_pept        join(complement(993593..993782),complement(992984..993534),
FT                   complement(992170..992931))
FT                   /codon_start=1
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270349"
FT                   /orf_name="AFUA_1G03410"
FT                   /product="DNA primase large subunit "
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="EAL88053.2"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG522223"
FT                   /db_xref="HOGENOM:HBG617734"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI0000F51AC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK79"
FT                   /transl_table=1
FT                   /translation="MIRQDFQRIDPKRRATLDHKKKQFASPVYKQQDYPHRLNFYDIPP
FT                   TAEITLEQFEQWAIDRLKVLAEIEACSYRNKSAAETSAHITPLLQKYLPLSSNTSSSSG
FT                   ALDQRLKNERQKDHYSHFILRLAFSATEDLRRRFVRAETMLFRFRFQQDDSREKRAFIE
FT                   SLNLDWEPVSDEERREVAEKLVSATPGLRRVDEETWYKVDWERVPELVERRAVLLSKGK
FT                   AYVPGREQLSMIIAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYS
FT                   EGEGFVEGAPITASNIDRLSQHFPLCMRSLHMTLRKNNHLKHFGRLQYTLFLKGIGLSL
FT                   EECIIFWRQSFKGFTDDEFNSRYKYNIRHAYGDVGGDVNRRGRGYPPYSCQKILNDSNP
FT                   GVGQTHGCPYRHFSVDNLIGLLQSTGVHDKDVLRGVREDVEKTRYHIACNRVFEWAHKA
FT                   DIKRVKEDGTWGQTDLDTIVHPNTYFKRSYLLKQMGKPPKDA"
FT   CDS_pept        join(994672..994843,994909..995480)
FT                   /codon_start=1
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270350"
FT                   /orf_name="AFUA_1G03420"
FT                   /product="Adenylate kinase 2"
FT                   /EC_number="2.7.4.3"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL88054.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG518277"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000052090C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK78"
FT                   /transl_table=1
FT                   /translation="MNSITRQLKKAARIILIGAPGVGKGTQTERLLARYPELSSISSGD
FT                   LLRENVRKKTPLGIKAEAAMQAGNLVPDSMILELISSEFRSKGWLPVTAPLATATSNHT
FT                   SRPSTPLSPSASFILDGFPRTAAQALSLDTIVPVNFVVHLVTPPSVILSRIASRWVHEP
FT                   SGRVYNTDFNVPKVPGKDDVTGEPLTQRQDDSVDTWKQRLHKFEETSKALLQYYERKGC
FT                   LWRVEGDSSDEISPKLFAEIERRFC"
FT   CDS_pept        join(complement(996369..996800),complement(995830..996288))
FT                   /codon_start=1
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270351"
FT                   /orf_name="AFUA_1G03430"
FT                   /product="Staphylococcal nuclease domain protein, putative "
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL88055.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG059308"
FT                   /db_xref="HOGENOM:HBG329968"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI000051FB44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK77"
FT                   /transl_table=1
FT                   /translation="MRWPPWASDTQAQQQSRKSSSEDDERQAAASSTTTSKKKDWESSV
FT                   TAIDWAAFTEARTIIPTLILTSGFLGAFYIHRRYLRRFPDAVSITPSYFRRRSLLGQVT
FT                   SVGDGDNFRIYHTPGGRLAGWGWLPWKKIPTSKKELRDKTVHIRLAGIDAPELAHFGRP
FT                   EQPFAREAHQWLTSYLFGRRVRAYIHRPDQYQRAVASVYVRRLLDFPPFRRRDVSYEML
FT                   KRGLATVYEAKIGAEFGGEAMERKYKKAEWWAKLRGVGLWKDYRRNKTKWESPREYKTR
FT                   MGLEEAAQPGVEIKK"
FT   CDS_pept        join(complement(998447..998550),complement(997834..998375),
FT                   complement(997413..997774))
FT                   /codon_start=1
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270352"
FT                   /orf_name="AFUA_1G03440"
FT                   /product="Peroxisomal carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL88056.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329967"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00005201F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK76"
FT                   /transl_table=1
FT                   /translation="MTGQSKAMRLSPWGSAVAGATGAVLANAIVYPLDIVKTRLQVQVK
FT                   SDKTDGSDGTMHYESTLDAINKIVESEGIEGLYSGIVGSLIGVASTNFAYFYWYSVVRS
FT                   LYMASDRVPKPPGTAVELSLGAVAGAVAQIFTIPVAVITTRQQTQPKGEKKGLIETGRE
FT                   VVNSEDGWTGLWRGLKASLILVVNPAITYGAYQRLKDIIFPGKNSLKPWEAFLLGALSK
FT                   ALATIATQPLIVAKVGLQSRPPPGRGGKPFKTFGEVMRYIIEKEGALSLFKGIGPQITK
FT                   GLLVQGLLMMTKERMELMFVLLFAYLRKIRQEKLRKAVDAAASKAKTSLPATLK"
FT   CDS_pept        join(999739..1000037,1000094..1000304,1000357..1002264)
FT                   /codon_start=1
FT                   /gene_family="HOG000212111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209228"
FT                   /orf_name="AFUA_1G03450"
FT                   /product="Calpain-like protease PalBory "
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88057.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG051465"
FT                   /db_xref="HOGENOM:HBG329966"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="UniParc:UPI0000520694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK75"
FT                   /transl_table=1
FT                   /translation="MKALSLAATTNDKQSLDAKCKEWLSRAEKIKEAKDWRSAIRVHAR
FT                   HAAELEAPVSTRTLTTREEIILLEGAKLNGFIFPPWAGPPSLEEFEPSEGGQSFIDKPD
FT                   LHLSDKQKDIFDGWKRPSELLAHAGGDTLMMSVPEKTDLVQDVLTDCSVVASLCATTSR
FT                   SERGLDKHYLPVVYPCEYDTGRPKPAPSGRYVLRFYFNGCFRKVVIDDRLPSSKTSRSL
FT                   YVVDRNNPNFLWPALVEKAYLKLRGGYDFPGSNSGTDLWVLTGWIPEQVFLHHEDVTSD
FT                   QIWRRLFRSFQYGDVLLTIGTGKLTEKEEEELGLVSEHDYAVLDMKEFNGRRQMLVKNP
FT                   WAGVHTASGRTENSLESHAPHDRSSLSPGTFWMDCEMVFQNFENLYLNWNPSLFKYRQD
FT                   IHFTWDLTAGKGVPGCFVKNPQFAVTSETGGTVWLLLGKHFKTRDRLDYSSSEDSQAGF
FT                   ISIYVFNADGKRVCLSDGALHRGPYVDSPNTLMRLEMLPRTTYTAVVSEESLPALSQNF
FT                   TLSALSISPVHIAPSQNKYTCVNKVQGSWMPSTAGGNAESARYPSNPQFTLTLSNATDI
FT                   SILLESSDTELAIHAKLFFSNGKRVTRVRNRDIITDSGDYRRGAALAEKKHLDKGVYTI
FT                   VCSTFAPDQLGRFTLWVSSMVPCELKPLSSEAAGRRAVLSDIGVLPPGRDRMLAPLQVP
FT                   RLTRIKLIARSRRSMIGSHPVGPSPVLMTVELGQGPYKEVLATSEDGDHSDAISGVRIE
FT                   DFDLHPCLEDSRGVWIVLERIGGPGGQVEDHFEVEALAEERVEIGEWFVEDA"
FT   CDS_pept        join(1002952..1003103,1003156..1004089)
FT                   /codon_start=1
FT                   /gene_family="HOG000212100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270353"
FT                   /orf_name="AFUA_1G03460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88058.1"
FT                   /db_xref="HOGENOM:HBG051466"
FT                   /db_xref="HOGENOM:HBG329965"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniParc:UPI0000520430"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK74"
FT                   /transl_table=1
FT                   /translation="MLTCYGPKFRNENSDNDTVIDAVAANAYVEQFGLEVFNRADTTMR
FT                   ANKVTRQTADTFQAAATFLELCQIWNPLEPEIAAKIKFAKYHALRIVKAIKAGEDPNAT
FT                   NPVIKEDHQAEGPAVTVEDLEAQPGAALASQTRQPTVEEVPDESEHAARAMVQQSLMDD
FT                   SLHPSRSSSATRPQRTGDAFSIPDVPTSAPRTPAPETGHAAEQGSTLELPSAPATIASS
FT                   SIPNLPDKSASLGAHHPADPNSNSFHSFPPPANLPSPPAAFNQPSHFYNQPKPSAWAPS
FT                   PPAQPHTEPAPVVSRPVQQPASAAVPTVSASSQSNSQGIDEEAIALAQKHARWAVSALT
FT                   FDDVDTAIKELRNSLKYLGAE"
FT   CDS_pept        1004790..1005104
FT                   /codon_start=1
FT                   /gene_family="HOG000048295" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904679"
FT                   /orf_name="AFUA_1G03470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88059.1"
FT                   /db_xref="HOGENOM:HBG051467"
FT                   /db_xref="UniParc:UPI000051EEDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK73"
FT                   /transl_table=1
FT                   /translation="MEEALDDGVLRLSMRYRDFTLFLDLKDQYHKELLTRLTEHTEQLE
FT                   FDWGMLEQSRQERMSCAESFLGRYGMLYWGNEVNREKFLMEDSRADPASPCIYPERKKE
FT                   "
FT   CDS_pept        1005387..1006061
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270354"
FT                   /orf_name="AFUA_1G03480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88060.1"
FT                   /db_xref="HOGENOM:HBG051468"
FT                   /db_xref="UniParc:UPI000051EC66"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK72"
FT                   /transl_table=1
FT                   /translation="MGRKHNNQLGKRRAPDDLEVSPSRLGGADVRAIRPFSSISDTADN
FT                   TTRTQDLVGLNEASRNINRAEYSGILTKDSVIAIQSRITPSDTAQMPEDALEQQTKFLV
FT                   SASNQPNMAPVWVPFQIFQSAASFLTHMAEECNIHEWDPSAQLSKEISKWDSSPPASQA
FT                   VVAASVKFEWSEFFIRVRQGRDDDWEFVMQELRNSWRAKGKDGSEAGNQRLHIRVMLHV
FT                   VS"
FT   CDS_pept        join(1008179..1008230,1008316..1008477,1008548..1009455)
FT                   /codon_start=1
FT                   /gene_family="HOG000212078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057919"
FT                   /orf_name="AFUA_1G03490"
FT                   /product="Epimerase/dehydratase family protein, putative "
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="EAL88061.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG051469"
FT                   /db_xref="HOGENOM:HBG323870"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51A6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK71"
FT                   /transl_table=1
FT                   /translation="MASDQGKKPAVLIVGGLGFIGRHLALYIHENNLASEVRLVDKVLP
FT                   QLAWLAPEFEEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGETRHSQPDDV
FT                   YELRSYNLTVALGREVARRGIRSFVECSTAHVYKPGSSPRKENDKLEPWHRLAKWKLKA
FT                   SDELKKIPGLNYCLLRLPHVYGEYDSGYFAMGICLARVHLDMETDLELLYTKNLKINTL
FT                   YVKDAASALWKAAEWRASTTDEPAQIAFNVVDHGDTRQEHVAEALSTVFGLKTSFLGSL
FT                   ASQLAKLNLDDVVDDMNEVSLQGWAELLEKKGITRPGPISPFLEKDVIKDQDMSIDGTL
FT                   FEKTTGWKPTRERFDAEGVRAMVDSYKRMGWWP"
FT   CDS_pept        join(complement(1013550..1013940),
FT                   complement(1013168..1013394),complement(1011522..1013075),
FT                   complement(1011220..1011459),complement(1010710..1011159),
FT                   complement(1010510..1010644))
FT                   /codon_start=1
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209229"
FT                   /orf_name="AFUA_1G03500"
FT                   /product="Topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL88062.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG269325"
FT                   /db_xref="HOGENOM:HBG521929"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="UniParc:UPI0000520446"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK70"
FT                   /transl_table=1
FT                   /translation="MTIVFLGSIPFLLGLRSLFSSTFSRVSLLVALLGLLFPLNSLTLY
FT                   TNLSLSILSFFAYSSFKVSLASSFSQAPSLFFRLGRQPVSSLCASPLRVHLHLQSSSQQ
FT                   FSTQRIAIMSSSEDDTPLVRANGRSAATSTDVKMEDTPETNGHVEPGVSLRFGPVKSAG
FT                   DIDMQDATDANTGVAGKRKARTSVGERKSYAEPESSEDEDQPLSKRRRTSVKHEDPETD
FT                   EDVPLALNGRKLPKASETALGAEESDSDVPIERKLVAQKKKIQQKAEKDAKASRKSDAS
FT                   QAAKATAASKKKQVNGVKSEPVDEKKPAVKKTTKQANAEPAASARNGKTKATPVKKEES
FT                   TEAEEGEEEEEEYRWWEDPTKGDGTIKWTTLEHNGVVFPPPYEPLPSDVKMKYDGVPVT
FT                   LHPEAEEVAGFFGSMLNATQHVENPTFQKNFFMDFKEVLEKTGGAKDPKGNKIEIKEFS
FT                   KCDFRPIFDYYDAKRIEKKNLPPAEKKRLKAEKDAAEAPYMYCLWDGRKQKVGNFRVEP
FT                   PALFRGRGEHPKTGRVKARVQPEQITINIGKDAPVPPPPEGHRWKEVKHDQEGTWLAMW
FT                   QENINGNYKYVMLAANSDVKGLSDYKKFEKARELKKHIDRIRKDYQKALKHELMVERQK
FT                   ATAVYLIDQFALRAGNEKGEDEAETVGCCSLKYENVTLKPPNKVIFDFLGKDSIRFYDE
FT                   VEVDPQVFKNLKIFKKPPKKEGDEIFDRLTTSALNKHLSNYMPGLTAKVFRTYNASYTM
FT                   ATLLKDMKATGSVAEKVKAYNDANRRVAILCNHKRTVTASHANQMEKMSERIKGLRYQR
FT                   WRLKQQMLDLDPSLKKKKGAKFFEMDEDISMEWVKEHQAFLLEEQRQKIKKKFEKENEK
FT                   LAAEGEKEMKASELEHRLEAVKEMENKFMRENKTGKVEVEGKSPSVEKLEAAITKLEQR
FT                   IETMELQAQDKEDNKEVALGTSKINYIDPRLTVVFSKKFNVPIEKFFSKSLREKFEWAI
FT                   KSVDENWEF"
FT   CDS_pept        join(1014395..1014450,1014615..1015189,1015247..1015359,
FT                   1015413..1015433,1015497..1015531,1015583..1015676)
FT                   /codon_start=1
FT                   /gene_family="HOG000215911" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904680"
FT                   /orf_name="AFUA_1G03510"
FT                   /product="ATP synthase gamma chain, mitochondrial, putative"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="EAL88063.2"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG314510"
FT                   /db_xref="HOGENOM:HBG586593"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI0000F51A72"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK69"
FT                   /transl_table=1
FT                   /translation="MFSRAVRPAVRAGSATLTRTAPPNAANFATLREIEGRLKSIKNIE
FT                   KITNTMKIVASTRLTRAQKAMDDSRVYGQTSNKVFENAETKPLEDKKTLLVVASSDKGL
FT                   CGGIHSGLSKATRRILQENPNADVVILGEKAKAQLSRSNADAIVMSFANVCKDIPTFAD
FT                   AQVIADQIAQLPTDYASVKIIYNKFINAQSYEPSTVEAYSEEAITKSANLATFEVEDSV
FT                   LANLREYALANSLYWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAIT
FT                   GELVEIITGATASEDM"
FT   CDS_pept        1016401..1018101
FT                   /codon_start=1
FT                   /gene_family="HOG000212067" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057920"
FT                   /orf_name="AFUA_1G03520"
FT                   /product="DnaJ domain protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL88064.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG051470"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000051EA35"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK68"
FT                   /transl_table=1
FT                   /translation="MSHLTIANCYEILGINSDATIKDINTAYKKLALKHHPDKTGGEES
FT                   SHIEFQKVQAPEQDTEDSKPIMLTKSDHQIQQAVEILRDPVRRKNHDLELFKLGRISVH
FT                   GTNFPHAGGSHWSASAFKRYDENSRYMYSYEQSVHVSPQKQESKEDMEWVEQMLKAEEE
FT                   FRRNLARQQEVEQMRAQMEAERVGQEEDCKLQSTWEDHPSEHLEQDAHTEDVLEEESDY
FT                   FEFYTESINRKEQDIWDKCAQRAPRSRDYREEEYYQEMYQKGEKQPELYEEDEDQEIDE
FT                   EDDEEQQDIHGEEVEDQPELYEGVDCEEKVSKVDTVDLQELYEEDGHDFDDSSLCPDNQ
FT                   LSEYIPSVCGSDLDYATARSSGSEFNPRFHMESIRAACADLYDNKSTSLEEAQKADDDT
FT                   ATFYEVSEADSSHKFYSTNPYLSETESVNEAVHNDVDEQVSEGVDNDDSVNRSSLHDLL
FT                   SPFVPYLRKKLDDPNGRYTEEDLRVELQGIVMETFCGWLENIRLTVPDAEIPRTGNDPQ
FT                   QCLHLGSWVKQFERPTCEICHRWMPIYTLMCPGCGIQACVGCKFQYEKE"
FT   CDS_pept        join(complement(1020923..1021065),
FT                   complement(1020844..1020865),complement(1020758..1020776),
FT                   complement(1020676..1020701),complement(1020575..1020620),
FT                   complement(1020320..1020518),complement(1020221..1020254),
FT                   complement(1020102..1020170),complement(1019580..1019982),
FT                   complement(1019513..1019529),complement(1019330..1019455),
FT                   complement(1019070..1019268),complement(1018936..1019016),
FT                   complement(1018721..1018870),complement(1018508..1018665))
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057921"
FT                   /orf_name="AFUA_1G03530"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL88065.2"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51A6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK67"
FT                   /transl_table=1
FT                   /translation="MGGVADSSAAMDAAAQMRKAALKGSSGMAGLVQNRKVFGIAMFAC
FT                   LGGLLYGYNQGVFSGVLTMYSFEKHMGDAVTNQTKKGWLTAILELGAWFGALYSGLLCE
FT                   RISRKYTILANVAIFCIGVVIQTTAATKGGNSSHILGGRFITGMGVGSLSMSVPMYNAE
FT                   IAPPEVRGSLVALQQLAITFGIMHRINYGTNHIGGTGPTQKDAAWLLPLALQLVPAVIL
FT                   GAGMIFMPFSPRWLIHHDREDEAKKVLTSLRGLPADDPLLQLEFLEIKAQSLFEKRTEK
FT                   EKFPHLERTNTWSYIKLEAAGFASLFTSWPMFRRVMVATVTMTFQQWTGINAVLYYAPS
FT                   IFNQLGMSSNTTSLLATGVVGIVMFIATIPAVIWIDRLGRKPVLVVGAIGMAACHFVIA
FT                   AIFGQNENQWDTHKAAGWAAVSMVWLFVIHFGYSWGPCAWIIIAEIWPLSVRAKGTALG
FT                   ASANWMNNFIVGQVTPDMLQNIRYGTYIFFGIITFLGAGFIAFMVPETKQLSLEEMDVI
FT                   FGSEGTAISDYERQAEISREIGLDEALARLTNTAPVEVHDVEAKQT"
FT   CDS_pept        join(complement(1023787..1024249),
FT                   complement(1021960..1023734))
FT                   /codon_start=1
FT                   /gene_family="HOG000212056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270355"
FT                   /orf_name="AFUA_1G03540"
FT                   /product="Dual specificity phosphatase catalytic domain
FT                   protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="EAL88066.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG051471"
FT                   /db_xref="HOGENOM:HBG329241"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI000051F176"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK66"
FT                   /transl_table=1
FT                   /translation="MHFSFAMSSICASLSLPPTHPGLSNTGAALQLWKSASAVFSNPTA
FT                   LLSLTRNFQILDQDGSLNWGNVAFVTTCIIAMAGCGFLSSLLRRKGSKRSSGRKRFRRG
FT                   IQIHDSKTSPETTTSSEEEDYDSSGSLRNGTDAALPQEKVTHKHHEQSADALATDPGIL
FT                   KKRSSYHSYSTSIATYPSIRTFFSPHPHMDKLPTKPTPIPLLVFVHGLGGSLAQFSFLL
FT                   TSLANVGPCFGIDLPGCGLSTFAPTDWDAYTVEALAELLFTAIEQHRDREAGQKVVLIG
FT                   HSMGCSLSALLASSASSIGSELKEHILGLVAISPRASPPTPDEVASYRRLLRIPESIFD
FT                   MWRYWDRRGGLHSASVNRLVGTDADPDTRELQMRYNKQSKTPVWRRMAWGTLPTYNKDG
FT                   KAIGGIPGEEVWAGVKTSVLLVAGESDAVTKPAELRKLLKFFGEVGPHADVGADGSAII
FT                   PDASETHDTVSAAYDRFAHEEEYGLEAQTSEKTIIDDCRASCEKKRAVKTVILPAPASH
FT                   ALLYDRATYRTLAGIIQDFLSQHIDERLSLGWQLQYMNTSGKWDVKNLAKWKKVTPVSQ
FT                   RIAGTFVALKMLREVDEEHNPVLFSQKYRDQIYAVIDISYENPVYNPASLEKGGIHYQK
FT                   HPTVSKIPPTADEVRDFIALVDRLQNEISEKMKMSGNPDGPRPVVGVHCHYGFNRTGFL
FT                   IVSYLIERLGFRVQDAIDEFERQRPPGIRHGHFIDTLFVRYCVGLKRAPTL"
FT   CDS_pept        join(complement(1027201..1027375),
FT                   complement(1025678..1027131))
FT                   /codon_start=1
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270356"
FT                   /orf_name="AFUA_1G03550"
FT                   /product="Mitochondrial dihydroxy acid dehydratase,
FT                   putative"
FT                   /EC_number="4.2.1.-"
FT                   /function="dihydroxy-acid dehydratase activity "
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="EAL88067.1"
FT                   /db_xref="GO:0004160"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="HOGENOM:HBG431429"
FT                   /db_xref="HOGENOM:HBG671001"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniParc:UPI00005206B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK65"
FT                   /transl_table=1
FT                   /translation="MAKSPQVGIASVWWEGNPCNMHLLDLGKTVKKAVTDQGMIGWQYN
FT                   TIGVSDAISMGSEGMRFSLQTREIIADSVETVTCAQYHDACIAIPGCDKNMPGVVMGMA
FT                   RHNRPSLMIYGGTIQVGYSNLLRKRVNVSTCFEAAGAYAYDTLRQPDDGGDTSKSKDEI
FT                   MDDIERHACPSAGACGGMFTANTMATAIESMGLSLPGSSSTPASSPSKMRECVKAAEAI
FT                   KTCMEKNIRPRDLLTKRSFENALVMTMALGGSTNGVLHFLAMARTADVNLTLDDVQRVS
FT                   NKIPFIADLAPSGKYYMADLYDIGGIPSVQKLLIAAGLLDGDIPTVTGKTLAENVASFP
FT                   SLPQDQVIIRPLDNPIKTTGHLQILRGNLAPGGAVAKITGKEGTKFTGKARVFDKEYQL
FT                   NDALTQGKIPRGENLVLIVRYEGPKGGPGMPEQLKASAALMGAKLNNVALITDGRYSGA
FT                   SHGFIVGHIVPEAAVGGPIAIVRDDDVITIDAETNTINMHVSDEEIQQRLKEWKPPVPH
FT                   VTRGVLAKYARLVGDASHGAMTDLF"
FT   CDS_pept        join(complement(1029590..1029898),
FT                   complement(1029252..1029515),complement(1028328..1029194))
FT                   /codon_start=1
FT                   /gene_family="HOG000212045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270357"
FT                   /orf_name="AFUA_1G03560"
FT                   /product="Peroxisome biosynthesis protein (Peroxin-2),
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="EAL88068.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051472"
FT                   /db_xref="HOGENOM:HBG329240"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="UniParc:UPI000051F15C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK64"
FT                   /transl_table=1
FT                   /translation="MSSTNFAAAQERVLERRRLREAEARKRLAEQQRASPLNHPALNRL
FT                   PYPLNRIPQSGVTLWNSIKGREGSRPAFRVGQVDAELLDEELLGLLKGQVGNALKYFGP
FT                   QLREDWSHEIQFALRAILFKLSIWDHNASYGAALQGLRYVDSRSKGPVHSTPTKWQKSL
FT                   YGLLTVGGRYAWEKWESWLISQEGGYEEPSRDVRMLARLTGLVSTTHSIAAFVSFLVFL
FT                   VNGRYRTLVDRILRIRLTPPSAQSAREVSFEYLNRQLVWHAFTEFLLFLLPLVGISRWR
FT                   RWLSRAWRKAISAIRSRDDDEVEVEKRGELAFLPERTCAICYKDQNPASTSENDIITAS
FT                   AGGIVGSAQTDITNPYETVPCGCIYCFVCLVQKVEGEEGEGWICLRCGEIVKKCKPWNG
FT                   DVLEEVRPSTTSGKIVGFAMDENAVTQGPVSGQGPKTLAEELSASHEVGQDEALDHSDQ
FT                   WSKVDKDEEEAELDEEVNESA"
FT   CDS_pept        join(1031631..1031816,1031867..1031931,1031992..1033087)
FT                   /codon_start=1
FT                   /gene_family="HOG000212034" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16270358"
FT                   /gene_name="phoA"
FT                   /orf_name="AFUA_1G03570"
FT                   /product="Acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL88069.1"
FT                   /db_xref="EMBL:AAL66381.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG736259"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI000051FB1C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X176"
FT                   /transl_table=1
FT                   /translation="MKPSVATLLATVSLVYAQTATEKEPSLSAIESAAASIQPYSPVSN
FT                   VEGVAFNRFFQVWLENIKDYEDAAADENMKWLASQGILLTNFYAVTHPSEPNYCAAVGG
FT                   DTFGMDNDNFNQIPANVSTVADLLDTKNIAWGEYQEHLPYPGFQGFNYSNQETYVNDYV
FT                   RKHNPLVLYDSVTKNSTRLRQIKNFTSFEDDLANKKLPQWAFITPNMTNDAHDTNITFG
FT                   AKWERSWIAPLLNNSYFMNDTLILLTFDEDGTYSKSNKIFSVLLGGAIPDELKGTQDDT
FT                   FYTHYSVIASVSANWGLPSLGRWDCGANILEIVANKTGYVNYDVDTTNLRLNETYPGPM
FT                   SAGEYSKYSPVWPNALTRGDCSAGHGILDIVKETYANTEPTYNYSSPFPYDTASNYNTK
FT                   VTATKKNVTGTHRSSSSSSPSASSNAAVSAVAPAAGVSGLLLGLALNLL"
FT   CDS_pept        join(complement(1034251..1034358),
FT                   complement(1034090..1034120),complement(1033884..1034051),
FT                   complement(1033683..1033824),complement(1033471..1033612))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209230"
FT                   /orf_name="AFUA_1G03580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88070.1"
FT                   /db_xref="HOGENOM:HBG051473"
FT                   /db_xref="UniParc:UPI000051FFA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK62"
FT                   /transl_table=1
FT                   /translation="MKSSPNKQTTLQLSDGQVPTQNCKSTLLERSGPDTWVPDAGRHQI
FT                   PAHAYSIYISTLYLSHTIQQKLARMSDHDNNLKIAHEAENDLNTYQAKQGLGRKSDSTV
FT                   ESGVNAMVDRKFGDTGIKIGREAGASSSDRKPIPEDEGGSRDDRGRISKAGQFQGSGGP
FT                   EDKVKIESQRRPGDDDVLNFQEMKREGLVRKIH"
FT   CDS_pept        join(1034731..1034895,1034981..1035081,1035138..1035275,
FT                   1035330..1036345,1036401..1036873,1036926..1037114,
FT                   1037167..1038222)
FT                   /codon_start=1
FT                   /gene_family="HOG000212023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904681"
FT                   /orf_name="AFUA_1G03590"
FT                   /product="Importin 11, putative"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="EAL88071.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG020828"
FT                   /db_xref="HOGENOM:HBG329237"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051E807"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK61"
FT                   /transl_table=1
FT                   /translation="MAEVVELPGESNPLNPQNLLHALALAASSTQQQVQTGTKQLQHWE
FT                   KHESYFTLLQDVFLDQSLPVEVRYLSIIQLKNGIDKYWRKTATNAIKREEKERIKVRAV
FT                   QAGVVEPAPLLALHNAFMIAKIMRYEFPQDWPDGISAIIAYLRSSTQPGANPLQLPRTL
FT                   TILLQIIKELSTARLQRTRANLQSVAPEIFHLLVNIYVEKVNKWTVILEQGGVDEAALL
FT                   GEAEQSLVCLKVLRRLIIAGFEHPNRDKEAQDFWLLSHTHFSRFFAIVNGSVPLSEQVQ
FT                   RSIEKHLLKLSKLHVEMAKERPAAFALLPDSIPLVQSYWTLVVKLGENYSQLGEDGDSD
FT                   NKTLMEKVGLRALLLIRACSKMAFNPAQTFKYQTPQDKEEKQRSIEQIKSDIFTHEFVV
FT                   SVMELLVTQFFRFRKADFQEWEAEPEEWERKEEDIAEAWEFSIRSCSEKLFLDLVIHFK
FT                   DLLIPRLLNVFFSFASPEKRDVLLKDSLYSAIGLASASLEQQLDFNSFLETALVQEVQI
FT                   QEHGYNVLRRRIAIVLGQWVPVKPDELNRNAIYQIFQHLLGKQDPLNDLVVRITAGRQL
FT                   KNVLDPFEFSPAVFMPYAQSILQDLMSLIQEVELPETKMGLLESVRVLVVKMEHHIAPF
FT                   SDQILALLPPLWEQSGEEHLMKQAILTLISSLIHSLKQDSIKYHSLVLPLISNSVEPGS
FT                   ETLVYLLDEALELWSAILTQTPAPASPELLALIPALYPIFEAATDSVPQALQIAESYIY
FT                   LAPQEVLSDRIRLPLLVSFETLLQSTTRQRIGVVPRLVELMIRGAEAVDGGSENTYNVI
FT                   TRSLIDSSFLQSLLEGLHSAYEASQTTGPRRKPTSVYGVVETDYYSVLARLALAYPKNL
FT                   VSAVSAATQTPEEQVLSWLLTEWFLHYDNIGSVTQKKLHALALTQLLALNGPDTQPPTY
FT                   ILNHLQSYMNIWTDIVTELAEGTEGDPNDPRSGDYLIYWNNAPNAKYDGPEPPENERRR
FT                   HWETSDVIHKINIRDFVRQHLHSLIVGCGGEQRFQEEWLLNVDREVVAAFAALGLF"
FT   CDS_pept        join(1039809..1039888,1039939..1040330,1040392..1041170)
FT                   /codon_start=1
FT                   /gene_family="HOG000114462" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270359"
FT                   /gene_name="exgA"
FT                   /gene_synonym="exg1"
FT                   /orf_name="AFUA_1G03600"
FT                   /product="Probable glucan 1,3-beta-glucosidase A "
FT                   /EC_number="3.2.1.58"
FT                   /function="actin filament binding"
FT                   /function="glucan exo-1,3-beta-glucosidase activity "
FT                   /function="metal ion binding"
FT                   /function="protein binding, bridging"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL88072.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004338"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0030674"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="HOGENOM:HBG176634"
FT                   /db_xref="HOGENOM:HBG735468"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F3D3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK60"
FT                   /transl_table=1
FT                   /translation="MIFKFSQKALVALYLVVGLAEAVPSKSRVVSRASTFDYNGIVRGV
FT                   NIGGWLVLEPWITPSIFDNAGDAAVDEWTLTATLGQDQAKAVLSQHWSTFITQDDFQQI
FT                   AQAGMNHVRIPIGYWAVSSLPDEPYVDGQLEYLDNAISWAREAGLKVVIDLHGAPGSQN
FT                   GFDNSGRKGPIAWQQGDTVSQTVDAFRALAERYLPQSDVVTAIEALNEPNIPGGVSEAG
FT                   LRDYYNQIADVVRQIDPGTSVFLSDGFLSTESWNGFKTGEDVVMDTHHYEMFDNYLISL
FT                   DIDGHVKSACDFGKQIEGSDKPVVVGEWSGAVTDCTKHLNGKGVSTRYQGEYANNVKYG
FT                   DCANTTQGSVADLSDQERTDTRRFIEAQLDAYEGKNGWLFWTWKTEGAPGWDMQDLLAN
FT                   GVFPSPLTDRQFPNQCA"
FT   sig_peptide     1039809..1039874
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK60 "
FT   mat_peptide     join(1039875..1039888,1039939..1040330,1040392..1041167)
FT                   /product="Probable glucan 1,3-beta-glucosidase A "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK60 "
FT   CDS_pept        join(1043356..1043497,1043557..1043830,1043901..1044333)
FT                   /codon_start=1
FT                   /gene_family="HOG000158748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270360"
FT                   /orf_name="AFUA_1G03610"
FT                   /product="Putative uncharacterized protein "
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="EAL88073.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG051474"
FT                   /db_xref="HOGENOM:HBG329726"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI0000520695"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK59"
FT                   /transl_table=1
FT                   /translation="MQASEGRRKMEALLEGGRPVKHVSRKALYTRLEARITYLKDFLDF
FT                   NSSDIEALTTGSKYIKALIPAVVNIVYKKLLEQDITARAFITRNTADETTNVDDWYTED
FT                   SPQIKRRKMFLRWYLTKLCSDPTEMEFWRYLNKVGVMHSGQERRLPLNIEYIHIGVMLG
FT                   FIQDVFTEALMSHPTLSLQRKVALVRAIGKIIWIQNDLFAKWRVRDGEEYADEMSEIIL
FT                   DDKEGYIGEKKILGDSSPSASSSDDDRSSIASSVAPSAASACPFSDMARPSSETKIWAG
FT                   R"
FT   CDS_pept        join(1052529..1052995,1053069..1053462,1053520..1053962,
FT                   1054054..1054201)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270361"
FT                   /orf_name="AFUA_1G03620"
FT                   /product="Vanillin dehydrogenase, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88074.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051F166"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK58"
FT                   /transl_table=1
FT                   /translation="MAANGAKADSGVIPLIINNESIVTENVFDIHAPATGQVLHQCAAA
FT                   SVDHANRAVAAAKAAFPAWSRMKPYDRRDVLMKAADIMFARSEELIKYQMEETGAGRMF
FT                   AEKTCLLGAGFLKDFAARIPSIEGSVPSVTQDGECAMVFKEPYGVVLGIAPWNAPFILG
FT                   VRAVALPLAAGNTAILKGSELAPKCFWAIGDIFREAGLPAGCLNVLYHRTADAAEVTTA
FT                   LIAHPAVRKVNFTGSTQVGSIIAATAGKYTKPVLLELGGKASAIVLDDANLEKAAFCCA
FT                   LGSFMHSGQICMSTERIVVQRAIADKFRQLLAENAEKLFGKAAPAPVLVTSAAVKKNKT
FT                   LVADALSKGASVLFGDANATESSDHSLRPVIVDNVTKDMDLYSTESFGPTVSLIVVDTE
FT                   EDAIALANDTEYGLTSAVFTDNLFRGLRVAKQIEAGAVHINSLTVHDEPTLPHGGWKSS
FT                   GFGRFGGGTAAFDEWLQTKTVTWTQ"
FT   CDS_pept        1056979..1057731
FT                   /codon_start=1
FT                   /gene_family="HOG000174973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270362"
FT                   /orf_name="AFUA_1G03630"
FT                   /product="GPI anchored serine-threonine rich protein "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /protein_id="EAL88075.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="HOGENOM:HBG051475"
FT                   /db_xref="HOGENOM:HBG329236"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI00005208FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK57"
FT                   /transl_table=1
FT                   /translation="MRFVTVAISALVAMASAYTQPDYSKPPQGNAILKPGLNEQVPVGK
FT                   PYTITWDPTTEGPVSLVLLRGPSTNVVPLSTIVESIPNTGSYSWTPSTDLENDVTHYGL
FT                   LLVVEGTGQYQWSTQFGISNPGKAADTPAASVTATTSATSEVETPAASSPADSNVTLVT
FT                   TETTTWCPESTAKPTSIPVIVPTGAPSIPSGSPTPSAYPSSTLISKTYSPSGPSGTSPT
FT                   PILFTGAADRTAVSVGAVAAGVLAVLAF"
FT   CDS_pept        join(1058379..1058425,1058492..1058576,1058639..1058779)
FT                   /codon_start=1
FT                   /gene_family="HOG000211988" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904682"
FT                   /orf_name="AFUA_1G03640"
FT                   /product="UPF0390 protein AFUA_1G03640 "
FT                   /protein_id="EAL88076.1"
FT                   /db_xref="HOGENOM:HBG051476"
FT                   /db_xref="InterPro:IPR019034"
FT                   /db_xref="UniParc:UPI000051F3F6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK56"
FT                   /transl_table=1
FT                   /translation="MAQGPLKKTKPSTAKRPTALAPKRGPRQIAPKKATLIKQQKITKK
FT                   LTAGLTAKTERTLAQRAGHLELLAGGKKDKKAEKEKGKEKGGKKN"
FT   CDS_pept        join(complement(1061561..1061805),
FT                   complement(1060324..1061486),complement(1059780..1060105),
FT                   complement(1059131..1059727))
FT                   /codon_start=1
FT                   /gene_family="HOG000211977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752516"
FT                   /orf_name="AFUA_1G03650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88077.1"
FT                   /db_xref="HOGENOM:HBG051477"
FT                   /db_xref="HOGENOM:HBG329235"
FT                   /db_xref="UniParc:UPI000051F16E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK55"
FT                   /transl_table=1
FT                   /translation="MDCGTAGTAAGIDPKILDNWQSDTAFSIASWEHGGYDQQFEWDTS
FT                   PDSNQDEAEVVDLGVLHGSLADDQPSASVFGHNSDPSNPGLISPEKLSAVDAAIEGTIS
FT                   GTVSPRTLPSSTDDNFHVDETWPHFQLINPMAAGLPVDAPMALPYAKDPTSNNTVIVDD
FT                   GGELSNGQGFPEVQPEQYLTFQNLSQAFQFAGDPWAEPPVNLDANTSAQAPISVPQMRP
FT                   QVQIQIINQPRSFQGSLRPLESRWLESLESQLPTNLTSPASLTTDCQDHSLPKDDRRLQ
FT                   DAFQYKSESSSVSGDLSGVYDCSYSGLSDDVPAFAERQLEDDGAWKDAQKKESSSATSR
FT                   PLQGATAFVVSENPQESFFMTAPSRSRASSTAAQRASGRPQALALQSVATVRKRKQRTS
FT                   NVSIDQSLPKPLQIVQEDGQGGSIASADFVSPPRGARRKGPLSMVGRANAGLRRKNKDT
FT                   CVQCRLNKRKVAQRAVNHPTVDRSGRVRMEIPSKFVLNDLLTLLSERQGRFNIRASQAW
FT                   GSLYVLDLAETYKFLKSLSEYNGNSRSTFLEFIDRRIVESKDKSKNWLSCVRDCDPMNN
FT                   IYSLLSQWNNMPSRASYSFVPLQGGGQERPMDIHNHEDQREILLAAQLSRIVCRMLEVE
FT                   GFRKLERDFYNIKWKQISQETHLRFLNQLGHILLSLRWRVSWWKRLGDGGREPDPSKQH
FT                   YEDRVELLCRILYVYYTCVQAKLPSWSTADVPKGVWSTYADSENAVWDDFPLDPSEDGF
FT                   KRWMERGRELIEQAGVPNRVSKI"
FT   CDS_pept        1064070..1065233
FT                   /codon_start=1
FT                   /gene_family="HOG000211966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904683"
FT                   /orf_name="AFUA_1G03660"
FT                   /product="Acid phosphatase, putative "
FT                   /EC_number="3.1.3.-"
FT                   /function="hydrolase activity"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="EAL88078.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051478"
FT                   /db_xref="HOGENOM:HBG329003"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="UniParc:UPI000051EECB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK54"
FT                   /transl_table=1
FT                   /translation="MHILVSYPALFLYHRAQYPLAHGDWRVPKRNETQYSCDPFSQVVN
FT                   DDGPPSRRLSPYIRPFVDALQAAGHQVSVAIPARSRSWIGKAHIIEAALEATYVPPDAF
FT                   QEDGTWDEAYETPDEDESKLEWVVITNGTPASCTQLGLFNLFADRGPIDLVISGPNHGR
FT                   NASTIYNLSSGTVGGALEAAICGKRGIAISFGSKDEQPIEVIRAAARLAVRVVNHLYQN
FT                   WDERVELYNLNVPMRADVETRPVLYTRTLPYYWPKGCLYAEVTQANGHSAPGLTNGNSN
FT                   HSDETDAKLCNGTTTKAVNGFGGSHLKKRNFAWSAELSEMKKALQASEKGTDAHTVLNG
FT                   STRLASSIIFRPRDGTSRLQEADCPIQRYSPYRKLLACFWSGWTLGA"
FT   CDS_pept        join(1065659..1065759,1065922..1066075)
FT                   /codon_start=1
FT                   /gene_family="HOG000048298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270363"
FT                   /orf_name="AFUA_1G03670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88079.1"
FT                   /db_xref="HOGENOM:HBG051479"
FT                   /db_xref="UniParc:UPI000051F636"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK53"
FT                   /transl_table=1
FT                   /translation="MATRLQHHGEVRARRWRPAIGSSRIQMNRHLLARRATLCPEDERE
FT                   QVSKESHRKSDLKTQKGSSLAGQRRQSIENGKVLVGLPE"
FT   CDS_pept        join(complement(1069223..1069766),
FT                   complement(1068189..1069168))
FT                   /codon_start=1
FT                   /gene_family="HOG000211955" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904684"
FT                   /orf_name="AFUA_1G03680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88080.1"
FT                   /db_xref="HOGENOM:HBG051480"
FT                   /db_xref="HOGENOM:HBG329233"
FT                   /db_xref="InterPro:IPR018814"
FT                   /db_xref="UniParc:UPI000051F629"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK52"
FT                   /transl_table=1
FT                   /translation="MPPKGTKPTNDELLAQFDDLGIDSTTEKRPSKPIAASTTAQSEDD
FT                   ILAELDNLASQRPNSGPGTPRLSTNEPRPATKSPKPAAVATPRSSEDKSAPRKSGESVR
FT                   SAPSGNKATTTQPSEQEKPKEQEAPASGGGGWWGGIFATATAAMKQAEAAVKEIQQNEE
FT                   AQKWAQQVRGNVGVLRDLGGELKNKALPTFTSLLHTIAPPISSHERLQIHVTHDISGYP
FT                   AIDPIVYSVFSRVMAQVEGGDLLVIQRGQESAPKRGLDLGTSFSTAGWQDGPWWRTVTP
FT                   GTPRSIAAVRGTVEATKLARASAESYATEYFASRGGVEAAAKQATQDLSESNPVRSSDI
FT                   FLAIQAISQTSSTELFQAGPTTEMATPPGVVDVPEATEEEVAFALYLHDPIHGIAFHTI
FT                   SQTIPRKWIDWLDAEAPATADPSVEDAKAPRTTVPEDIAEIVASGGVDPREWVAEWLEE
FT                   SLALAIGVVAQRYVARRMGVGERGPGKGKMRVEQASVVESGAGEAARAL"
FT   CDS_pept        1070999..1071556
FT                   /codon_start=1
FT                   /gene_family="HOG000071411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057922"
FT                   /orf_name="AFUA_1G03690"
FT                   /product="4-carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /protein_id="EAL88081.1"
FT                   /db_xref="HOGENOM:HBG423236"
FT                   /db_xref="HOGENOM:HBG613300"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="UniParc:UPI000051F177"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK51"
FT                   /transl_table=1
FT                   /translation="MRLPYVSDPPPTSTPEEAEILARVKARRAPGDLLPLDRALLHSFP
FT                   VADGWNSFIGAIRTKTTLSTIIKELIICRVAVLNGAWFEWEQHAPLLEEGGLGDEGMRV
FT                   VRDIHADISLNIEEKALSPAEGAVLKYTDAMTKTVTVPDEVFQELKGFFNEREIVEITT
FT                   TVAAYNCVSRFLVALNVGEKNP"
FT   CDS_pept        1073287..1075893
FT                   /codon_start=1
FT                   /gene_family="HOG000211944" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209231"
FT                   /orf_name="AFUA_1G03700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88082.1"
FT                   /db_xref="HOGENOM:HBG051481"
FT                   /db_xref="UniParc:UPI000051F62A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK50"
FT                   /transl_table=1
FT                   /translation="MYVAVMRSIPLFKIYPSEPAMSHHPFSSCPSSQTINFRTVSQVFF
FT                   FSASHNTLSSLLSFIYCGGSLDRTAVPKYCWRLGISQANIFLFGVHLANIECLGTEFGK
FT                   RIQFSVSRFSSNCHTYLLQICSFLWSILHRAGMAPVAQSDIEINHTSDMASQASSLRRQ
FT                   FSEPLSAQSTSTQTSQSPSSLTHKSKCYLCGEYFNTSKSPNDDSSTLKEHIAAAHPHSA
FT                   KRYSLSAAKEHTSNGRLNTDHELTEDAGVSGVDDVEAEVTGDAEESEVVRTYDAGPDGE
FT                   LDEAISGLSTPIRPDGFSRGQTSIIEQRVYKLWNINDVSKFSEDFEERLDDIENTWDTI
FT                   FRNPKRGTKRDASDLPERFNPYKKSKVAKGEFLEITPLENILSQLRDPEYRSVDELYAI
FT                   TENVHLTLKTWQDEYLAIDKLYRLATRQQSKPSADPRKLEDPTVFEGQREAMLYGYKYD
FT                   PKAPGGVQDPFDQGGFMPTAAQTAKIRAKGDPNPDGWPIIHKFGIPYVPMLPKPPAQST
FT                   VAKNTRRRKAAELEAASQELETDDTFFGTPVPAEDKDDSVPSAKRRTRQRRTALEVEQT
FT                   QDNTPVPSAPTSPAPTSAATRGVGRGRGRGRGRGAARAPSRAVSETPQPAANAAPARGR
FT                   GRETKVVASVSHPVPLQARPSSNSGTLSQLAPIEPARNGAQATVSPAVTPARSAEGNES
FT                   LDPAELARREKIANAKNPRRTEAMLNHWARFNREGRIRKPKRSKSQVAADRAAEAARKA
FT                   AEAQKPAIKKSKSRTPGPMNSQVDGPIAPAPAVQPVSLSLPSGPPGLAPMPTVRSMASP
FT                   YAPIDPRGVASFPPGPPGPFQQPPAPVPYRTPYPGYYSPYGASTAGLPPPGPARPA"
FT   CDS_pept        join(1076799..1076961,1077027..1077409,1077478..1078233)
FT                   /codon_start=1
FT                   /gene_family="HOG000211933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270364"
FT                   /orf_name="AFUA_1G03710"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88083.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051482"
FT                   /db_xref="HOGENOM:HBG329231"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000052090D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK49"
FT                   /transl_table=1
FT                   /translation="MGKKRRGPTLEELLARPWCYYCERDFDDLKILISHQKAKHFKCDR
FT                   CSRRLNTAGGLSVHMSQVHKEQLTAVDNALPNRSSLDVEIFGMEGVPDDVIQSHNQRVI
FT                   AQFQQAEAERQAVTGNPPPGAGSGGQPSKRPKLEDVSDLKKRLAEHKARKAEIAAGGSS
FT                   GEATPVGAGQTQAPAPAGYAHSPQTAAAATPQFTYPAPYAGTGSPFPQAASPVYPNFSP
FT                   GAQAQYPIQHTPTGYTPQATPPYGTTPPPFPLPPHQQASPSHTVPQTAPAFPQRSGSLP
FT                   AAPSLPQRPAFQPPPVNAYQMQQIHMGHPLPNAGVHTAVPDGGRAPGAEAASISSSVND
FT                   LVSGAANEADQATAKAAASAGATTEEKPSKKDKGKPTRLVYSDNETSPEEKMARLSRYA
FT                   FVPDRRGETTLEELPAAVVVGTIRESDKIFDSAQ"
FT   CDS_pept        join(complement(1079370..1079501),
FT                   complement(1078970..1079314))
FT                   /codon_start=1
FT                   /gene_family="HOG000211932" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209232"
FT                   /orf_name="AFUA_1G03720"
FT                   /product="UPF0136 domain protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL88084.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051483"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniParc:UPI000051F637"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK48"
FT                   /transl_table=1
FT                   /translation="MTIELSFSIYHQPDVQYLRRLTSLRIHLSKSCTNQSIFGLTVNMS
FT                   QSSLPSPTNSAAALSFLTSVGGIIGYTRTGSIPSIAAGLSVGALYLYSFLRLRDGQPYG
FT                   EEIGLLASAVLGGSSVPRVIKTRGKPVPLALSVLATYGLVVFGLAFREKRASRI"
FT   CDS_pept        join(complement(1080906..1081418),
FT                   complement(1080489..1080849),complement(1079939..1080426))
FT                   /codon_start=1
FT                   /gene_family="HOG000157169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270365"
FT                   /orf_name="AFUA_1G03730"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL88085.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051159"
FT                   /db_xref="HOGENOM:HBG329229"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F87E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK47"
FT                   /transl_table=1
FT                   /translation="MIEDIGVPKNEIAKWVGISSAASSSCQAVMAVTWGTISDTVGRKP
FT                   IILCGLTFTMIFSLMFGLSKSLAMLIASRALLGLMNGNVGIIRTMVAEMVPEKELQPRA
FT                   FSIMPLVWTIGSIFGPAFGGSLARPAVKHPETFGNWKLFKAYPFLLPNLASAFLFVIGI
FT                   TTGWLFLHETLAAKKHHRDVGLRLGQMLTGSCSSRRKNTSNSETQEDDERTALLGKHRS
FT                   TKSTTATRPSWKDVFSPQSTLVLLVYAMMAMHNMAFDSLLPVFLHMPIQRLDGNPEVRL
FT                   PFKFIGGFGVDSQTIGIYYTLIGIIGMFVQFFIFPVAAKRFGVLNCTKATAIASPVLYL
FT                   MTPFTALVPASIRSFVVFMLMLSKLICSIFSFPCCTILLTNSAASLSVLGTLNGVATSV
FT                   NALGRAAGPALIGAAFSYGVNKGYVILPWWLLAFFAALSAVPVFWVDETEAAED"
FT   CDS_pept        join(complement(1084289..1085180),
FT                   complement(1082852..1084227),complement(1082722..1082778))
FT                   /codon_start=1
FT                   /gene_family="HOG000211921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270366"
FT                   /orf_name="AFUA_1G03740"
FT                   /product="Glutamate carboxypeptidase, putative "
FT                   /function="carboxypeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL88086.2"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG192051"
FT                   /db_xref="HOGENOM:HBG713441"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI0000F51AC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK46"
FT                   /transl_table=1
FT                   /translation="MREKAMAPSETTPLLVVNVAPQRYRYPHHALRRACSFSLILILFI
FT                   GLILFLIPFPILPREHGSLWSYLPGASPFPYPSWPNSPGLTYEQLQAVLQSTPSAAKAR
FT                   EWSSYYTAGPHLAGKNLSQALWTREKWQDFGVMDTEIVAYDVYLNYPVDHRLALLKKDG
FT                   DKTDVTFEASLEEDVLKEDHTSGLPDRVPTFHGYSASGNVTAPFVYVNFGTYDDYQDLV
FT                   DANVSLAGKIAIAKYGRIFRGLKVKRAQELGMVGVILYDDPQEDGDITEDNGYKPYPEG
FT                   PARNPSAVQRGSAQFLSIAPGDPTTPGYPSKPGCERQDPHNSIPSIPSLPISYQEVLPF
FT                   LRALNGHGPKASEFNKRWQGGKLGSKGVEYNIGPSPDDVVINLYNEQEYITTPLWNVIG
FT                   TIKGAIPDEVVILGNHRDAWIAGGAGDPNSGSAVLNEVIRSFGEALKAGWKPLRTIVFA
FT                   SWDGEEYGLLGSTEWVEEMLPWLSKTTVAYLNVDVAAAGTNLRPTASPLLYNVIYEVTG
FT                   LVQSPNQTLEGQTVRDTWDGQIDTMGSGSDFTAFQDFAGIPSYDLGFSHGPKDPVYHYH
FT                   SNYDSFDWMDRFGDPGWLYHEACTKIWALAAAKLVETPVLAFNATDYAVGLSTYLDQIR
FT                   PAAEQLPGHSSFNLEPLDKAIARLQKVAAKFDAEAAELTSQLDENLPWWLWWKKVRLYF
FT                   LIRGVNDKYKAFERKFLYQPGLDGRNWYKHVVFAPGIWTGYAGATYPGLVESLDAGDLK
FT                   NAKKWRDIIRERIEDATDLLQ"
FT   CDS_pept        join(complement(1086100..1087379),
FT                   complement(1085756..1086032))
FT                   /codon_start=1
FT                   /gene_family="HOG000211900" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270367"
FT                   /orf_name="AFUA_1G03750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88087.1"
FT                   /db_xref="HOGENOM:HBG051484"
FT                   /db_xref="HOGENOM:HBG329228"
FT                   /db_xref="UniParc:UPI000052040A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK45"
FT                   /transl_table=1
FT                   /translation="MVTPTSKPNSSFSKVYLTKNNYAGRSLHPNAKRPGKGVEESAKEE
FT                   STQVVESFEVDGDKQIVDNEDITAEPASSPVSSLEDHENEILPGFEYFDSAVGERRRPQ
FT                   RGRKDLRGSESPTLRRKRNADEMAHTAQADAEKEDYVFGWSQSQKKRKQGYAGKKSDGS
FT                   LWKAQGSTTAPSQSKSSPSSSASESKTGSSSQKTKTRSRKEAVDRAPSFMVPPDIDDLL
FT                   PSSSGNRTKPEFIASASIPNDTISSSSGFASSAQISHFFDSDDDCSSGTSLSSVPENLL
FT                   EEFSQMEDVFLSDMDDSENTELKQSLCPWCKKAVDSDALRKFRAQPKQRIREQQQFCES
FT                   HQKETAEKEWKERGYPDIDWDTFDERIKCHFDDLESILVPEGNSYYRNVLDTMLKSGKA
FT                   KNFRLTLAGDALETICCGYYGTRGANKMLQALTARFSRKLRRLAAEDHIVKTAGPVIYA
FT                   QAVLVPELAVRLVKEDMGVDVDSARQILRESIEIGEKLNFAPNDVVPIPAESENADDII
FT                   V"
FT   CDS_pept        join(complement(1089598..1091655),
FT                   complement(1088232..1089536))
FT                   /codon_start=1
FT                   /gene_family="HOG000211888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270368"
FT                   /orf_name="AFUA_1G03760"
FT                   /product="DUF726 domain protein"
FT                   /protein_id="EAL88088.1"
FT                   /db_xref="HOGENOM:HBG051485"
FT                   /db_xref="HOGENOM:HBG397864"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="UniParc:UPI000051FB1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK44"
FT                   /transl_table=1
FT                   /translation="MTSPSSTPIDHSVDSSADPLRSGSQAARDTQPSATPTLSNIDQTD
FT                   NRGNGEVEVKTPQGTKPGVNPTLGDNKANADVADELDDFGLPIPVRSKAPCQLEDERPE
FT                   EDERFHDVKETRLPSPKSETIPSENDKRAASHDVSSENDKQSTPPPAYSSLDIQDSVHQ
FT                   SSSTHKRHSSLKPSEWSHQRLSENKAVDSESDDESDGEWKDMPALGEFDVYDDYGRLIA
FT                   RGAKEEGDDAVYQGLGGAGKGYTRVQLDEDAQSATSLDQDTSYLFKETAGNSVGVEGEE
FT                   LRDPLSQLQATKDLLTESQRIAYVGVTRLVIYQMTQDLEKLPTTKASRKAKQKAADAMR
FT                   KWGQTVMGRIYTHMEIDPAEQIMIEQLAEHGVQPADLVRPLMQNARVKNPMAEELDSPQ
FT                   ASMSSSASRGLKGNSRASFSTESELTSESTPPPPYETHGDDDLPEVRTPSQMPTSAKID
FT                   IDLRWTVLCDLFLVLISDSVYDARSRSLLERVGQSMEVSWLQIARFEKRVIDALEMQEA
FT                   AEKETWDESEHMEKRRKMALKRKYMVMGLATVGGGLIIGLSAGLLAPVIGAGLAAGFTT
FT                   VGISGTSAFLGGAGGTALIASGATLTGSTIGLRASHRRTGAVQTFEYRPLHNNKRVNLI
FT                   VAISGWMTGKVDDVRLPFSTVDPIMGDIYSVLWEPEMLQSMGATINILATEALTQGLQQ
FT                   VLGSTVLMALMASLQLPLVLTKLSYLIDNPWNVSLARANAAGLILADSLMDHNLGKRPV
FT                   TLLGFSLGARVIFSCLKELADKGASGLVQNVYLFGAPLVANKDEFIKARSVVSGRFVNG
FT                   YSSNDWILGYLFRATSGGIMRVAGIAPVEGIPGLENHDVTNLVNGHMDYRAAIPRLLKE
FT                   VGWEVLSEEFAEIEDPDPENHGERQRELIREIDEARKAAEAQPEKKRFGLFKRGKLAEK
FT                   KGWETYDVKRNDSFPRESTDSNGTGAVLFDIDAIRAELASEMIEVKQLESTLPPMKLDL
FT                   NSPSTQSPAAATPSEHRAPKDGRATPSVPQTPDENSRGHSASQKTQSPPPRQEQIHMAF
FT                   DTSYDNPPQRSHSSFEPASYDLCPTRPALRSSVTMPTSVGASALGAMALEPNAWADHDF
FT                   GHGEEGEISMTFE"
FT   CDS_pept        complement(1095865..1096794)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270369"
FT                   /orf_name="AFUA_1G03770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88089.1"
FT                   /db_xref="HOGENOM:HBG051486"
FT                   /db_xref="UniParc:UPI0000520200"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK43"
FT                   /transl_table=1
FT                   /translation="MSLEYHYTNLAVYELAIGEGYRDPDAIKQEYYTLPRPEGDRRNQR
FT                   ASNPLSAIRVDITIKWMHTAHEMLNFFLSCDNELMRKLPNLAYTRVGVALMSLLKIYFT
FT                   VISGGLGKFVTPESVKVEMYLDAIARRLTEASGGQKYKIPSRWYYVLAVKSRNWYDRLQ
FT                   QRQAQRESSFASQMEVGQSIQMQVPAHTLQHPCPVNPNCSTEPLVGDAGIPQRPPYSNM
FT                   GGAYGAPVAMNHMWHVDQSHAPTSLSYQYPEYQPPILQSQYGYVAQHPSLPSESNQDQP
FT                   PLHRSTGMELDGWLPDGSIIGAPTLPGL"
FT   CDS_pept        complement(1097186..1098241)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270370"
FT                   /orf_name="AFUA_1G03780"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88090.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051487"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F15D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK42"
FT                   /transl_table=1
FT                   /translation="MSASSDVMPTDGGHSQQTAPPQQLNRSCESCRGLKVRCIPDPTTA
FT                   NQCQRCTKTGRVCIFVAPQRRRPRKRTDSRVAQLEREMRQMRSLLKDRLHADDSSGESV
FT                   DSDHDESPEHDSGVESKDHLSSIPEAPSSVSTSTRHTDQSYGGVPLSSYPTVVESSSVS
FT                   IPSFTPGFSDNSPEMPIGDDVIDRGVIPLEYANELVAFFIRDLMAFAPVVVLPPETTAS
FT                   HLRHSKPVLFLSIIAAAAIAVDATVAAVLNRELVRLYAERFFIQGEKSLELVQALVLMT
FT                   VFYYPPDSPMKLQHFQYTHIAATMALEIGLASKRRVSPKAGGKKDKRNAYDEQMAEQAR
FT                   AILECYHLAST"
FT   CDS_pept        join(1102878..1103058,1103167..1103191,1103220..1103243,
FT                   1103296..1103440,1103511..1103822,1103876..1104003,
FT                   1104054..1104095,1104131..1104230)
FT                   /codon_start=1
FT                   /gene_family="HOG000211855" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270371"
FT                   /orf_name="AFUA_1G03790"
FT                   /product="Mannosylphosphorylation protein (Mnn4), putative "
FT                   /protein_id="EAL88091.1"
FT                   /db_xref="HOGENOM:HBG051488"
FT                   /db_xref="HOGENOM:HBG329226"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniParc:UPI000051F3D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK41"
FT                   /transl_table=1
FT                   /translation="MILTCAMHLFSTAFLLYLHGFLLALVALGSADSDVDFMSVRAKFL
FT                   KDYSGKGGEPGEKYFICLELHRNLFHYHYDGRFAEEPLPEEDTIPHLAALIQTYLSTMA
FT                   DLGAETWIMHGTLLAWWWNQKIFPWDNDLDVQVTEPTIHFLAEYYNMTEHHFELPGVDG
FT                   GRNYLLEINPQYVVRTTEDAANVIDARWIDTSSGLFIDITAVRKDDELRKKGQQGALMC
FT                   KDGHRFDETDIFPLRNSYFEDFPVKVPYKYTDLLVEEYGSKALTTVDFQGHHFNEDTKI
FT                   WEQTNWLISQLPERNEDFHGSEDPSLSPSGPRRYPIV"
FT   CDS_pept        join(1105633..1106241,1106297..1108156)
FT                   /codon_start=1
FT                   /gene_family="HOG000209860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270372"
FT                   /orf_name="AFUA_1G03800"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88092.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051489"
FT                   /db_xref="HOGENOM:HBG329822"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005208FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK40"
FT                   /transl_table=1
FT                   /translation="MSFPPIDPMSSASQPLSSPSSSSNPSGYIKSTSVDHAANPGTHTA
FT                   HDPPSIRSCVTCRRRKVRCNKRTPCSNCVKAGIECVFPPPGRAPRKSKRPHDAELLSRL
FT                   RRLEGVIEHLSGKKSGAVEPLFTVSSPSQQEPGSASPQEGRQTTPQTQGVQAGKCPFVL
FT                   DSDPKAVKPRNLEHDFGRLVIDEGRSRYVSNRLWASLGDEIEELQDILDPSSSEEEDHP
FT                   SPGSSSTLSTNHDGFLFGYYSLSHSLRSYHPPPPKVPVLWDIYLDNVAPLIPMFHKPTV
FT                   RKLLTDAAQNPNFLDKNSEALVLSVYYVTIVSMSPEQCFSILGDDRDTAVTRYRFAVEQ
FT                   ALSKAGLLNTQSLMLLQAAVLFLIGVRREDDTKFVWTMTAVVLRLAQGIGLHRDGTNFG
FT                   LKPFETEMRRRLWWHICLLDIKSAEEHGTDAQIQDRMFDTRLPLNINDDDITLDMQEPP
FT                   EERVGFTEMTFCLVRCEITAALKRISSMCPTNLPHPENTQQPADSCAKLIQEVNKRIEE
FT                   RYTQHCDMNVPVQWVCATVARLILAKLWLIVHHPMTRKDPAAGNLTIASRETLFVTSVE
FT                   IAEFTRLLGRDQTTAKWSWLFVTNMQWHLIAFVLSELCVRPLSPLTDRAWQVVSSLYET
FT                   WGLTAKHRKGMLWRPLSRLMKRVAAFREQQQQQQQQQQQQGLQNTSDPSSAPSLFTPYH
FT                   PGVWQSAVQPYLAGGVPQIRDLSVPGSVQPASQPIAGPTFDAEIVPELFPNVTWPALPD
FT                   SQSMSAKDPLSTAAPIEISENFLGPTTTSQDPALQQNWEAWDQVMRDFQMDVQEAQTSH
FT                   PLGNISDWLA"
FT   CDS_pept        join(1108755..1108847,1108910..1109134,1109208..1109392,
FT                   1109485..1109551)
FT                   /codon_start=1
FT                   /gene_family="HOG000211854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270373"
FT                   /orf_name="AFUA_1G03810"
FT                   /product="Oligosaccharyl transferase subunit Dad1, putative"
FT                   /EC_number="2.4.1.119"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /protein_id="EAL88093.1"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="HOGENOM:HBG058552"
FT                   /db_xref="HOGENOM:HBG329225"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniParc:UPI000051EC88"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK39"
FT                   /transl_table=1
FT                   /translation="MTLVCPLSGCVHSSFIRTLSTGHSTAKLPLQTSMPPKRIQTPSSS
FT                   SLSSGPAVLSSNSSVFQIAHHVWQQYLTTTPQRTMMLDAFMVFLLFVGAVQFLYCVLAG
FT                   NYPFNAFLSGFCAAVGQFVLTASLRMQTSSELKGVNSKPSSKGKNARFAAVEGGEQQGA
FT                   VSHERAFADYIFGSLILHFFCINFIN"
FT   CDS_pept        join(complement(1110310..1112697),
FT                   complement(1109889..1110248))
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057923"
FT                   /orf_name="AFUA_1G03820"
FT                   /product="MRNA splicing factor RNA helicase (Prp16),
FT                   putative"
FT                   /EC_number="3.6.-.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL88094.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000052090E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK38"
FT                   /transl_table=1
FT                   /translation="MASDGMPPAKRLKSSNLPPHLRDAKRKDIDNWETNRMLTSGVAQR
FT                   RDFEGDFLPEDEEGTRVHLLVHDLRPPFLDGRTIFTKQLEPISAVRDPQSDMAVFSRKG
FT                   SKVVRERRQQRERQKQAQEATTMAGTALGNIMGVKEDEGDSAVAMPVEDTYRSGNKFAQ
FT                   HLKKDEGGQSSFSKSKTLREQREYLPAFAVREELLRVIRDNQVIVVVGETGSGKTTQLT
FT                   QFLHEDGYSKYGIIGCTQPRRVAAMSVAKRVSEEMEVDLGAEVGYAIRFEDCTSKDTVI
FT                   KYMTDGVLLRESLVQPDLDKYSCIIMDEAHERALNTDVLMGLLKKVLARRRDLKLIVTS
FT                   ATMNSERFSRFFGGAPEFIIPGRTFPVDLHFSRTPCEDYVDSAVKQVLAIHVSQGPGDI
FT                   LVFMTGQEDIEVTCELIDERLKMLNDPPKLSILPIYSQMPAEQQAKIFERAPPGVRKVI
FT                   VATNIAETSLTVDGIMFVVDSGYSKLKVYNPRMGMDTLQITPISQANANQRSGRAGRTG
FT                   PGKAYRLYTESAYKNELYIQTIPEIQRTSLSNTVLLLKSLGVKDLLDFDFMDPPPQETI
FT                   STSLFELWSLGALDNLGDLTPLGRAMTPFPMDPPLAKLLITASEEYGCSEEMLTIVSML
FT                   SVPSVFYRPKERQEESDAAREKFFVPESDHLTLLHVYTQWKSNGYSDGWCMKHFLHPKA
FT                   LRRAKEVREQLHDIMTVQKMRLVSCGTDWDVIRKCICSGFYHQAAKVKGIGEFINLRTS
FT                   VSMQLHPTSALYGLGYVPEYVVYHELILTSKEYMSTVTAVDPHWLAELGGVFYSVKEKG
FT                   YSQRERRVTEQEFNRRMEIETQMAADRERAAAEKLREQERNDPSRRKKEVEAGSVVRRP
FT                   AVTGARRIGGVTASSTTRNGTNGASGGGTVVKKPQIKRRPGRAF"
FT   CDS_pept        join(1113184..1113223,1113282..1113372,1113422..1113614,
FT                   1113682..1113714)
FT                   /codon_start=1
FT                   /gene_family="HOG000211843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209233"
FT                   /orf_name="AFUA_1G03830"
FT                   /product="Prefoldin subunit 2, putative "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="EAL88095.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="HOGENOM:HBG631382"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI0000520431"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK37"
FT                   /transl_table=1
FT                   /translation="MASQAQINPKKQQELQLQYTNFKNTLTQMAQKIGDIEQEAEEHKL
FT                   VIETLEPLPEDRKCFRMVNGVLVERTVKDVLPALKTNSDGLKQVLDELVKQYQSKQSEL
FT                   DDWKKKNNIQVVQP"
FT   CDS_pept        join(1116018..1116168,1116508..1116645,1116720..1116847,
FT                   1116942..1117196)
FT                   /codon_start=1
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270374"
FT                   /orf_name="AFUA_1G03840"
FT                   /product="CCAAT-binding factor complex subunit HapC "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88096.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00005208F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK36"
FT                   /transl_table=1
FT                   /translation="MSASPSKEPEVEQEAQSGEDQEHMDKDQEQTQNQGEFEVKEQDRW
FT                   LPIANATCANIYRQVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQE
FT                   KRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRETQSARGEHQNRPTSSGYNAGGPVG
FT                   GSNTQGGRPGASASGGFPETTDNTNNIINPGLDPSEQDSSAYGYPSMVGQPHNGAGGDS
FT                   Y"
FT   CDS_pept        join(complement(1120498..1120564),
FT                   complement(1119258..1120419),complement(1118109..1119198))
FT                   /codon_start=1
FT                   /gene_family="HOG000211811" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057924"
FT                   /gene_name="amdR"
FT                   /orf_name="AFUA_1G03860"
FT                   /product="Acetamidase regulatory protein "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88097.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051490"
FT                   /db_xref="HOGENOM:HBG329829"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK35"
FT                   /transl_table=1
FT                   /translation="MSSTAQKNSLSPTGNGVTKRKSGSAACVHCHRRKVRCDARIVGLP
FT                   CSNCRSSGKTDCRIHEKKKRLAVRSILNPVPIRCRPPSTSEHVPEASPPSTISEPTAFT
FT                   TAFRGVQPEAAAPPASVAPNVQSKAQHLHSNSYSQTSPQAQECHLPPASDRFAEQDAHA
FT                   DFEKRLVKLIDDEEGSGPREIQRGVRAIYVGHELSNMSFLIRQQRDKDDDVYHFAGSEI
FT                   PRRQLKTGHDQLLVDALTLPEPALVDELVQAYFTHVNPGYPIVEEDQFMSQYRNRDPSD
FT                   PPPILLLQAILLVGCHVTHPKEERDALKAIFFRRAKWLFDNRIERNRDTLVQAALLLTW
FT                   HSDSPDDDVSANAHYWVGVAARIATGLGMHRNPVSSRFAPRDRRMWRRLWYILVQLDVM
FT                   VSLSYGRPQAINLEDSDVSPLTASDFEGCGARVQTDYVIHFSELCTMISYIVRERFGLR
FT                   VSSERRKAALQEADEALANWSLRLPDHLRLRASDMDPWSAMLHLTYNNFLILLHRPHPR
FT                   ASAYSDDYGPHDAEICSAAAGVITSIFEELRLNDRLKYLWYSGVHTLFTAMIQVRVELR
FT                   FSNPVLAINALRRFDSASCSLRELAKYWSHATTILRLFEDSKRLQKDLRLATSERSRPF
FT                   SSTQDQPQAQALDQNKNQHQHSSADAPVQPPQPDRLLPSYDSPTPDSTSLPQTAVSPHQ
FT                   NLTFDSWIPSTNLATVDPMDQPREFLDWRQLFSFTDPDQPVLPMSMDGLPELEDEWRQI
FT                   YWQETPMSDLLQDGGWMHG"
FT   CDS_pept        complement(1121203..1122588)
FT                   /codon_start=1
FT                   /gene_family="HOG000211800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270375"
FT                   /orf_name="AFUA_1G03870"
FT                   /product="Cut9 interacting protein Scn1, putative "
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="EAL88099.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG051492"
FT                   /db_xref="HOGENOM:HBG329832"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="UniParc:UPI000051EA36"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK33"
FT                   /transl_table=1
FT                   /translation="MLIQLIHEWSMLVTEAPGITVITVMVSVFPVSFRYYYITAFSCHP
FT                   QGPKTISIILPRDQHIWDGRNMPEYDHDKVPDFPWELGVYDAHCHPTDAMSSISDIPGM
FT                   KAATLTVMATRAEDQDLVFQIAKDLNNAKLTVQDAETDRVLPSFGWHPWFSHQIIDDQK
FT                   SSSDITQGASDLESKKTHYHKVLTPAPEDEDFVSSLPDPKPLSQFISETRERLLSFPNA
FT                   LVGEVGLDRAFRLPKAWTQQEAENRNAHITPGSREGRKLSPYRVHMEHQKAILKAQLRL
FT                   AGELRRPVSVHSVQAHGAVFDVFKELWSGHERRVPSRRERRRRLSVEGAHAESDAEDEQ
FT                   VQKSLKREGSPLPYPPRICMHSYSGPVEQLKQFLNPSNPSDVYFSFSNVINFSGPSSQK
FT                   VIAVVKALPEDRVLIESDLHTAGQQMDDLLEEVARQICELRGWSLQEGVQRLADNWKRF
FT                   VFG"
FT   CDS_pept        1122794..1124017
FT                   /codon_start=1
FT                   /gene_family="HOG000211789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270376"
FT                   /orf_name="AFUA_1G03880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88100.1"
FT                   /db_xref="HOGENOM:HBG051493"
FT                   /db_xref="HOGENOM:HBG329833"
FT                   /db_xref="UniParc:UPI00005201F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK32"
FT                   /transl_table=1
FT                   /translation="MSITCSTLLTVPFLALVSLPLVFSAYITICLSILTLFLRLLVLYV
FT                   ELCFAIVSNYFVVPTSSKSSLLSFASEPTTPAASPTPKRRSIDHGVTVILPHTSSHRQI
FT                   APFSRVRTRPAPARRRNSSISSTGRPDGDHARPAGKEELRRNGVTTPPSALLTLLSGDE
FT                   DRDFEGVGGWRCPPSARSQGHVSRSASSSSKASLSDEADERAWLSINDRLELPSQPFPL
FT                   RSHPETADILPWRHSQAASCSPDGRRQRHHHRSATTSLIPSQTRRAPTSPSASRSNRSA
FT                   GSGARSRGLSPRPRSQDASSLSTYSDFFHAMASAPQAHSQLHLSNSSEVPGGYFAFRPG
FT                   NGANSSGSAVSTGTTTPVEDRSSTTSRNMGRFMAHYPAGVRYRRRSVSGANLGSQLPNA
FT                   SLSIDRPF"
FT   CDS_pept        join(complement(1125870..1126046),
FT                   complement(1124301..1125848))
FT                   /codon_start=1
FT                   /gene_family="HOG000211778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270377"
FT                   /orf_name="AFUA_1G03890"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88101.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051494"
FT                   /db_xref="HOGENOM:HBG329834"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000051F8A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK31"
FT                   /transl_table=1
FT                   /translation="MTSESLSSSKDDLHDRGRAHHGPYVSQQESTPYAARGANTAAARS
FT                   SWFPLGYREGFSQWMITKVIAQVTEIWFQWASLPAAAAEHKVLSFLPYLQHEPPTHLQT
FT                   GKTTTQRDGVAQSLQSADLSQQSEVSAHSTDDPYGPRRWRSSMVELSGKDRALNEFSVE
FT                   RVGEEVDQHLVMLHGYGAGLGFFYKNFEPLSRLKGWQLHALDMLGMGRSTRPPFRIKAK
FT                   NREDAIKEAEDWFVDALEEWRVKRKIERFTLLGHSMGGYMGVAYALKYPGRLNKLILAS
FT                   PVGIPEDPYAVSADMPEPSESTLAQEFTQDQQTIAQSSLSVPPEVAQKGDNNVLLKGYG
FT                   NAAAPPESRPARRSIPKWFAYLWEANISPFSLVRWAGPLGPRIVSGWTSRRFSHLPANE
FT                   AKALHDYSYSIFSQRGSGEYALAYILAPGAFARSPLIRRIQNVGRQIIPPSNPSGEPAN
FT                   VTDPSPSQPPSDSATQASSAPGKRETGIPIVFMYGDHDWMDAAGGLAAKAKIEEEKRRV
FT                   LQNASPEEREADNGSAKVVIIKGSGHHIYLDGWEEFNKVVLEEMEEVSQRERARSRT"
FT   CDS_pept        1126793..1128196
FT                   /codon_start=1
FT                   /gene_family="HOG000211767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209234"
FT                   /orf_name="AFUA_1G03910"
FT                   /product="Spo7-like protein"
FT                   /protein_id="EAL88103.2"
FT                   /db_xref="HOGENOM:HBG051496"
FT                   /db_xref="HOGENOM:HBG323873"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniParc:UPI0000F51AC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK29"
FT                   /transl_table=1
FT                   /translation="MAAQTRSLDQLVKGSPAPGSLPESLSRPSGQLNTLQPPFSQDASD
FT                   PSSPPRSSTPDLLSTLPSSPPQIYLNLLILESSLRAQYLALRERRRQNTFFLLLLAAWI
FT                   AYFAYALFLRPREDGSGVGGSIYWMVEMGEKVALLGGIVTALLVWGTGQWERGVRWPRR
FT                   WLAVANRGLRTMNTKIVIIRGPWWQELLSYLSFLFPFTLPFFPAPTGNFHYIERPSSDK
FT                   RGSRQHYQQYYNNVDSESGLVEEDLSPGGDYIRLLLLPKSFSPEFRENWDDYRTEFWEK
FT                   ENERRAQLRQKLRQKERQLARQEGGWFWWLGLGLGWKASQRRRLVAATLKSSDGDKHRH
FT                   HHHHLSSISKHAHDLKSPTRRGPRSESHSRTPSRSTTPVDIDDRPPSRSSASSRPRRGS
FT                   TTPSSTASEQSMQLRKKKGTKSLSRGLSPLTQAQIREGIYNTSSLSSDDSFLGESRETT
FT                   QSREASPSV"
FT   CDS_pept        join(complement(1131644..1131716),
FT                   complement(1131567..1131597),complement(1131456..1131507),
FT                   complement(1131358..1131404),complement(1131194..1131299),
FT                   complement(1130872..1131135),complement(1128736..1130804),
FT                   complement(1128633..1128669))
FT                   /codon_start=1
FT                   /gene_family="HOG000224126" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904685"
FT                   /orf_name="AFUA_1G03920"
FT                   /product="DNA replication licensing factor Mcm3, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88104.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI0000F51A43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK28"
FT                   /transl_table=1
FT                   /translation="MDGVQLRDEAGQDRVRAAVEFLDPKVLTGDARARSYRADIVLMLN
FT                   RGLRRLTVSIDEIRAHNRELADGLLTSPFDYSLAFDRALKEVIKTLPNRPSRETADDVN
FT                   YYCAYVGAFGEFSCNPRTLGSTHLNRMISLEGIVTKCSLVRPKIIQSVHYNERKDRFVA
FT                   RRYRDQTMTTTGITNMNVYPQEDDEKNPLITEYGYSTYLDHQTISIQEMPERAPAGQLP
FT                   RSVDVILDDDLVDSAKPGDRIQLVGIYRSLGNRNASSGSSTFRTVVMANNIIQLSSKSG
FT                   GGIAQATITDTDIRNINKVAKKKNVFELLANSLAPSIYGHDYIKKAILLMLLGGMEKNL
FT                   DNGTHLRGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKET
FT                   GERRLEAGAMVLGDRGVVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTSLNARCS
FT                   VLAAANPIYGQYDPHKDPHKNIALPDSLLSRFDLLFVVTDDIEDARDRMVSEHVLRMHR
FT                   YRQPGTEEGAPVREDLNQTLGVGLEDNQDSNQPTEVYEKFNVMLHAGMANSSRKGKGIE
FT                   ILSIPFIKKYIQYSKSRIKPVLTKGAADHIVATYSALRNDELSGNQRRTSPITARTLET
FT                   LIRLSTAHAKARLSNRVEERDAKVAESILRFAMFKEVLEDERRKRRKVTTFDEDSESSE
FT                   SDSEDDNTPANTTATPRSSRRVGTMRTRSAATRSTNGDEMDADGDVVSEDGDGLYSASP
FT                   RGQRLRSSQTSRTQTQTDSQSRMSVASSQPASQLIQSQTDDSQSQNAMSSTSSSQPIQP
FT                   ARLTMFRQALGPLMGTRLFTHGDTADVEELIGAVNTAVRESPSLGAGHVFQRAEAIEAL
FT                   KAMNERNELMFLEDDETVYRI"
FT   CDS_pept        complement(1132174..1136061)
FT                   /codon_start=1
FT                   /gene_family="HOG000211756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057925"
FT                   /orf_name="AFUA_1G03930"
FT                   /product="Translation regulator (Cya5), putative "
FT                   /function="binding"
FT                   /protein_id="EAL88105.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051498"
FT                   /db_xref="HOGENOM:HBG329840"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051F3CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK27"
FT                   /transl_table=1
FT                   /translation="MLERAAGCLENAGRRFFRDSKGALRSRRSWYPHFAQSNGTSADTV
FT                   HLSHSASTTSDRQDSLISVSWRARSATADTWTPVLDFLYPPRTQEFAASLLLRPSRRLA
FT                   VRRKKKPIPALTRAYTSVAASLYKPVIPDKPVVDLDAKRADQLERFRAKEELRSILNQS
FT                   KPGVYGDYDRAWDLYETARRPKDVTPAFLAHLSRSTLLRNNLRAQWVFRRIYPRDRSPE
FT                   DYLHLAKSYLAVGKPDEIIRICKDAKGGGGDVLCWAFAFSHFVNKADWDSAEKFWNARP
FT                   PSSEKVLLNAVASELNDSNLPTKLFDLAEVLRSQETSMSWSGLVHFLLDYAFSNSRIAA
FT                   DVSTENILLLLKEYNLLGFLTAQHYFRLIRALQSSDVRSTFTKSIVVYRNLRWQMEQEV
FT                   PPADLLGAFLRCLARFEITTGIHYFLGEYARFHGQPSIDAYKNALIAFSRAGDVENTNS
FT                   VFEQLVKHHGKPSSRRLLTPLLYVHARLGDVTATRRQFERVSKEFGLTQNTVCWNILLT
FT                   AYANADDFGGAFATFDKMLEEGVQPNSHTFGALMGLCANRGDIDTVRQLLELAKRSPVR
FT                   ITTPLLDTIVEAYCNNRELEKAESVAETCLGLDVKGSRVRMWNVLLWNYAFRMDLESIS
FT                   RIRSRMDSAGVQPDAMTYAALMLSLVLRGQTDPARRILRTLHRSNHMYATEFHYAIILY
FT                   GYVKDRNRDMVHIIFREIKERFKRPGFTSRLLVLRNQLQRDLELIKTGGRAGSGANVRL
FT                   ENAERFLAETIADFDKANMASKEPLPGAGRLPITQAFPAMYYEYLITAYGTRGVFHRVK
FT                   ELFDQFLRDRKSSTSERPAYDVAPLRLVSALMLTYLKSEQYKKVEECWQITFPRVVKMA
FT                   TQPDLDEWLADRLLRAEETEQPDYPIPSPVNSHKDVLLSSDKPDILALKPPSILPACRF
FT                   LLSRPLSLYMRSLAYRNETWRIPQVVAEVQKAGFPLTTFNWSTYVQMMASSDKPSDQVE
FT                   AFTVFERKFMPNFPGWNNLRRGYGVRPPGVPSTIDVMENPRRAKPPNMLGKESRRYWSK
FT                   IQPDFMQPTYVSMVYLASALQAFRERSIYDGGLEVGTLFKVAPKTIAAIADMPYLREKF
FT                   QGVLLRRRQEQGDKKGDSGDRDHFVWTGGILGVGGKPRSPTAVERPAMEADQEENASAS
FT                   ARPQPDVTDDEAPDAPNAPAVEAGLSPEEVSAPNAKSIDPQDQFDIEAEALLGSRRALL
FT                   EASEALLDNEHRASADEVDETDISSLIDDLANPDEDAPKSADGRQQQEPPTEHQGQPEQ
FT                   EHHNNGMAHDA"
FT   CDS_pept        join(1136233..1136363,1136610..1136774,1136849..1137988,
FT                   1138046..1138550)
FT                   /codon_start=1
FT                   /gene_family="HOG000211745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057926"
FT                   /orf_name="AFUA_1G03940"
FT                   /product="Signal recognition particle, putative "
FT                   /function="binding"
FT                   /protein_id="EAL88106.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051499"
FT                   /db_xref="HOGENOM:HBG329841"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051F3D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK26"
FT                   /transl_table=1
FT                   /translation="MQKGHEIATGDAPEPGKKEKRLYIGKFNQYCYNKTQFQGILWVTE
FT                   REDVLLAGDYNAYRAHTTRRLHKLRKKLGQTTPKGRKYTAKPPVSAEDISNNVAYVHVL
FT                   LLSSERAWAQAMHMKSTHSADPSAKGIAGSAKRHIMSRLNKASGYSQQLVLLLEDQATS
FT                   GASDTDILEAHAYLASLLGALYLEKRKWEQCIQSYAVSRIIYTTLGREDRKDVFRDLLT
FT                   GTIDPSIRYAAYQMKLPRSRPLSSLAIQYFPSDANIRSKVERVDPDCLKENIAGTRKTA
FT                   DGEIQQLPESITWRSRTVALEDATISQALASAAAAESRLKSWLADVEGESASSKDKAAA
FT                   YDSVIIASQDAVDATKTAIDDLANEGVEPSDKRMQSLQITRTAVNYALVGWRIGRNRVL
FT                   CGTNDGMIFETDKAECLKRGKGASREESTGKKLTRLREKVVLYDSILQSIEFILELPGV
FT                   AADTTFVQELEAKRCYFRALRCLSIARSHCYLGNSKNALALYSQAMQLTAQSTVSDQSS
FT                   QLSNEPLRLDVSRSQVQTLGSILQGLVAQYRGLVTLEKMAAEGPQTGNQRPVIERLHEY
FT                   SGDKVDLSNLVPYPPQMQPIPVKPLFLDVAWNYIDYPREGAHTQEETQPPKGTGTDEKK
FT                   GGRRGWFGFGR"
FT   CDS_pept        join(1140160..1140319,1140405..1140555,1140632..1141886)
FT                   /codon_start=1
FT                   /gene_family="HOG000181358" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209235"
FT                   /orf_name="AFUA_1G03950"
FT                   /product="Cytochrome P450 sterol C-22 desaturase, putaitve "
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88107.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG065082"
FT                   /db_xref="HOGENOM:HBG592092"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051E7F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK25"
FT                   /transl_table=1
FT                   /translation="MANVNGSFVSPSADATISPQLFYNVDSLSAVLNGFTFWKALATLF
FT                   FAAVIYDQLRYFYLKGSLVGPTFKLPFMGPFLQSVNPKFHEYKAKWDSGELSCVSVFHK
FT                   FVVIASTRDMSRKIFNSPAYVKPCVVDIAHKLLGPDNWVFLDGKEHVEFRKGLNGLFTR
FT                   SALSSYLPVMEECYNKYYKYFLEKSKANDYKPEPWMPEFRELMCAVSCRTFVGHYMTDA
FT                   AIKKIADDYYMITAALELVNFPFILPFTKAWYGKKASDMVLEEFSNCAAKSKAHMAAGG
FT                   EITCIMDAWVKAQQDSAKYNEKIAKGLPVEDSEKPSHLLREFTDYEIAQTVFTLLFASQ
FT                   DATSAACTWLFQLVADRPDVLEKIREENLRVRNGNINAPLTMDLLDEMKYTRAVVRETL
FT                   RYRPPVIMVPYLVKKDFPITDSITVSKGSMIIPSVWPATHDPEAYPNPDSFDPDRWITG
FT                   DAEKQAKNFLVFGTGPHYCLGQTYAQLNLIAMIGKASLEMDWEHAPTPKSEDIKVFATI
FT                   FPEV"
FT   CDS_pept        join(1143212..1143487,1143561..1143959)
FT                   /codon_start=1
FT                   /gene_family="HOG000211734" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270378"
FT                   /orf_name="AFUA_1G03960"
FT                   /product="Rhodanese domain protein "
FT                   /protein_id="EAL88108.1"
FT                   /db_xref="HOGENOM:HBG051500"
FT                   /db_xref="HOGENOM:HBG329843"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000051FB45"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK24"
FT                   /transl_table=1
FT                   /translation="MASVLSIRRPIAALAARTAKTTSQKAIPHAAVTALLSSTASPRSY
FT                   FTAPRPQTARLALASSNIKQHLSHQQQTIRRINDYTTKPLRSWKFEDINAALPSDPAGP
FT                   PSPPANPQGKLILIDVREPAELTSTGIIPTAVAVPLASQPDALFLTPDEFETRFGFPKP
FT                   GIEEEGDIIFYCKAGVRAKTAAQLAVQAGYNPDRIGVYEGSWLDWADKGGRVEKWEGPK
FT                   HE"
FT   CDS_pept        join(complement(1147462..1147911),
FT                   complement(1144871..1147383),complement(1144571..1144814))
FT                   /codon_start=1
FT                   /gene_family="HOG000105770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270379"
FT                   /orf_name="AFUA_1G03970"
FT                   /product="Mitochondrial translation initiation factor IF-2,
FT                   putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="EAL88109.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG141178"
FT                   /db_xref="HOGENOM:HBG635083"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI000051E7FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK23"
FT                   /transl_table=1
FT                   /translation="MAPKKKGNRKQDDDWEAELGESIAPVSEQPKDATPADAAPEEDDM
FT                   GGGLLAALRKNKNKKAKKGKPVNDFVEGEDATEQANGDVDFSSKQPEEGTVDQEDVFAG
FT                   KKKQKPAKATPPAPASVEGDGEIRVKTKKEKEREKKEREKQRKREQALKKKATAPEPKA
FT                   EPAKAEKKEQAAPAAAAAPTPPAAAPEAPGKKKKLPAHLAAIQRQQEALRRQREEEERR
FT                   LAEEKAAEEERLRREAEEEKKREEARQRRKEKEREKKEQLRREGKLLTKAQKEAKERNE
FT                   LRLKQMLAAGVGKVAGLEEPGIEKKKPVYDNRKRKGLKKQEEDLEAAAARARAQREAEE
FT                   ERRRKEEEEKKAKAEAEAAAAAAAAGDEESEVDDWEKAAEAEEEVKDSWDAPSEDEGEK
FT                   PATNGVAKPAAAPQQKAEVHESESEDDSEDDSESESEDEEKSAAQKAIAQRKAEAAERR
FT                   KKQHEEALAARSKDNLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATY
FT                   FPVDALRQKTAVVNKDGKFEFKIPGLLVIDTPGHESFSNLRSRGSSLCNIAILVVDIMH
FT                   GLEPQTLESMRLLRERKTPFIVALNKIDRLYGWKKIDNNGFQDSLAMQSKGVQNEFRTR
FT                   LEHTKLLFAEQGFNAELYYENKSMARNVSLVPTSAHTGEGIPDMLKLLTTLTQERMTNS
FT                   LMYLSEVECTVLEVKVIEGLGTTIDVVLSNGILREGDRIVLCGLNGPIATNIRALLTPA
FT                   PLKELRLKSQYVHNKEVKAALGVKIAANDLEHAIAGSRLMVVGPDDDEEDIEEEVMSDL
FT                   ENLLSKVSRDQRGVSVQASTLGSLEALLEFLRVSKIPVANISIGPVYKRDVMMCGTMLE
FT                   KAKEYAVMLCFDVKVDKEAAAYAEEVGVKIFTADIIYHLFDDFTKHMAELTEKRKEESK
FT                   LLAVFPCVLRPVAVFNKKDPIVIGLDVIEGSLRMHTPISAVKTNPTTGAKEIIDLGRVV
FT                   SIERDHKPIQVCKKGQPSVAVKIEGANQPMYGRQLEEKDTLYSHISRASIDTLKEFYRS
FT                   DVSMEEWALIKKLKPVFDIP"
FT   CDS_pept        join(complement(1152143..1152696),
FT                   complement(1151979..1152093),complement(1150351..1151914),
FT                   complement(1150111..1150289),complement(1148612..1150057))
FT                   /codon_start=1
FT                   /gene_family="HOG000211723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270380"
FT                   /orf_name="AFUA_1G03992"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27334.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG323874"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI0000F51A4A"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S5"
FT                   /transl_table=1
FT                   /translation="MSPPLSDRGFDASGKRQDMGPMDIEQEGPSTTKPVVGLLSQTLVS
FT                   SPIIQLILPARLRSKHQNDVVFVGERHIQIKEALSGIHLEDVNSESDFDAYIMAAKVIN
FT                   VSTELPWEAQMKLAASKAAVTDPGSRQELPPQIMVLSLASRELVFLYFSSTSGHFIHHH
FT                   RPLPNDVSTFERFGRNIAVEPRSRAVAVSASADYFGVFMLKKPPVLQAQMASSHLDPIT
FT                   EERFFRVEGDILFMEFLYPKAEDGDKIILLLLVSQNQVTQAICYEWHADETIRQASPRI
FT                   TKRFLPPEDTLPTMLIPLTKTSSFMLITTTSMAVYKNRLDPRRQPSRYPLPVPDREAKK
FT                   APLWTRWARPLRNWSYNQRHDDIYLCREDGRVFYLGIGNEGELENQAHLGQLCCDVDAA
FT                   FDILDIGHEGGDLLLAAGTTGDGGLFVQKARDQPRCVQKFINWSPVTDSVIVSSGQDSS
FT                   SSDTARDRLFVCSASSYGRGAIFELRHGLEAQIGLVVSLEDLSSTRDIWTMSDDINGGV
FT                   YLLISDPVSSILLYLSADFGEEMCAIDEADSGLDFSTQTLAAGCTSSGVLVQITEKAIL
FT                   LGTTTKSTMRARFEFGSDQSVAVAAVHSSASLIASAVRTRHEMHLSLKSINIGQDQLHL
FT                   SEIGQPLRLPHEPVSILIEVLGTFTLIFVGTGNGKVLIYSFEDSTMLLSEVSIDVENGD
FT                   DLSKAIESLAVVAIDTDGPSQKYTILCGLRSGIFAPFEMTLGHGNTKCAIEVKPASPRR
FT                   IGNTSVKIQSRGQFALLTCGHGFWQASCPRKDGVIDPNLHLQRIWVTDQNNPAYHPGNV
FT                   HSFAMAKTIDPNIDGEADTLFCIADGQLLICTLDHAAKTVPRRIDLPGSASKLAYSNYL
FT                   RSLIVAYTRAELDTESDPIRRLTRPFIEFVEPDTQHGVSKAVDVSEDGYSAWRPHGAAG
FT                   EKISCILEWTPKKGDEEYHFIVIGTARKQQQERGRVIFLQASRSSSDSSRIECSVKYIH
FT                   KFESPVYAIAPYGDFTLMVSTGHEIVPLEPKLSQTRRVRAARYPMLSPAISLSCHEPYV
FT                   YMSTSRESLMVLKSSEDKLLLHAYDRQKHDGLSHIHIGGEFNLTVTTSRGGRVSILSEN
FT                   GITDNDKMMPVALCEAHLPSSVMKLSSGSKPSPFSRSSQVYYGTAMNGIAYRFLILDEK
FT                   EWRLLRLLQNLCIRDPILCPFTPKRKRRRNPATNGIAEPQPSHMHIDGDILSRLVMRGP
FT                   KYLTKMLTTQGFEDAAFPENGTAQATLELFTELSNNLLGESPDQVEKVMRWLEKAVHVE
FT                   F"
FT   CDS_pept        join(1153876..1154104,1154154..1154285,1154341..1155236)
FT                   /codon_start=1
FT                   /gene_family="HOG000211712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752517"
FT                   /orf_name="AFUA_1G04010"
FT                   /product="TBC domain protein, putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88112.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG051503"
FT                   /db_xref="HOGENOM:HBG329844"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000051F16F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK20"
FT                   /transl_table=1
FT                   /translation="MDDSSTTQPEGNLDEKQEVPRSDPIGKLLDSDSENIARPKKEEAI
FT                   RKACDLRDLDALVSYATSEGGLLNDDLRRLAWPIFLRSDRDVQDSNFASWEDLPSHGDE
FT                   DQVQLDVNRSFVYYPQCPEDELLLKKDELSILIRRVLREYPMLSYFQGYHDIAQVLLLV
FT                   LGEKEAAPAVTNISLFRIRDYMLPSLSPALKHLQLIPAIIEKADPALREHLGGIKPFFA
FT                   LAATLTLYAHDIQEYSDIARLFDFLLATEPVVSIYLFAAIILSRKKELLEIPADEPEML
FT                   HFTLSKLPQPLDLDSLISSAMRLFNDYPPESLPFRAWKRISQHSVLKSSRAPFNKQTRD
FT                   EAIRLLEKQVRQLHNEELRDKALAFLWHHRTTVGSVTVAIFIGVMSIWIRKKGFDTPLW
FT                   SYFAELKTSFRKWLPMISM"
FT   CDS_pept        join(1155561..1155605,1155666..1155717,1155788..1156493,
FT                   1156543..1156618)
FT                   /codon_start=1
FT                   /gene_family="HOG000211701" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057927"
FT                   /orf_name="AFUA_1G04020"
FT                   /product="Yip1 domain family"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL88113.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG174949"
FT                   /db_xref="HOGENOM:HBG329846"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniParc:UPI000051E590"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK19"
FT                   /transl_table=1
FT                   /translation="MANRGYDVVVDVDAEGDLGHTDLQEDLEFHPSNFENDPRSAKVQQ
FT                   DSTPFLGAGTSRGRDRSPGGTPSKHAWWSIHYYSQFFDVDTNEVLRRCVSALYPRTNFL
FT                   DVLEGNADLYGPFWIATTVVVILFLTGTISQWLSNNNSKHFAYDFTLLSGAAGLVYGYT
FT                   GVIPIALWGALRWFGSSTADLIECWALYGYSNLVWIAVALVSWSPLTALNWALVGVGFG
FT                   WTVFFLLRNLYPVLSATDAKTSKILLIMVIVLHAGFAIAIKILFFAHASPVSKKNKDHD
FT                   DDDHDDKRRMF"
FT   CDS_pept        join(complement(1157791..1157840),
FT                   complement(1157489..1157669),complement(1157163..1157273),
FT                   complement(1156984..1157070))
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752518"
FT                   /orf_name="AFUA_1G04040"
FT                   /product="Ubiquitin UbiA, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EBA27335.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI0000F51A35"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S6"
FT                   /transl_table=1
FT                   /translation="MDYELTEPFFCNFTVQIFVKTLTGKTITLDVESSDTIDNVKAKIQ
FT                   DKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYN
FT                   CEKSICRKCYARLPPRATNCRKKKCGHSNQLRPKKKLK"
FT   CDS_pept        join(complement(1160263..1160367),
FT                   complement(1160108..1160161),complement(1159920..1159991),
FT                   complement(1159599..1159885),complement(1159431..1159536),
FT                   complement(1159240..1159378),complement(1158795..1159181),
FT                   complement(1158286..1158719))
FT                   /codon_start=1
FT                   /gene_family="HOG000211690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209236"
FT                   /orf_name="AFUA_1G04062"
FT                   /product="RNA polymerase I specific transcription
FT                   initiation factor Rrn7, putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="EBA27336.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG323875"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="UniParc:UPI0000F51ABF"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S7"
FT                   /transl_table=1
FT                   /translation="MEYTTRGVCGQDGCRETRYYLDNGLWFCRRGHQQEEDPEDFGTQG
FT                   KTSRVKKAVYQLILWKQCHALVQGRGFPAELEPSCLIIVSNWLFQVVVRDLWALRLESL
FT                   SERLRDPAEDDREPELFSSQPATTLDEPEGAFKLSGRAAQWPRLIDTIGLCYLGCLLMR
FT                   LPVTIGEFHRMLMREDFPFIRILRLIPREMRDKLPQEYIALLETTRLIKAEHLHKATLE
FT                   LSLLYHHKFGVQFPSLNTPAVLYRYIKRLALPVDVYPAVKRLQSLVGFRFEFPTTVPGR
FT                   SRPLHLPEVQLITLIVISTKLFFPFDDIKRYPVSTREPSAQVLDWKLWGQVQRHFDRRE
FT                   TAGGRIGKGNEILVTEKDVFDMTPAQLDEYMDWYETSWLDHSREFFPVGPMGSDGQTVS
FT                   DPTEGDDEAMHAMLETVTSQLRPRKAISDPKANVARPGTSYPRYRTESELPEMARSFYE
FT                   IAAKVAGVSLSTLVRAVSQTETKISRWLDDKRRIEHHGDPTEMDVTDEAGTEDLEAMED
FT                   EDMSGLSDES"
FT   CDS_pept        join(complement(1161252..1161632),
FT                   complement(1161055..1161187),complement(1160930..1160994))
FT                   /codon_start=1
FT                   /gene_family="HOG000106270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270381"
FT                   /orf_name="AFUA_1G04070"
FT                   /product="Eukaryotic translation initiation factor eIF-5A "
FT                   /function="ribosome binding"
FT                   /function="translation elongation factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="positive regulation of translational
FT                   elongation"
FT                   /biological_process="positive regulation of translational
FT                   termination"
FT                   /biological_process="translational frameshifting "
FT                   /protein_id="EAL88118.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006452"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="GO:0045901"
FT                   /db_xref="GO:0045905"
FT                   /db_xref="HOGENOM:HBG007765"
FT                   /db_xref="HOGENOM:HBG526951"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniParc:UPI000051EC67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK14"
FT                   /transl_table=1
FT                   /translation="MHMSPLLLHTSTIERPSYNCLQLSSYSGWALSTDICSFQHETFES
FT                   ADAGASATYPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFTGKK
FT                   LEDLSPSTHNMDVPNVTRREYQLLDVTDDGFLSLMDEAGNTKDDVKLPEGEVGERIQKM
FT                   FNEEGKDCNVTILTAMGEQACMDVKEAPK"
FT   CDS_pept        join(1162306..1163184,1163240..1163534,1163590..1164374,
FT                   1164428..1164463,1164510..1164551)
FT                   /codon_start=1
FT                   /gene_family="HOG000211679" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270382"
FT                   /orf_name="AFUA_1G04080"
FT                   /product="GARP complex subunit (Sac2), putative "
FT                   /protein_id="EAL88119.2"
FT                   /db_xref="HOGENOM:HBG051508"
FT                   /db_xref="HOGENOM:HBG323876"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniParc:UPI0000F51A71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK13"
FT                   /transl_table=1
FT                   /translation="MWLDRISGHSTPSCVPLDSRSNSPAPRRSSSLLSPAPPNNRPSPN
FT                   RQGSSLSVLLTPSDSTTSLPATARGVNGSVLKQGAARSRPSDVADPLEVLKDIIGKQKA
FT                   DVETNECLKASAPEAKPLHLVETIDFGDLSLEEFVSQVGEPRRATSADVSAQTLQQFEK
FT                   ERDKYQELHAAITSCDDVSKSVEVYLNDFQSELGAVSAEIETLQTRSVQLNAMLENRRK
FT                   VEQLLGPAVEEISISPRAVRMIAEGPIDENWVKALNEIEARMTSIEAKVSGSSSTKAIE
FT                   DVRPLLNDIKNKAVERIRDYLVSQIRALRSPNINAQIIQQQRLVKFKDLYSYISRAHPQ
FT                   LTGEITQAYINTMRWYYLSHFSRYLQALEKIKVYPSDRNDILGGDPSAPKTGHIISSGR
FT                   SGSAAHDPFSLGRRIDILRTSNHMALSAYLAEEDNAFHGIEVPFRNFNLALVDNISAEY
FT                   SFMTEMFSTLSFHQISRKAVEIFEPVFALGQGLTKQLIENSTDSLGVLICVRLNQQAAF
FT                   ELQRRKVPVADSYINGINMQLWPRFQVIMDLHRESLKRVASNTGRSAVSALSLAGGDDL
FT                   TQSSAPHFLTQRFGQLLHGILVLSSDAGDDEPVANSLKRLVAEFDGLLTKLSRSGGDAK
FT                   RREKFLFNNYSLVLTIISDTHGKLATEQKQHLDEMLKNVGKRG"
FT   CDS_pept        join(1164956..1165051,1165110..1165235,1165297..1166286)
FT                   /codon_start=1
FT                   /gene_family="HOG000245179" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209237"
FT                   /orf_name="AFUA_1G04090"
FT                   /product="FAD dependent oxidoreductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL88120.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG095565"
FT                   /db_xref="HOGENOM:HBG525746"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000F51A86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK12"
FT                   /transl_table=1
FT                   /translation="MATRACIALSRPFFARRNFSSTRASSADVTHAVIGAGVVGLAIAR
FT                   QLALRQGTSTILLERHDAVGTETSSRNSEVIHAGIYYGTDSLKAKLCIRGKQMMYDLCA
FT                   KRGIPHRNTKKWIVAQNEEQWAAALGTHKLAQTLGVPTRLVGHEEAQRREPEVQALAGI
FT                   VESDTTGIVDSHALMTYLQGDFEDRGGDCAFLTNVTGIEALDGGRAGYRITAVSADGAE
FT                   TSITAETLINSAGNGACAINNMVLPRERHRTPFYAKGTYFSYSASFPRTSVLVYPATLP
FT                   GHGGLGTHLTLDLGGRIRFGPDVEWVDDPTDLKPSPARLQQALPEIKAYLPRVAPEAIS
FT                   LDYCGIRPKLGRGGAVNTGKGFQDFVIQEEEGFPGFINLLGIESPGLTSSLAIAEMVEG
FT                   LLYR"
FT   CDS_pept        1166995..1167609
FT                   /codon_start=1
FT                   /gene_family="HOG000211666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270383"
FT                   /orf_name="AFUA_1G04100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88121.1"
FT                   /db_xref="HOGENOM:HBG051509"
FT                   /db_xref="HOGENOM:HBG329847"
FT                   /db_xref="UniParc:UPI000051E7F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK11"
FT                   /transl_table=1
FT                   /translation="MAEVHGRRDLRVQKKTQSHSHSQASTSTPSHHRRQMANVHAGSHK
FT                   FNRCWDWIVVGGNCHYAKNRSTFTSYRRSPGKIGRSRVLGIGTVKLQVQRGPHDPRPNK
FT                   LVLDDVWHMPDARCNGLSVSKYTETNQPLSVESKGAHVEAKSDRDGEALWFGHPYCGCS
FT                   RVVLTGDPKGDSYLRDGQMHTLSVIASPEELNKLRSRVRQW"
FT   mobile_element  1167025..1167453
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   CDS_pept        join(complement(1170903..1170978),
FT                   complement(1170791..1170845),complement(1169617..1170706),
FT                   complement(1169439..1169561),complement(1169338..1169388),
FT                   complement(1169166..1169278),complement(1168057..1169098))
FT                   /codon_start=1
FT                   /gene_family="HOG000211655" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752519"
FT                   /orf_name="AFUA_1G04110"
FT                   /product="C2H2 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88122.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051510"
FT                   /db_xref="HOGENOM:HBG323877"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51A9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK10"
FT                   /transl_table=1
FT                   /translation="MVLKKCNICDRRFKKTEHFKRHERSHTKEKPYECNICHKRFSRSD
FT                   VLSRHAKGHNAASSSATNGVVKTDQHHTSTTHAYDQQHSHVNGNGQFIPSINPSTNPVD
FT                   AQQAQTVQFIPREISLTTPDRLPSSSLDCLADISAHQARTQTQLNPMVMDHQQAYLGWG
FT                   DVSAAEPSPFRAPVFVPVPNDILQFWLEPRADTTSNPSPIDLMRDASVSLVDDQAPASP
FT                   RARQNGHPVENPSIQSPSNIPSERFAKVQRYWLTPTNNTGRLMNTLWRDVASCSLDNIL
FT                   GVYSGQPFNGPSGLLGDSRYGLDEECRQNLLATFGQARRSTSNDASNAPRMSEAPFGSP
FT                   QAFPPAEILDMALDLYLRNFQPLVPFVHIPTFSAKRTRSPVLYVMCMIGMIILGTKGTT
FT                   SFVSKNFDLVLDRITDELAKCAAGSENPVGTVSTFAAAFLFLNLAAMTGEKEHIAKSQM
FT                   LYINLMTIAQRHGLFAATEGQILDMSLYEAIPDVNARWKAWSKVELIIGLLLLDSWYSS
FT                   FLSTSPIIVPDAIQFILPCDGAIFDAKTAMHWMQLISMGKRILMPTVVAPSENVDLPAL
FT                   DNSVDGLCMHGVLAMVQLRLCEAYHRLLSNRANYPFAPCHTYAMDGRARCLPTLQLQIA
FT                   DKYREALERLNPNAVVMWHNMCMTLTADIQIFELAAGRSGPLPARKALDDIAIWSQTPA
FT                   ARRSCLHAAQIYKAMINRKASDHTMFHSMLALFTAALVLGLYTFMAPRPPETTAGCISV
FT                   ELLDDVDWQQVGREGFTSFMEPRGNHAFTASDNSAVNFIRNGGTLYLRGIPVQGGYQSA
FT                   RRILLDYAGLLKDSGKWSVRKFSHVLHIMSDVLMDIE"
FT   CDS_pept        join(1173261..1173525,1173589..1173783,1173834..1174220,
FT                   1174273..1174940)
FT                   /codon_start=1
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270384"
FT                   /orf_name="AFUA_1G04120"
FT                   /product="Coenzyme A transferase, putative "
FT                   /EC_number="2.8.3.-"
FT                   /function="CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EAL88123.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008410"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="HOGENOM:HBG028546"
FT                   /db_xref="HOGENOM:HBG353770"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI000051EEE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK09"
FT                   /transl_table=1
FT                   /translation="MSRPLPAVFRPILGRRNFSVSANKRAINKVCASAQEAIKDMKGSS
FT                   TVLCGGFGFSGVANTLINAVRDRPDIKDLTVVSNNAGMPGAGLGQLLESGQITKMIASF
FT                   IGENKVFEKMYLNGDLALELTPQGTIAEKCAAGAAGIPAFYTPAAYGTIVQTGELPVRY
FT                   NKDGTVKEYSKPKEVRQFNGKNYLLEESIFGDYALIRVHKADKLGNCQFRKAMNNFNEA
FT                   MAKNAKYTIVEADHIVEVGELSPEEIHLQGIYVNKVIQSTEKTMIEKLTFAKDPSEMLQ
FT                   AGSGEATARRERIVKRAAKELKDGMYVNLGIGIPLITPAYLPEGVEVVLQAENGILGLG
FT                   PYPKPGEEDPDLINPGKETVTLSSGASVFGSHESFGMIRAGRIDLTMLGALQVSQYGDL
FT                   ANFMLPGKVKGVGGAMDLVANPEKTKVVVTMEHTDKKGNPKILPECTFPLTGPRCVWKI
FT                   ITDLAVFDVSPTEGLTLAETAEGVTVDEIRSKTAAPFKVAENLGTF"
FT   mobile_element  complement(1179387..1180037)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        1185807..1186730
FT                   /codon_start=1
FT                   /gene_family="HOG000217093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270385"
FT                   /orf_name="AFUA_1G04130"
FT                   /product="FG-GAP repeat protein, putative "
FT                   /protein_id="EAL88124.2"
FT                   /db_xref="HOGENOM:HBG051512"
FT                   /db_xref="UniParc:UPI0000F51A7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK08"
FT                   /transl_table=1
FT                   /translation="MQTRPLSINAIWHLVLPLLATSATAAPYQTRILATGTTFNAPDPY
FT                   GPWSLTPSANKPGPDLAYIKTSNTGTGKVEVHLASRASNYQTRTLEVGTTFFPEDNGVW
FT                   QLIDADGDGRDDLVYIKTRNTGTGRVEVHIATAASNFQTRIKDVGTTFLPEDNGTWQMA
FT                   DFDGDGILDLIYIKTRNTGTGRVEVHVASGASNYQTRIQEVGTTFYPEDNGVWQMIDFN
FT                   RDGKLDLVYIKTRNTGTGRVEVHVASGASTYKTRVQEVGTTFYPEDNGFWQLIDFNKDG
FT                   VLDLAYVKTQNTGTGRIEVHVANGRN"
FT   CDS_pept        join(complement(1188537..1188634),
FT                   complement(1188380..1188442),complement(1187693..1188332))
FT                   /codon_start=1
FT                   /gene_family="HOG000217092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904686"
FT                   /orf_name="AFUA_1G04140"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88125.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051513"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51AAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK07"
FT                   /transl_table=1
FT                   /translation="MSTSKSSRGSKPSRITVACNSCRSRKQKVSASAPICTQCLQSHRQ
FT                   CDWPEQLKRGPAKGYIEALEHRLHETEQILLRLLAHMTDEQLSIALERNQSPFLRSGKN
FT                   DAQYWRRYPLRTACDLRKWQQDCFAGTSVAGPPMFSSSRRTDASAQSEVEADEISPGAP
FT                   ESQQTEEQPVPHSEQDPSTRKEGQRSTQTIHGKNMNQHVAWENSYNPSNELRKSSTATG
FT                   FMYRPSSLELIPFRDTQSLHAGTPPGPSLWSGAPSVAFQRQFLW"
FT   CDS_pept        join(1189000..1189252,1189306..1190147)
FT                   /codon_start=1
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270386"
FT                   /orf_name="AFUA_1G04150"
FT                   /product="Tartrate dehydrogenase, putative "
FT                   /EC_number="1.1.1.93"
FT                   /function="NAD or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /function="tartrate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88126.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009027"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="UniParc:UPI000051F63E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK06"
FT                   /transl_table=1
FT                   /translation="MASTVPITYRVASIPGDGIGPEVVEATIQVVRKLCQKFQTFDIDF
FT                   THIPWGTEYYKAHGRYASEDCLDTLRQFDAVLFGAVGAPDVPDHISLWGLLLAIRGPLQ
FT                   LYANVRPVRTFPGTKCPLNTATKGIDWVLVRENSEGEYSGQGGRSHVGQPWEAATEVAI
FT                   FTRVGIERIMRFAFETARSRPRRHLTVVTKSNSMRNGMVLWDQVAAEVAREFPDVTWDK
FT                   MLVDAMTIRMVGKPDSLDTIVGTNLHMDILSDLAAALAGSIGVAPSSNLDPTRKNPSLF
FT                   EPVHGSAFDITGKGVANPVATFWSAAEMLSWLGEKDAAKQLMGCVERVCAAGVLTPDLG
FT                   GTANTQGVVDAVCAEIERLVLQHD"
FT   CDS_pept        join(1190682..1191845,1191902..1192007,1192058..1192122)
FT                   /codon_start=1
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270387"
FT                   /orf_name="AFUA_1G04160"
FT                   /product="Aspartate aminotransferase, putative "
FT                   /EC_number="2.6.1.1"
FT                   /function="L-aspartate:2-oxoglutarate aminotransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL88127.1"
FT                   /db_xref="GO:0004069"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00005201E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK05"
FT                   /transl_table=1
FT                   /translation="MAPSQIDEGLQQTAITSDATYVKSVSRSTPSRFSSLSVPPVDEPF
FT                   TLQAEYLSDGHPDKVNLGIGVYRTEDGDPWPLSVVEQAEAQLFHANNVARHEYLTIQGD
FT                   VKFLALARDLVFGFGESPSNEQVAAQDRIASIQTISGTGANRLGADFLARTIKPSCVWI
FT                   PDPTWANHYTIWELVGVEVRTYPYYDHKGNCFDYERTTRLLSAQAKKGDVVILHACAHN
FT                   PTGADPSKEQWRKLAVLCQQKGLVPFFDLAYQGFASGSLDEDAWAIRHFMNCKPELEFC
FT                   VAQSFSKNFGLYGQRTGALHVVTSSSSGTLPQVVLANLSHLVRGEYSMAPRGGSEIVRT
FT                   VLSDEGLRQQWYEDLKHMSGRIKQMRQALYDELIRLGTPGTWNHVLEQIGMFTYTGLTE
FT                   PQVLEIRRRHHIYMMKSGRISMAGLNSKNVRYVARAIDDIVRTVA"
FT   CDS_pept        join(1192673..1194314,1194457..1194869)
FT                   /codon_start=1
FT                   /gene_family="HOG000217091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270388"
FT                   /orf_name="AFUA_1G04170"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88128.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051514"
FT                   /db_xref="HOGENOM:HBG329854"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F62C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK04"
FT                   /transl_table=1
FT                   /translation="MDSSDLTSGPAEIGSLTAHSNEESQFVGSSSGVFFINTVRRAFSK
FT                   DVDLSKISLPLPEDTLVGSDESHAERSPSAVRSPSMSEPSASLSKWQYDSQIAHELGKV
FT                   PPLDMARELMMVYFKVWHPLFPFLHGPSFLRAMELLYSDSHGTEGQNYGNIPSTSTSTS
FT                   TSMDHRNACWTTIFQCVFNLASHLRPDLSLPPESRIKSPGSMHSLLAILTRRQDLPSLQ
FT                   ALLAAQLYLVAKMSLRTASTVGGCILRSMLHAGLHRCPFRYKELSTHDRQLRKRIFWCA
FT                   YAIDRYLSQALGLPLGIQDSDVDVCAPGAHEVHSPGLHKVQGTSEGSTPRFVAGSPGKG
FT                   TPASSTPAQIELTSPQQPQQHRHSSGFVDPGEHEQHQREIVFMSYVESGKLTGRALELF
FT                   HKSILVRSVRRSSVLILVTDVHKWWNSLPTTLQGTPASTGDSIYQGPQDDDPFHFGPFF
FT                   TILYHHLILLINRPSLSLPPSTPEFNSGLQTCIGAARGILSALRAQIDAKQALFWPGFL
FT                   SAAWMAGLVLAFACQLGQYVWSKVLCKFPASKHCHRALSLLAENIRHSFTSSQQPRTSP
FT                   SDPSINPSCEEPAIANPTKRRKLSSCDSLVPLPSASASASAEAMAGQGQGPLNAHESGN
FT                   GPVELNMTTETTEMEYLNLPDFDMNTVDLLQAANFDYLLDMFGQQYPSF"
FT   CDS_pept        join(complement(1196428..1197903),
FT                   complement(1195725..1196353),complement(1195508..1195664))
FT                   /codon_start=1
FT                   /gene_family="HOG000217922" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270389"
FT                   /gene_name="pab1"
FT                   /orf_name="AFUA_1G04190"
FT                   /product="Polyadenylate-binding protein, cytoplasmic and
FT                   nuclear"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88129.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="HSSP:1CVJ"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051F8B6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WK03"
FT                   /transl_table=1
FT                   /translation="MSAEVSTTPAADNTVNGTPEATNAAATSAPEVTAVESASPSTTPS
FT                   ASQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTA
FT                   DGERALEDLNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDAAIDNKALHDTFAAF
FT                   GNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDRQ
FT                   SKFEEMKANFTNVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFS
FT                   THDSAQAAVDEMNDKEIKGQKLYVGRAQKKHEREEELRKQYEAARLEKASKYQGVNLYV
FT                   KNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTTGETSESEKEKEKESNKENEKEGEEK
FT                   TEEKPKESEEEPKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALA
FT                   QRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQGFIPAGQRGGMP
FT                   FAPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQIPPNFQGIPMGAMQGPGGIPNG
FT                   MGYPQMAQVQFGRGAGGRGQVPGMPMGQGIRGPGYGQGRGGAPVQGGPRPQGGRGQPAA
FT                   APPAAGREEVPATGGLTAQTLSAVPPPQQKQMLGEALYPKIQAQQPELAGKITGMLLEM
FT                   DNNELLGLLEDEEALRAKVDEALSVYDEYMKNKGEGEAPAESAKPKEDAAETATEENKS
FT                   "
FT   CDS_pept        join(complement(1199852..1202857),
FT                   complement(1199114..1199785))
FT                   /codon_start=1
FT                   /gene_family="HOG000211433" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209238"
FT                   /orf_name="AFUA_1G04210"
FT                   /product="IQ and HECT domain protein "
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88130.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG051515"
FT                   /db_xref="HOGENOM:HBG329855"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000520911"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK02"
FT                   /transl_table=1
FT                   /translation="MFQSFTGNSRRPRQVNLGGRNTNPFAAYPSGRHLPQGPSAQNTLA
FT                   IAQQERLLRQQERERLGATRKIQRTWRGYRSRKLTHSTWRTEWDTAERQRTGSSLPFEH
FT                   KTRTPDDFLEPSLRYATAAECLSQLRLLMQFVEPWNTSDIVRLVYYANAFQITLHEVPT
FT                   IATEGEWTTPLCRLAKTTLRVLRSALSPIVPDFAVPHLVGLLVFLTNLIPKQMARLAED
FT                   YYSVMATITRNIESLSQRCHVSQENLAQSVLALLRPITSETLTAYEWFARSYLTIPDLS
FT                   AYLGTLDQLAGNINYKLLLSALGPLQSRFRERPQSVTDLDARLWLLAYIIYFHQYANGT
FT                   QAGQQAVEPDFVKIVSELLNSTAVHLSRRLEADDMIDDDVTEETPLHPFVKEQISSLVN
FT                   QSKITGLLSQLQSTRLSQGDLANSESDASKEAKILATYALTLLRVFPRRGDDIRMWLYL
FT                   GSATSGDQKAGHPGSRIPAIKYFWHASRSSRIFDKISQDSTKVLPLLKPADESRESGLS
FT                   MTQAERDEEWTIILLFLELYTFVLKVMDDEEFFSSQSSFTASSNSRVSWTKESALPLKD
FT                   IKDMTVFLKNLAFTLYWNSADLNEREAPQTAGGIQSYFTGAVSSSDAITSVKDLEMRNK
FT                   EKGLPGVTGIPLDYFKGLVTGLLRMIHERDSRRKFLPDGHWLMTNRFDMEGFIPAVVAE
FT                   EENRHQLQDEDEEESQDDWMRDDEYEPLNLIGTGRAQQTRRIEALRRRQQQAARRKQLE
FT                   AVAPRLEILRNMPFFIPFATRVQIFREFIYRDQMRRRQGYIDPDAWRMSVAQASMGRMI
FT                   DGRPAAQDILSRHHANIRRESVFEDAFDQFYELGEGLKEPIQISFIDKFNTVEAGIDGG
FT                   GVTKEFLTSVTNEAFKSGSEPKLFEENDQHLLYPNPAAVEQRREVLRQLGFVENSPEWN
FT                   EQVRDLLRRYEFLGRIIGKCLYEGILVDVNFAPFFLLKWALTGGAGSAQRETAYRANLN
FT                   DLKDLDQGLYQGLLQLKNYTGDVEDFALNFTVTDTIPLPNGGTRTVTQDLKSNGSDIPV
FT                   TNQNRLVYISYIARYRLQVQPALQTNAFLQGLGHIIQPSWLSMFNQSELQTLVSGESGD
FT                   IDVADLRRNTLYGGVYTIGDDKEEHPTVKLFWQVMEEMSNEERQKVLRFVTSTPRAPLL
FT                   GFSHLNPRFSIRDSSEDQDRLPSTSTCVNLLKLPRYTNAKVLREKLLYAINSGAGFDLS
FT                   "
FT   CDS_pept        join(1202961..1203174,1203324..1203496)
FT                   /codon_start=1
FT                   /gene_family="HOG000048300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270390"
FT                   /orf_name="AFUA_1G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88131.1"
FT                   /db_xref="HOGENOM:HBG051516"
FT                   /db_xref="UniParc:UPI000051F3D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK01"
FT                   /transl_table=1
FT                   /translation="MLLTNDAGIVWENMVREMEMAWAYDIYSSADRRVRDTHYVPDLEL
FT                   NQHCQGGQDLNATHQNKAESYLGRLIYAKNQIAPFNEVNTRGNAESSTAVATIHIAGDD
FT                   ILKYCGLGRDASSTNTHTVHIIHS"
FT   CDS_pept        join(complement(1203911..1204099),
FT                   complement(1203635..1203844))
FT                   /codon_start=1
FT                   /gene_family="HOG000211444" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270391"
FT                   /orf_name="AFUA_1G04230"
FT                   /product="50S ribosomal protein YmL27 "
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88132.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG051517"
FT                   /db_xref="HOGENOM:HBG329857"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniParc:UPI000051F63F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WK00"
FT                   /transl_table=1
FT                   /translation="MAMFKPSQPMMARLRLTTKQVNGGYYKGNRTGSMGYFAKNGSYVI
FT                   DWKKVRTYVVPENLADFKLTPFVTKRMAPTKGKYTREIEKNGRTVIVERAFGAKDYLDM
FT                   WASDNGQEVLEQERLEQESAASETASRQ"
FT   CDS_pept        join(1204386..1207085,1207142..1207324)
FT                   /codon_start=1
FT                   /gene_family="HOG000211457" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270392"
FT                   /orf_name="AFUA_1G04240"
FT                   /product="Small nucleolar ribonucleoprotein complex subunit
FT                   Utp14, putatrive"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="EAL88133.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG051518"
FT                   /db_xref="HOGENOM:HBG329858"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniParc:UPI000051FD8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ9"
FT                   /transl_table=1
FT                   /translation="MPRRQTQLRGPKDKDPSSKKPAPKKNTGKKALNALSIAESQVTDK
FT                   LGVRRNRLGKIHDPSKRKRNPNRDMDDSDGPDNKRRRFGGDDESELSSNAGSDGEGHRW
FT                   RLGQVDSDDDEELDSDEALGTSDEERFEGFTFRGSSTTNAGSKPKPKKSKRVREINLDE
FT                   DVEESEEEDEDMDEDDDLGEDAIDLTTAWDLNTAEEEKEKAAASKKKQAEPDESEEYDS
FT                   DSEENDDGSDEESGLSMSGDEAEVDEHGLSKLQSFVNALEPESTNKPSRRAGGAQEHAK
FT                   PTEYGLTSSRKLTVADLLPSITDSRLKSSLKHVDATPSSHKQSSGIPGKLDAPLAKRQQ
FT                   DRLDRAAAYEKSKETLNRWLETVKANRRAEHLMFPLPDPDAQQIHRIGPTKPQTDLEAT
FT                   IHNILVESGLADPSGKSTEEQVQEFEELQARKLPIEEIRARRAELRKQRDLLFREEVRA
FT                   KRIKKIKSKSYRRVHRKERERLQQQERQALLEAGVDLEEEDREMNERRRAEARMGAKLK
FT                   DSKWAKSLKQTGRTAWDEDARRGAAEQALKEEELRRRIEGKSVSRADEDYLGSSSSESE
FT                   DEDPWAEDAGSDAEKQKLRKKLEGLERDDVDASEITGPHAKLFSMKFMQNAEAARKAEN
FT                   DAEIRRLNRELRGEEESQSEAESEVGRRKFGQSQDDKSGKDMKQKSLPRTEFEEAPGSD
FT                   DEADAAPDQEVGIVVNQFNKKKSSERSGKPQSARPSGGAPEQKATTIEEENPWLVTKRN
FT                   NRRATADDSQQIIDATLGAETVEAPKKQKDKPIVSSTLGQAEDDNGSDDEESVPVLLKN
FT                   HDLVKRAFAGDEVVQEFEQDKLETIEEEGDKVIDETLPGWGSWTGQGVSKREQRRQKKV
FT                   LTKVEGVKPENRKDAKLSRVIINEKRIRKNTKYMATQLPHPFETKAQYERSLRLPIGPE
FT                   WSTKETLQNATKPRVMIKQGIIKPMEKPMI"
FT   CDS_pept        join(1207729..1207856,1207896..1208142,1208263..1208316)
FT                   /codon_start=1
FT                   /gene_family="HOG000048301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270393"
FT                   /orf_name="AFUA_1G04250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88134.1"
FT                   /db_xref="HOGENOM:HBG051519"
FT                   /db_xref="UniParc:UPI0000520448"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ8"
FT                   /transl_table=1
FT                   /translation="MRPQRSLQTCKLPDDKYMKFFRLTDYAISQEVVRAPTTQYGGITH
FT                   EIFDDQYVLQTLRVSGPYKSSPVWLTLAYGSARKIGLFSCLLCSTPYLPRMDSSDSHNF
FT                   HHRSFYPPFIDCITRLNHLHPCPRSCIALPFRAHHTYC"
FT   CDS_pept        join(1208618..1208633,1208812..1209020,1209160..1209553,
FT                   1209607..1209705,1209764..1209876,1209927..1211654,
FT                   1211718..1211803,1211848..1212127)
FT                   /codon_start=1
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270394"
FT                   /orf_name="AFUA_1G04260"
FT                   /product="Endo-1,3-beta-glucanase Engl1 "
FT                   /EC_number="3.2.1.6"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="EAL88135.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG059774"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI000051F3D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ7"
FT                   /transl_table=1
FT                   /translation="MCHESGFIQLFPYNNISVYVTFCIIVLRFFEVLRQLVLRYLSPRA
FT                   RQENGRGKHVALYSHADLAFSIRDSTIPTSFYPTSLEREGRSAEQPFPTDLNLGHLLDP
FT                   LLHPQGGSEPGVLDLLLSGLQPPTQPVPTKHLTTNPSVVTSSSPSKASTSKDTLPLISS
FT                   PPVVSTASSSSTTANEESTSQNTGSARPDYSSPDGTLSSSLEPAGKTSSSVESQTTSSA
FT                   TSGDPAQQNQSSTKPVTAAATNMANGQDVFVPVSTGPIPKTIGSRNDHPVPKNGIVNTD
FT                   TPVETNKFYCGLFLGTQTNNTFTHPYSVAWVKGGGTSQSYGMAISHVESNIVAHGPVNT
FT                   AIPGSPISYYVNPIGIHSVILSASELGPSTVLTTENPLPFSANAVLRPSASSSQSITIP
FT                   VVQGMGFVTGIYSNLQPKIQSGVFFTKMVTAGSPRTGIFKYSLSLKDGTSWLLYATPDD
FT                   GSDPQLQLASNSEIIGPAGWSGTIQVAKNPAGASGEKFYDNSSGVYAVEGAVMGSVSES
FT                   TGTYSLMWAKAGKDAQNTPLLMFALPHHMESFDASTQSRATNITLRTTTKGQATAVIGE
FT                   YWTMVEPELPISMGFAPWSVSGGSIDKISPAAQQVILAAAPTELQQDMDAQTNLNSMYF
FT                   SGKALSKFATLLYTVDKLGGNSTLAAEGLARLKQSFARFIDNRQQFPLVYDNVWKGVVS
FT                   SASYATGDVGADFGNTLYNDHHFHYGYFIHAAAIIGSMDPQWLETSKDWVNMLVRDAGN
FT                   SAGNDPLFPFSRGFDWFHGHSWAKGLFESFDGKDEESTSEDAMFAYALKMWGKTIGDVS
FT                   MEARGNLMLGILRRSMRNYFLMESNNKNHPANFIANKVTGILFENKVDHTTYFGNNLEY
FT                   IQGYGLLSPSLIHMLPILPCSAFTRSKQFVKEEWDAMFASNGPDPAENVVGGWKGVLYA
FT                   NLALVDPAASWNFFTQPNFDYSWIDGGASRTWYLAYAAGEFIID"
FT   CDS_pept        join(1214188..1214191,1214523..1214977,1215040..1215896,
FT                   1215955..1216027)
FT                   /codon_start=1
FT                   /gene_family="HOG000083011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270395"
FT                   /orf_name="AFUA_1G04270"
FT                   /product="Calcium ion transporter Vcx1, putative "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL88136.2"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328108"
FT                   /db_xref="HOGENOM:HBG738140"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI0000F51A6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ6"
FT                   /transl_table=1
FT                   /translation="MSAARNFRSAFRRHSWGPKKSSMTGFSSSPNGAGEPSERDALIND
FT                   IPRINSGMSQHRRHKRGPRWLNIPAQVMHLTWETLVRDYVNVLLVFVPLGIISGALHWD
FT                   STVVFSLNFLAIIPLASLLSFATEELAATMGQALGGLMNATFGNAVELIVSIIALKDNQ
FT                   IRVVQASMLGSILSNILLVLGCCFFIGGLRFSEQTFNSTVASTMSSMMTVASASLIIPA
FT                   TLYASLSPSHSKTTTDNNILILSHGTAIILLVLYVMYLYFQLKTHTKLFEEVQDALGPD
FT                   TENQADHEEEEEEEEHHILSPLAATIALVVVTILVAICADYLVGSIDSIVEKTSMSRTF
FT                   IGLILIPIVGNAAEHVTAVVVAWKGKMDLAIGVAVGSSLQIALFVTPFLVIMGWILNVE
FT                   MTLNFHIFETVAFFISSLVVTFLIQDGKSNYLEGGLCLGMYLILALAFYVYPDDPTGDA
FT                   LIAN"
FT   CDS_pept        join(1216511..1216819,1216880..1217212,1217270..1217692)
FT                   /codon_start=1
FT                   /gene_family="HOG000211479" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057928"
FT                   /orf_name="AFUA_1G04280"
FT                   /product="30S ribosomal protein S7, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88137.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG051520"
FT                   /db_xref="HOGENOM:HBG323880"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="UniParc:UPI0000F51A3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ5"
FT                   /transl_table=1
FT                   /translation="MPPRINLFTVGKALPGFRPSSSCAVSSRFSINRTHAASTVQAQRR
FT                   WNSSKSEKKDDLDGLKGPTEDPLPHVSEEAAQMDKILHGGKYEAAASPELEQGTPVAEI
FT                   LQRDKDALKHMPKVMQDQLKRSSGNRSFSTFTRRYQPDLQEQEVTDPSVAVVANMINQV
FT                   NQEVAELHPGLKFPAPESLPKTENFRERYDPLLEQFTKLLMRDGKLSKAQKNMSFILDH
FT                   LRTAPPPQPHPKRRLLPGPPSPQLPLNPVLYLTLIVDSVAPLIKIRQQKGIAGGGAAVQ
FT                   IPVPLMQRQRRRTAIRWIIDASDKRRDSSFAQRVAHELVAVAEGRSGVWDRREAVHKLG
FT                   VAGRSNLGLVTQRR"
FT   CDS_pept        join(1217871..1218616,1218668..1220201,1220261..1221038,
FT                   1221092..1221237)
FT                   /codon_start=1
FT                   /gene_family="HOG000211490" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270396"
FT                   /orf_name="AFUA_1G04290"
FT                   /product="Plasma membrane phosphate transporter Pho87,
FT                   putative"
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL88138.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051521"
FT                   /db_xref="HOGENOM:HBG329859"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniParc:UPI000051EA2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ4"
FT                   /transl_table=1
FT                   /translation="MYYRPALSSQFLHLAFSSLQSDARTPQTDSNAPILQPPCRFVLRP
FT                   TRQPLISPAQQLCGDPPQPRRRSPAPSSSSPTTNDVLSIGRVATSESVLFFSQNSLPVE
FT                   TVPSNAVGRTVARIASATGAYEQELEHDGHDQSFELEEFHTRNRYPLVTRERTSSNHFV
FT                   SLESDSHEQVQESEKYTPPGEKSGQDHRANNPRVRFWAEALRRRQSPKESARGQRTAKM
FT                   KFSHSIQFNAVPDWSAYYIAYSNLKKLIYSLEQQARKANGQAQSDVESAPLLSETPTPE
FT                   AVFRRALNAELEKICSFYEVKESEILKEVEDVVRDTEEYSSKTDGADVDPMSDAMIKSR
FT                   RMSSNSRPRTSGSYRDYAEEETEDDDDAADSDDEHHPPTGQGGVPSSGRSRSDLSDSRF
FT                   MADSRILGFDRRGSGGHDEHCKDPGFLELYNEGLSLRQRAVNAYVSLCGLKSYIQLNKT
FT                   GFSKALKKFDKILDCNLRREYMSSTVSPAYPFTDSTMKKIDDVIGRVEQLYADLITGGD
FT                   LALAKRELRLHLREHVVWERNTVWREMIGIERKAQAANVGIRRTLLGMDEDPATARRQG
FT                   DEQEAAAKEIKTPFGRYSVPEWLCSLSFGTLIVILAVFIILLYAPIMDKPEQQNCLAML
FT                   VFVSLLWATEVIPLFVTSLLIPFLVVMLRIMKSADKPYHRLGPKDATGAAFSAMWTPVI
FT                   MLLLGGFTIAAALSKYDIARRMAMYVLSRAGSNPKVVLLTNMFVSMFLSMWISNVASPV
FT                   LCYSIIQPLLRNLPPDSNFAKALVLGIALAANVGGAASPIASPQNIIALQNMYPSISWG
FT                   TWFFISLPVCIISILLIWLLLLATFKPGRDTTIVPIRPVKDQFSGVQYFVTIVTLSTIG
FT                   LWCVSHQLEHVFGDMGVIAIIPMVLFFGTGILNKEDFNNFLWTIIILAAGGLCLGKAVT
FT                   SSGLLHTIAKAITARVDHFNLYGVLLVFSALILVMATFISHTVAALIMLPLVRQIGVGM
FT                   DDPHPNLLVMASALMCSVAMALPTSGFPNMTAIMTEVPQTGQRYLHVRHFFTRGIPASL
FT                   MSWAVIVTIGYGLMYIAGL"
FT   CDS_pept        complement(1221528..1222331)
FT                   /codon_start=1
FT                   /gene_family="HOG000211501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057929"
FT                   /orf_name="AFUA_1G04300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88139.1"
FT                   /db_xref="HOGENOM:HBG051522"
FT                   /db_xref="UniParc:UPI000051FD8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ3"
FT                   /transl_table=1
FT                   /translation="MSDQENNSRPSSPTPNPTQTEEGAPPTPKTDTQTPTKKPPKLGKK
FT                   KQQQQQESKPQPEPEPAEPEQQEENEENPPDNTKEDPRPQRDTHDVSANGEATEEDQEP
FT                   EQPQPQQEQPRPRRRKPQPQRYRPDSDTESIPRPEMDNNTAMEKPRRRRQRPQMQQQQQ
FT                   QQDGGPLGGLGGVNQVGDLVQNTAGNAVNGVTGSAGKAVGGLLGGNKGEKEDGGRDEQL
FT                   RLRLDLNLDIEVQLKAKIHGDLTLGLLYVFFRLFPYPDGMIKCGC"
FT   CDS_pept        join(1223380..1223485,1223649..1224262)
FT                   /codon_start=1
FT                   /gene_family="HOG000211512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057930"
FT                   /orf_name="AFUA_1G04310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88140.1"
FT                   /db_xref="HOGENOM:HBG051523"
FT                   /db_xref="UniParc:UPI000051F170"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ2"
FT                   /transl_table=1
FT                   /translation="MRGTSKGPAPSRRWLLRSDQVSPPYPYDDDDDDVWSSKIYKMATA
FT                   EKTKEQQKEPILQQDDYSDDYSDDYSDEDYETDDYEVSGDEAEAEDPKNQVKHRQRQQQ
FT                   QQRSRQPDAVEEADDEDYSDEDDYYSDEYDDEDEDYDNQVASGKAMQPYQPAGGNQSLS
FT                   QNGSMNVIPQEKQGSSLDDEEGMKLKLELNLEIEVELKAHIHGDLTLALMYVTPLLPPD
FT                   IPFTRSIRIGVDPRCSA"
FT   CDS_pept        1224929..1225600
FT                   /codon_start=1
FT                   /gene_family="HOG000211523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270397"
FT                   /orf_name="AFUA_1G04315"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL88141.1"
FT                   /db_xref="HOGENOM:HBG051524"
FT                   /db_xref="HOGENOM:HBG329862"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="UniParc:UPI00005206B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ1"
FT                   /transl_table=1
FT                   /translation="MATNANAPTKSFIIKHMNTSHADSLSLYLRAYCGVSAHFAHPAIL
FT                   QDISHSDLLITAKGTRYSVPINPPMTSLAETRARVVAMHKDSLQRLGLSDITIAEYRPP
FT                   QGLQVVSLVLVVATLVVFGRRSNFLPGSAFYETVGLDRYPVFTRFCYDVAPVVVGLLLG
FT                   SHLVEATLLAVKRLRPHGVRFASGLWVVWIVSNFVEGFPAWRRFDEMVREERMKRERMR
FT                   D"
FT   CDS_pept        join(1226288..1226361,1226411..1226942)
FT                   /codon_start=1
FT                   /gene_family="HOG000211544" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270398"
FT                   /orf_name="AFUA_1G04320"
FT                   /product="40S ribosomal protein S8e "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88142.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG245558"
FT                   /db_xref="HOGENOM:HBG745393"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI0000520696"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJZ0"
FT                   /transl_table=1
FT                   /translation="MGISRDSRHKRSATGAKRATYRKKRAFEKGRQPANTRIGAKRIHL
FT                   VRTRGGNRKFRALRLESGNFSWGSEGISRKTRVIVVAYHPSNNELVRTNTLTKSAVVQI
FT                   DAAPFRQWYEAHYGQPIGRRRQQKTAETTTEKKSNSVVKKQAARFADHGKVEPAIEKQF
FT                   ESGRLYAVIASRPGQSGRVDGYILEGEELAFYQRAIRK"
FT   CDS_pept        1227135..1228253
FT                   /codon_start=1
FT                   /gene_family="HOG000217090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904687"
FT                   /orf_name="AFUA_1G04330"
FT                   /product="Ser/Thr protein phosphatase family protein "
FT                   /protein_id="EAL88143.1"
FT                   /db_xref="HOGENOM:HBG051525"
FT                   /db_xref="HOGENOM:HBG329865"
FT                   /db_xref="UniParc:UPI000051EA4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY9"
FT                   /transl_table=1
FT                   /translation="MVSPVELLFHLTYTDQGQATGIINSTPPVRALGNYNNHIQLSTLL
FT                   NYPLTTVMGNKTIKTRLLLISDTHNTSPHPPPSPHPYRHPLPEAHILIHSGDLTTIGSY
FT                   QEHATTVATLKCHPAELKLIIAGNHDITLDEAYYAALPPSSFKTRSGREDPAAIKQLYC
FT                   GPEAYDAGIRYLDEGVHCFSLSTGAELRVFASPYTPAFCSWAFAYPRGRDRFNPLPEDT
FT                   TASSALSSAGADAPDGVVPDFPSVDIMITHGPPAGVLDTVVHGGSVGCEGLFAAVKRAR
FT                   PRVHVFGHIHEGYGALRGEWGPDMTLGGTKVVCDPDKVREERGAYVDVSADSGCPLRFG
FT                   EETLFVNASVLNERYKAVNAPWVVDLDLPVSS"
FT   CDS_pept        complement(1228544..1234783)
FT                   /codon_start=1
FT                   /gene_family="HOG000211545" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270399"
FT                   /orf_name="AFUA_1G04340"
FT                   /product="SH3 and Ded_cyto domain protein, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="EAL88144.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="HOGENOM:HBG051527"
FT                   /db_xref="HOGENOM:HBG329866"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI0000520912"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY8"
FT                   /transl_table=1
FT                   /translation="MPWRPLPRIAFAVAIYPFQPSTAADLPLELGDELYIIEQGGVNGE
FT                   WCRGYLVAPPSILAGLTSTKGQTLEARVFSGIFPRNCVEIREVLGDGDGHKALTNGDRL
FT                   SVDRGADDDPVTDTRSSVAYSQDDEHLAGEVSNVIIAKKGKPSQIFIQRLEDGQPSPAS
FT                   INHIIQTPSHPHTPVTPVTLTPRDPNAPKPAAPVPMLKIGDETPTSLSEPLVDEIASCL
FT                   REWHSTNLHELLLARQYDVVEEMYNLVRELDFARRQLLHDVLTAYEKEALRQEVVWKLV
FT                   RGNKMLGGEVIVRDPAQRGRLLTGEDSAVQLTKLQSEMSMLDESPTQHSDTASLHHLLL
FT                   EVNAVSGNSPGPVTLAVHLCSQTDGGAPKALSETYLLDIPSPESFSSMGQSSKLKTLFT
FT                   DLCATDLGDGSANGPKLYLVVEVRVPETPTVGAPLQSRPSVSRGSSSAAKSPTSAGHPG
FT                   KGSLRTRRSMIWSTKPRGLQSAEPAKESSAGPPQSSESASSTKDRGDTQSSKSSTTLRT
FT                   LGVGLLEVSQILRQEKDAEQIVNIWSPSSWLEEGEGHVDGFDDLVRTLLPSPSGKYVRS
FT                   ERAARIHLHMYPFVDSDSDALVRKNPTIMHNVIQTKRIGFSQAPSKPRSDIYVTISHAT
FT                   FPPEALLSHPQAGQLPVPTSTGLRNLQLTLEVRAASGARVEKCIFPSSNNVAHTAWRTT
FT                   ITERGTPWNQTICLNVPTEDIPGAHLIMSIADAPEFPFALAWMPLWDNQAFIRDGPHSL
FT                   LLHAYDKHTSSIENGKGAYLSLPWSSLGKNESAKDEAITGPLATLRLETYLCSTEYSQD
FT                   QVILSLLHWKDRPVDEILDTLKRVLFVPEIEIVKQLSSVFDALFGILVENAGNEEYEDL
FT                   IFNNLVTVLGIVHDRRFNLGPLVDHYADNQFNFPFATPCLMRSYLRLLQASADVQQSRS
FT                   LRATFKVGRHVLKFIINARQQQKAKEEGIGITRGQSTFNRDLHTIFKSLEVLMRNPSPA
FT                   MVGSKTLVVQHFHTWLPGLSKVISKDEIIMIALSFMDSCSDVKGLLILYKLVLIQHYTQ
FT                   LEIFESGPERRTLISSCIGWLEPYWGATGSVTDQYRDQVRLSCAIVAQLLKQPDPFLYG
FT                   FMPQIVSSYYSIIPDGVEETSYLSLLFSKSFPFQVKASKTSQKFDEALVELSAIMAATA
FT                   TIPKPKKPSLKGPELATFISQALEVHNSILNCEAYPESWFSVHVYNHRATVKSLEFLAT
FT                   LLTSKFLPAPDDAESFDTRLWESFFMTLLKVVSSDALALETFPEQKRRAVWKIAGDVRE
FT                   QGAELLRSSWEAIGWETTDEDRELYGLRKLGGYQVQYVPGLVAPIIGLCLSVHEGLRHV
FT                   AVEILRTMILSEWGLNQELSIVETEIISSLDHLFKTKKMNESIIQKLFVSELLEYFEGC
FT                   TSLDEDLSDAVKGLIATVDELLDLFVASQSGSMAGSMHTLRLMEYMKDMGREDIFIRYV
FT                   HELANVQAAAGNFTEAGLALQFHADLYDWDPKRVVPEVLDPPFPEQTAFERKESLYFAI
FT                   IQHFEDGTAWAHALVCYKELAEQYEHTVMDFAKLSRAQSSMAKIHESIAKEEKQFPRYF
FT                   RVVYKGLGFPPTLRDKQFIFEGAPNERMASFVDRMQREHPAAQIVSSGEVQDYEGQFLQ
FT                   ITSVSAHRDMTHPVYQRSRIPLAVRDHLLISEPSQFSSTLKRHVQGTDVREQWVEKTIF
FT                   TTAEPFPNILRRSEIVAVEEVALSPLQTAVERTWRKTQELSLLERRAASGEDQGLSSLT
FT                   EALQQLLDLNSPSASCVALYRQFLAEVDEDDTEKVEESTDPMKNALAVALMDHALAIKH
FT                   ALALYARPAHQATQAELMRQFEEAFAPELVSLNPVVAESPATQRQSPVSAENRQKQSQS
FT                   RSISPRNHVRKPSEKPSVSQRISIMNPFKRANHAPNGSVATVIDMKTEGKDHDDDTATI
FT                   YSRTTAQSGTTHTKRRSFFGEMVHKHGSSIAASTEDVQEQLSRSGSRSQDNRSRSGSQH
FT                   HGPSGDDSISSIKGGGVAKATSVRDNHSVRSSDRSQVGSPGGHSYSQSHSGGVRDSVMK
FT                   RLSLFKGVGRKTSRLEIRPETNGVLREE"
FT   CDS_pept        join(complement(1238250..1238325),
FT                   complement(1237183..1238150))
FT                   /codon_start=1
FT                   /gene_family="HOG000161956" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270400"
FT                   /orf_name="AFUA_1G04350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL88145.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG051528"
FT                   /db_xref="HOGENOM:HBG327115"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E579"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY7"
FT                   /transl_table=1
FT                   /translation="MVALQAVQAHNAALTSLASGPVAVFVGGTSGIALSTALAFTRYTT
FT                   SPKIYLVGRSQSAADTAIASIKRINPSAQPTFLQADISLLKNVDSVCAELASREKSINL
FT                   LFMTPGYLTLKGRDETAEGLDRKFVLHYYARMRFITNLLPRLSAAAQDPSVDAGARLSR
FT                   VVSVLDPMVSVRAGGAGTLDFSDLSLKHTFTLQKCGWHASLMGNFFLESMAERHPHTSF
FT                   VHAYPSGVATGVMRELPAGRVLSAVLTPLLRPFMVPLHESGERHLFAATSGRFPSKAEG
FT                   EGSEGDIAAGSDGTKGSGCYWLNWDGEVFPPNKKIQRTRMQGAVDKVVQHTEEVFKQVC
FT                   EEGNTYP"
FT   CDS_pept        join(complement(1244631..1244829),
FT                   complement(1242221..1244424),complement(1241049..1242166),
FT                   complement(1240073..1240991))
FT                   /codon_start=1
FT                   /gene_family="HOG000211556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209239"
FT                   /orf_name="AFUA_1G04360"
FT                   /product="Exocyst complex component Sec3, putative "
FT                   /protein_id="EAL88146.2"
FT                   /db_xref="HOGENOM:HBG051529"
FT                   /db_xref="HOGENOM:HBG323881"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="UniParc:UPI0000F51ABE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY6"
FT                   /transl_table=1
FT                   /translation="MSSRDRSRVPAPNDVPPHREPRRMGDGRNGGFTGPGEATMSRAEK
FT                   FEDEKRRIIQSCFSKKDSDGSLVESYITHVRITEDAAHPSTPAPPNSPPENKKPRVIIV
FT                   AVRRSGRVRMHKARENNDGTFSIGKTWMLDDLSSIQSYTGFVPSTPLEQQHKQWAATVG
FT                   FVVTVGKPYYWHARSSKEKDFFIGSLVKIYRKYTGGKVPNLIGFDDRERQLLVGSPSPA
FT                   PPGSRGMGQGPATRSPSSQGSRPQSPYTGRAPSRDGPRDIPREFKRQPSEEQALRAQRS
FT                   RDQMQRPSTSQSGRVAAPSPLGQTSQPLGAVSPDPRGEPPPRSNERLPKAPVLPPPEPR
FT                   TKEVTDSLAAAKPVSHTPSSQADLGSDPRPSPFLQDGKAVLDPSPVPRTEDLSSSLHEV
FT                   GHDKDARPSTAVSGSAENLDVMQTPASSMEANKTVGESRENLSLPETQVEPQIIDKPAG
FT                   PVKMQPPDIPPALRPASSRSNNVPTPSVAAAPPETTRSVTPPPAAEPSEPPRERSPSPP
FT                   PASSPESSKPVEEDSEAHRPGLGPMIKKKPSRDIAGAFRKAATAYGAFKPRPGGAGERL
FT                   LAAAKKQQSMSDEPDGITGVVPAPSLRVGTEVKPAAASGTPDNKETPPAIPSPIKEAPS
FT                   PVAPTALEPPTVEVTQPPATGTAVTVVGSRDEARATARDEVKTVADERSRSVSPSPNGR
FT                   RRRREDNTIKYCQALGIESNILEGRGADFDDILTDLGWNGRLSDDKKIEDLEADIRREI
FT                   GRVEATSWLGNLEQQEGKVDQLARLIDKTIEECEELDGLLTLYSHELNTLHEDVSYIET
FT                   QSQGLQVQTANQKLLHNELQNLLKTLSISAVDLQPLRESSLSNPDGLRETEAALSTLYK
FT                   AMLMIDPDIWQNKKRLGDAAGEQGSVGVYADTEIGQMRAIREKKEEYRAQSRMFLQRLR
FT                   QFMAIAYKVAEQKRVDAAANGPKDPLKLDSEARAYFRQELWMYNALMLFAREVSGSEWH
FT                   GLISLYEQQAKLPYQNEFRDNNLAWKRAGRKPSGEEQELLFTHQEKEKESEGITMAARK
FT                   LTVRRGKTIRAAAGLRLTPGEKRHGRLEPCEVFAGTLQETLKMISEEQNFIVHFFHLSS
FT                   LSNTEFSDFVASGNPDERPLPDFSARQPHDPDRGMARKVDQIMDELYSFWSTDMQNLVD
FT                   WAIQPDPLQGIGILSALEKAMSDFDDTNQEFIIRCLQKLHSRLNGLFNRFVDEQIRGIE
FT                   DTKVKVNKRKGVISFIRVFPNFSAAVENMLSQPNQEFFDIRVSVNDAYDRINRAMWESL
FT                   KFIAKEAPTGVAASAGDPEDKEVLNYHILLIENMNHYIEEVDVRGLPVLERWRDRAQQD
FT                   YEEHLKLYLDLVIQRPLGKLLEFIDAAEGLMAGGGNPADIASRPSHSRSVAKKVLAMYD
FT                   SKEIRRGIELLKKRVDKHFGDADDPGLSRSLVLKVLRACERRYEEAYDRTRHVLDAVYE
FT                   GQLDLEWRKEDVIAMFNR"
FT   CDS_pept        join(1245559..1245615,1245684..1246940)
FT                   /codon_start=1
FT                   /gene_family="HOG000211567" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209499"
FT                   /orf_name="AFUA_1G04370"
FT                   /product="Ribosome assembly and transport protein Srp40,
FT                   putative"
FT                   /protein_id="EAL88147.1"
FT                   /db_xref="HOGENOM:HBG051530"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="UniParc:UPI000051FFAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY5"
FT                   /transl_table=1
FT                   /translation="MAAQKVKKASSKATVEKSKAKTVAPPPELVASVAAFLSQFGFKST
FT                   SEALSKEQSKKAIAKVDSKEVPSLLDIFRSWQDRKSESSSDSESSSSSSEDESSDSDVE
FT                   MNDAPKMQKKQSRESSPSSSSSSSSSSSSSSDSDADDEEDDDAAPAPAPAPKTTGTKRK
FT                   AESSSSESSSESESEDEAPKAKKAKLSTKSDSSSSSESSDSEDEESDSSDSESSASSSD
FT                   SDSDSGSDSDSSDSESVSSSDSSSDSDSDSESEKEPAKKAAKKILKTAAKTPLPESSSS
FT                   SSSDSDSSSSDESSDESSSDEDQNTNSRSSSSSQNSSGSSKTVQPSDSDAKEPINKTTK
FT                   KAQETSSSSASPAPGNGPATKKKHTGARPTPLAQLSELPHNHPSNAYVPYAYAEKAWKD
FT                   LSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFED"
FT   mobile_element  1245732..1246409
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   CDS_pept        join(complement(1248086..1249170),
FT                   complement(1247301..1248027))
FT                   /codon_start=1
FT                   /gene_family="HOG000211578" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271361"
FT                   /orf_name="AFUA_1G04380"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL88148.1"
FT                   /db_xref="HOGENOM:HBG051531"
FT                   /db_xref="HOGENOM:HBG329869"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00005201E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY4"
FT                   /transl_table=1
FT                   /translation="MLLSDLPSDIIYVIATYLPSASSLAALAQTCQRLHKVIAAEDWRV
FT                   FHAHFKNRFPFVETPPFWKDATQALTARARALDRLGLLCRFVLPPRDAVKVGSHRGTRQ
FT                   DNPTHGYRPSIDSYESWPGGSWSERKEVLVWGAADELVLRIRQPTYNGGETWFMFNDVK
FT                   TKISSYHDICGVHLLKQEHHTRKSGDEHIIFGRLNGDLCHVAISPDSASHKYYQRFMTN
FT                   GHGLERTDLSGGDEPILAAHLNNGSIVFYQTTTGEPEVEPFAHCKITPDGTARNKYSKF
FT                   LSPECIAYGTGRQENALTIATISNERLSVSREISVTSLDIGESIGLRRKANVSAIAPLT
FT                   AQSTAESSGQVFLAAWGDRCIRLHDLRSHQPFEYTYRDTIDTNPIYCIHPFGQDRFLAG
FT                   AGGDAVVKIYDLRMQSAYRHKDTQIPSPNDLRRSSNGSTPYLNGFQDTVTYPRKDFSIF
FT                   LTTSSSVRWNSKATRSRVDRQYRGPIYTMSSPSPSSSTIYTGIVDGVMRLDFASSDDLT
FT                   GPAQAWYRDYFGLSADLTHPATQADRIVELSGYERRDSTSASKLRTQQPFARIGPSDIE
FT                   HEKNTGWDRRWQPSGPPGAWRRSDMVT"
FT   CDS_pept        join(1250155..1250486,1250547..1251658,1251709..1251848)
FT                   /codon_start=1
FT                   /gene_family="HOG000178129" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752767"
FT                   /orf_name="AFUA_1G04390"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.14.1"
FT                   /function="aromatase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88149.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="GO:0070330"
FT                   /db_xref="HOGENOM:HBG051532"
FT                   /db_xref="HOGENOM:HBG323882"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000F51A6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY3"
FT                   /transl_table=1
FT                   /translation="MVVSIYTSLSIVILLLFVAYKAIVYPVFLSPLAKIPNAHWSAPVS
FT                   PAWILWKRFRSQNNSTIHAAHERLGPIVRLGPSEISINCVEGGIKTVYSGGFEKHEWYP
FT                   RVFGSFGTVSMFTMTGSKDHSVRKRMLSNIYSKSFLQSSPHMRLISRTIVYDRLLPILY
FT                   DAATSSRPVDVHDLNQGLTMDFVSAYLYGVTNGTNFLQDAPYRQRMLHLYQSRKPFEFY
FT                   HQEVPNLLSWTKSLGIRLIPRYCDQANEILDSWGLGLCDKAEESLKSNRLEDEPAVYKH
FT                   LKQMILKHLPENKNDVEYARILEQQRLDIACEMYDHLTAGHETSAVALTYLLWELSKRP
FT                   ELQDALRAELSTLEPMVIFPRPSESAELPPAKSIDSLPLLEAIVTETLRLHAPIPGIQP
FT                   RVTPYPSCTLAGYNNIPPKTRVNAQAYSLHRNPEVFPDPETWEPKRWLKDVNTPSELEE
FT                   RRRWFWAFGSGGRMCVGSNLALQEMKLVVAAVYTNFKTSIVSDDNMEAIDAYTVKPTGE
FT                   SLILRFELVE"
FT   CDS_pept        join(complement(1252890..1253016),
FT                   complement(1252689..1252768),complement(1252506..1252604))
FT                   /codon_start=1
FT                   /gene_family="HOG000211589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752768"
FT                   /orf_name="AFUA_1G04400"
FT                   /product="37S ribosomal protein Mrp10, mitochondrial "
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88150.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG059133"
FT                   /db_xref="HOGENOM:HBG736580"
FT                   /db_xref="InterPro:IPR017264"
FT                   /db_xref="UniParc:UPI000051E591"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY2"
FT                   /transl_table=1
FT                   /translation="MPPKGVSTRLNPVRLQTIPHLRVRRPNQHEQNPCVTIMSSMLSCW
FT                   ASSGGSVEGCAALEQQLRQCMDGPKPKGNKKNTINYHLMRMYPKVVGPKKKEGRLG"
FT   mobile_element  1253413..1254483
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(1255183..1255533,1255555..1256763)
FT                   /codon_start=1
FT                   /gene_family="HOG000211600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209500"
FT                   /orf_name="AFUA_1G04410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88151.1"
FT                   /db_xref="HOGENOM:HBG051533"
FT                   /db_xref="HOGENOM:HBG329871"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniParc:UPI00005206A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY1"
FT                   /transl_table=1
FT                   /translation="MSIRHTTIFRNTASSIRPARQIHRAFSTTSRRQNAGSQTNASSDA
FT                   SYSRVNSEEESAMQRRLSEMTEQAMLEGGRSAQRNIEQAGFSEDLKKRLQERIAATTFK
FT                   NEYAAAHSIVNMPFMLQTLADQLKESAGQGTRDIAGAAPWTGTESLHDATLRMLDSSKK
FT                   PMRVPYKIPQPAPVDMRISPKPSKSPGLRIADAKERSATYTMSQRPGISEDEREALRRE
FT                   MSERFTAGARPMPMTLQGLSSLANERIEDAIARGQFNNIKRGKGVNVQSDHNANSAFID
FT                   TTEYFMNKIIQKQEIVPPWIEKQQELTREVDRFRQRLRVEWRRHAARLIASEGGSLEAQ
FT                   MKRAQAYAAAEARLAERTKIEQAFRDTKGTASSTPADETTKTETTSNSDENQLPHLSPL
FT                   RDLQYLSTERSYHELQIKHLNALTRSYNLQAPPVAQKPYLNLERELNNCYADVAPSLAE
FT                   EIKRRATERASPHVPTAKSSTNKVLSTFSTTQTSRVYDEDASKGYGFKDLWRDLFSKKS
FT                   ER"
FT   CDS_pept        complement(1257013..1257786)
FT                   /codon_start=1
FT                   /gene_family="HOG000211611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271362"
FT                   /orf_name="AFUA_1G04420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88152.1"
FT                   /db_xref="HOGENOM:HBG051534"
FT                   /db_xref="UniParc:UPI000051EEF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJY0"
FT                   /transl_table=1
FT                   /translation="MGNKVSAIHGVKSDHFYEKGNGINEIWIGDVELISRLPFGDSDLA
FT                   QAAWPIGGWPKIPWHNFIIPLKRRALSAIESFSPGNNEHHQMSKRAAPDSGPPFHLSRV
FT                   SLIVAVSVLSSMFMVAIYLPIFVRRHTASSGSSWQPDIARRQEQTRRFATRAGIATMAL
FT                   AVSLVIAILQVHIWTLIRFVFAPKSAKFQILEVLWIAVGCVGLFYSVKAVTLLWLDLRD
FT                   ARRAAVEESPNVSNGVIEKQLPAILVSWLERRRRP"
FT   CDS_pept        1258607..1259881
FT                   /codon_start=1
FT                   /gene_family="HOG000211622" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904929"
FT                   /orf_name="AFUA_1G04430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88153.1"
FT                   /db_xref="HOGENOM:HBG051535"
FT                   /db_xref="UniParc:UPI000051FFC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJX9"
FT                   /transl_table=1
FT                   /translation="MMLLLMLLLFTLCDIATAGSVSVEDLTLNLDLDRRGIALSTEPPV
FT                   DQSLLAIQIGGIVGAYVIFVAILLTLLLFVGRRLRRAVQASNYTLQVEMMKPSKQAVSM
FT                   DPSPVTPVSARLPSPIAQNGFNRSWGSLAKGPRPHVSGNGSAATIDESVVAIDRQRAQE
FT                   EMEMLYAAVMEHDAQRAAGIDTSKQEWEVQSPGSVHTNPFTDRSSRTSERPSISQTKLP
FT                   LSPKSSRLSRISSLSLFNSNSRPQSKGGKIRSPRLPLRNLAISSPVGSPDLTAPHSYGE
FT                   DQMPLTPRLYNPAPPPAPPITISQASSEVSLGKAPGRAPAPAPLSLSTASHGSSSLPFR
FT                   DAFPLQSAPPTKTTVIERPIKPLNGPRTGLPTPYSPYMPFTPVTPLTPSRIVTKRQRKR
FT                   ETKENGLRVLNEDDIVKDDGDMWGY"
FT   CDS_pept        1260680..1262095
FT                   /codon_start=1
FT                   /gene_family="HOG000211633" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271363"
FT                   /orf_name="AFUA_1G04440"
FT                   /product="Proline utilization protein PrnX-like, putative "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL88154.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051537"
FT                   /db_xref="HOGENOM:HBG326214"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FB36"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJX8"
FT                   /transl_table=1
FT                   /translation="MPLTILSQAQLRSLLLSLNRDEVSSLQQSLAQALLDYSTGSQEQG
FT                   CAATYQPLRTAITRQNGCTTLFMPASTGRTIGMKMISLQDGGAAGCAVEGAFEIPEGTK
FT                   TASRSRSAGPRSSMTSLSSEMSDLSISSQEEGSSSSSSSRSLRSDTVNRQSVGSSSSSG
FT                   ISKTLGAWPGAGTRDTSPQGTVTLLDADSMPFGLINAHELTPFRTALATMMIFNKRKRV
FT                   RTVVVFGAGKQAYWHIRLALTLRAADIKRVVIVNRSFERAAMLLKDIYSTENSSWRGDV
FT                   KFSAVSTDFGEYDRIIQDAIHKSDAIFCCTPSIEPLFPAELLTSREGRQKGRFISAIGS
FT                   YRPHMAELHPDILRDEVNAHHSGRHFHKHIKRSGVVVVDSLEAALKEAGELIQAGIKPN
FT                   QVVELGELLMVRDASRKDNNQDVEDTKSLREWVERGNVIYKSVGMGLMDLVTGGDLIQM
FT                   ARTRNLGTSVEDF"
FT   CDS_pept        1262617..1264071
FT                   /codon_start=1
FT                   /gene_family="HOG000211644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904930"
FT                   /orf_name="AFUA_1G04450"
FT                   /product="Siderophore biosynthesis protein, putative "
FT                   /protein_id="EAL88155.1"
FT                   /db_xref="HOGENOM:HBG051538"
FT                   /db_xref="HOGENOM:HBG329872"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniParc:UPI000051E57A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJX7"
FT                   /transl_table=1
FT                   /translation="MRNTICRLPNGQSYTVTPVFGGVNFKSNDMHLKDSIIPPGWTIVL
FT                   YTNQNTDQPAQDSVPPEEERGRSRYTQGEAEEKTRTTRFTTPTLNDDCFYISFIVNPPS
FT                   TDFKPPVSPTRQIAMMIWVSLYWYFHEPEPDLHLQTDAASQTPLTGKPKGEWRIHLKRE
FT                   GIFKGRNLLQKLERMGLIASEESSVGLEPSETQESGAWSRMFVSRRSFWQIDPRIFVFT
FT                   LVPANPLHSAPSSPFISPRFASPSRESPIPTESPASPTGKDFPLHMPNEGPFASSSHLP
FT                   TYFPPPPTQYTFTNGLRHPVRPKPPHQGEVFYIRFIPSVGQYLSFRVPILSSSATPSRG
FT                   HGHSHSTSSIEVPPQTTPSDLDLLHKWMNDPRVSAAWGEGGPKEKQEKFLRNNLTSRHS
FT                   FPVIGCWDGKPFGYFEIYWVKEDRLGALIGGADNYDRGIHLLVGEQEYRGSHRVAIWLS
FT                   ALVHYCWLADPRTQTVMLEPRVDNEK"
FT   CDS_pept        join(1266389..1266524,1266687..1266934)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058204"
FT                   /orf_name="AFUA_1G04455"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27337.1"
FT                   /db_xref="UniParc:UPI0000F51A8B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S8"
FT                   /transl_table=1
FT                   /translation="MDRQQLPAKGAVGLNELEARTAGAPPNHALRVQALSSLRGCSGVY
FT                   CRFSRKEACSQPPKRGILSLTGLFADDEVIESKPMPSKAPSQRYRGVLAWRFQSSYRRR
FT                   DWRGFDELLPSSVPPEDDYLFPG"
FT   CDS_pept        join(complement(1270407..1270442),
FT                   complement(1269867..1270174),complement(1269651..1269811),
FT                   complement(1269164..1269589),complement(1268328..1269097))
FT                   /codon_start=1
FT                   /gene_family="HOG000236577" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752769"
FT                   /orf_name="AFUA_1G04460"
FT                   /product="Lysyl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.6"
FT                   /function="ATP binding"
FT                   /function="lysine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="lysyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL88156.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006430"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG631383"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000F51AB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJX6"
FT                   /transl_table=1
FT                   /translation="MHSICPRWASQLQCISAGLPFTSSNHRTLRLADSLLGAIKPVSSS
FT                   SIRTRHSSSAASSDKAFRHRLEEVKNACADPYPRLPSDNRSLSCATFRERYSHLTSNQT
FT                   VEDDTVVVNGRIRAYRLAGSKLIFFDIFQDGHKVQVMCNIRKLDGVAPDAFKRFYRLLR
FT                   RGDTFSVTGNPHRTGTGELTVLATELPRLLAPCLHDVPVDAEEHETSPYPRHVQFLADQ
FT                   KAADIIRARSAIIQFLRQFFLDRSFMEVSTPIIGSIAGGAIARPFQTSATEFPDRQLSL
FT                   RIAPELWLKRLVVGGFDKVFEIGPSFRNEGLDKTHNPEFTTCEFYHAYANLEDLMSITE
FT                   NLLSGMAAHIQEFNKNASLKPPEVDFSAPFRRVDFTTGIEGKIGRRLPDLTTPDALDQV
FT                   SQLFRDLSLPIPKEPTLPRLLDELCGTYLEPECINPTFIINPPECLSPLSKSFIHPANQ
FT                   QRVAARAELFIDGREIVNTYEEENSPFEQRRKFEDQVRYTKGTDEPAEIDESYLEALEW
FT                   GLPSTGGWGCGIDRLCMLFTGTKRIGDVLPFGNLRAVTRRHTGLSRSTN"
FT   CDS_pept        join(1270789..1270886,1270993..1271176)
FT                   /codon_start=1
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271364"
FT                   /gene_name="tim10"
FT                   /orf_name="AFUA_1G04470"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit tim10"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="EAL88157.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000052041A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJX5"
FT                   /transl_table=1
FT                   /translation="MSFLFGGPPKMSSAEKIAAAETEVEMVSDMFNRLTESCQKKCIPN
FT                   DYREGDLNKGESVCLDRCVSKFFEVNIKVSEKMQGEAAQKQGAPGFGM"
FT   CDS_pept        complement(1271626..1274181)
FT                   /codon_start=1
FT                   /gene_family="HOG000211400" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904931"
FT                   /orf_name="AFUA_1G04480"
FT                   /product="Sin3 complex subunit (Stb2), putative "
FT                   /protein_id="EAL88158.1"
FT                   /db_xref="HOGENOM:HBG051539"
FT                   /db_xref="HOGENOM:HBG329893"
FT                   /db_xref="UniParc:UPI000052091C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJX4"
FT                   /transl_table=1
FT                   /translation="MPPAVTSAQAAPPVAIQRDSNPCSHTNGPMEASPLHGHQKLVFTD
FT                   PVALRYLEEDPATVVLHRRLILEGYEIYIVEQWACSRVHPTFVITTYTGDPSHKVLVGV
FT                   LSVPTDESSWSPRLKLYFNAVTQCQARTKNTPLGTVMVTDLSSFPSALTVIPVPDGDIL
FT                   RHKEDFIVNENLKRLSCAGRAGLKLQPPSPATVAKFYQLYRTSERVPVYSAVMELVKQC
FT                   QIALSMFGLLAPEYVDGLLCDVTETAINDWWTEFGIDLYNIEPSDGVLGPTTVAALLGT
FT                   FMGARNRLHAFGAPVGKDAFDIRSLKRAIESFQKSQKMERTRRLDRQTLDRLHRVTAKA
FT                   ANAEGWTDAVKSTMAELSGHGGEMVMGMVRGREKGGIADIETLELDDFASLVTGERAKW
FT                   LWRGKPRKSGLGDGFAHDQPAADMMFNRDEQGNYVWTSRKRHSYEDLAGDRSLQGSDRP
FT                   WRQPDTGAAPDEKDQNLSRMVRRGVSGKVSDARIGFGRFKEAVGLPSLRSQHHKSTKDG
FT                   AELMGDAAYMPAIESDAEMPVLKTQADAHLTDQESISEPQDQARFHAVKAEQPASTSGP
FT                   TVSELEPPKITVDSPRDNEKTESARKTSTSQLEEDESDLGRSRTRSTDASVSQDELSRV
FT                   DLMLLRRPQSFIESSTTDDSERRSNGWPRHLSFSIVEDVVLGWESLGGREALQPKPDAT
FT                   LEQAVALEDTLASDVRIFSSKIEELSHHTVPWVEKQVNSVDELNRKLYESQENINSIYL
FT                   DQVEKYQQMRERSSELLTEEHNYLVDTMKRVEMMGAKLDYELDILESKVEDVESGLGEF
FT                   ERHVVELETRMKGLIKNEEEKQNNSWLSLLGRFLGLSSR"
FT   ncRNA           complement(1274988..1275121)
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U4"
FT                   /db_xref="Rfam:RF00015"
FT   CDS_pept        join(1276019..1276139,1276214..1276341,1276400..1277158,
FT                   1277228..1277446)
FT                   /codon_start=1
FT                   /gene_family="HOG000211399" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209501"
FT                   /orf_name="AFUA_1G04490"
FT                   /product="Regulator of gluconeogenesis Rmd5, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EBA27338.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG323884"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="UniParc:UPI0000F51A70"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9S9"
FT                   /transl_table=1
FT                   /translation="MDLVRKEHERLTKRLKASQNIKNVQDTIDLIQAARDTIASDPGQA
FT                   SMTLAKLQNSVKSSFDAINDNLKEHHSALNKYSKALDKLFKDKPLPSTEHDALSSREHL
FT                   INRAIAMHLLREGQFSVAATFLSEIAEKKASTRENDMDTDGPDAAKSLLDIDDVPSDEV
FT                   RKQFATMYHILHEMKENNNLLPAIQWSRENKESLEARGSNLEFELCRLQFVWLFHGGQG
FT                   PAVAGPQAALEYARREFHVFLPRYLVEIQQLMGAMAFSPNLQESPYRNIFDNPSAWSDV
FT                   AQSFTREFCSLLGLSADSPLYIAATAGAIALPTLLKLQTIMKAKRTEWTTQNELPVEIP
FT                   LPPSYLFHSIFVCPVSKEQSTDENPPMMMPCGHVIAEESLKRLCKGTRFKCPYCPNESH
FT                   PREARKVFL"
FT   CDS_pept        join(1278393..1278601,1278651..1279019,1279083..1279356,
FT                   1279419..1279454)
FT                   /codon_start=1
FT                   /gene_family="HOG000198833" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209502"
FT                   /orf_name="AFUA_1G04510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88161.2"
FT                   /db_xref="HOGENOM:HBG051542"
FT                   /db_xref="HOGENOM:HBG323885"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI0000F51AB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJX1"
FT                   /transl_table=1
FT                   /translation="MLTQQHSRSSQNMLSIKRPSQSPADSSSSRYRIGKATASQRVRNP
FT                   VRDSPSTPSRRVERRQRTGTSPTKSSPSTSIVTISVGPEARLFAAHEATLCISPFFAAA
FT                   CCRAQAQSPSPDSPNKRISISLPDEQPEILSCILEYLYKGDYTPRAIYNRHRETWELEN
FT                   TGPDTNGQTTNATIFHHATGSVILRDTAVYCAAQKYGLEPLKRLALRKQGLHSGIQCST
FT                   ILSSARYAYANTPDDESKLRAHYLALIIRCRSTFKRSGTMQMEMEKGGKLFFDLFVAMC
FT                   NHMDDLAIAKSSLA"
FT   CDS_pept        join(complement(1281156..1281727),
FT                   complement(1281024..1281096),complement(1280823..1280975),
FT                   complement(1280699..1280760),complement(1280229..1280649),
FT                   complement(1280088..1280174))
FT                   /codon_start=1
FT                   /gene_family="HOG000211378" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058205"
FT                   /gene_name="csn12"
FT                   /orf_name="AFUA_1G04520"
FT                   /product="Protein CSN12 homolog "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="EAL88162.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG051543"
FT                   /db_xref="HOGENOM:HBG329890"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI000051EECC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJX0"
FT                   /transl_table=1
FT                   /translation="MASVFTDFKEGQQNGSGPRLAAALTPIATSQSPDRLLSFYNFSDS
FT                   DHISADLRYSLFQANGVKLPKQEQNGWVDIFAAYWKAVGEIVKFEEYNPSASWAKVFDA
FT                   WKNVANTLIRGYTNFGLQAWTVPCLYVVGKYLRVFAIKADTEISSKGAMAFGDQLQDDV
FT                   AADFEKSAKLEEAARIINRMFTLCLSDRAPIEESRKWGIYNTTNLLFKTYFKLNSVGLS
FT                   KNLLRALSASSADLPELEAFPKSHIVTFKYYVGVIHFLDENYREAEEHLAYAWNMCHKG
FT                   AFKNRELILTYLVPCHLVTTHTLPSQKLLAPFPRLEKLFRPLCDCIRKGDLVGFDTAMF
FT                   AGEEEFVKRRIYLPLERGRDIALRNLFRKVFIAGGFEESKDGQPPIRRTRVPVAEFAAA
FT                   LRIGTHADDRSRVDIDEVECLLSNLIYKGLMKGYIARERGMVVLSKGGTAFPGTGV"
FT   CDS_pept        join(1282636..1282746,1282822..1282998,1283058..1283216)
FT                   /codon_start=1
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271365"
FT                   /orf_name="AFUA_1G04530"
FT                   /product="Ribosomal L18ae protein family "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88163.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG319315"
FT                   /db_xref="HOGENOM:HBG387981"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniParc:UPI000051EC73"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW9"
FT                   /transl_table=1
FT                   /translation="MRIFAPNPVVAKSRFWYFLTQLRKVKKANGEIVSLNVIHEKRPLK
FT                   VKNFGIWLRYDSRSGTHNMYKEFREMSRTEAVEALYQDMAARHRARFGSIHILKVVEIE
FT                   KADTIRRPYIKQLLQKNLKFPLPHRSAKPAGKKVFAYSRPSTFA"
FT   CDS_pept        join(1284032..1284076,1284158..1284437,1284505..1284582,
FT                   1284637..1285205)
FT                   /codon_start=1
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752770"
FT                   /gene_name="mcr1"
FT                   /orf_name="AFUA_1G04540"
FT                   /product="NADH-cytochrome b5 reductase 2 "
FT                   /EC_number="1.6.2.2"
FT                   /function="cytochrome-b5 reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EAL88164.1"
FT                   /db_xref="GO:0004128"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG477179"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="HSSP:1QX4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051F891"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJW8"
FT                   /transl_table=1
FT                   /translation="MFARQSLRVAQPLKQGFRKYSTEAPSKGKSSLAPIYLGVGLIGLG
FT                   VGLYRYNSASAEAPPAERPKVFTGGDQGWVDLKLAQIENLSPNTKRLRFEFPDKEAVSG
FT                   LHVASALLTKFKPQGAEKPVIRPYTPVSDEEQPGYLDLVVKVYPNGPMSEHLHSMNVDQ
FT                   RLEFKGPIPKYPWEANKHKHICLIAGGTGITPMYQLARKIFKDPEDQTKVTLVFGNVRE
FT                   EDILLKKELEELENTYPRRFRAFYLLDHPPKEWTGGKGYITKELLKTVLPEPKEENIKI
FT                   FVCGPPGMYKSISGPKVSPTDQGELTGILAELGYSKDQVFKF"
FT   CDS_pept        join(1287140..1287220,1287710..1288096,1288155..1288616)
FT                   /codon_start=1
FT                   /gene_family="HOG000211356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271366"
FT                   /orf_name="AFUA_1G04550"
FT                   /product="HMG box protein, putative "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88165.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG051545"
FT                   /db_xref="HOGENOM:HBG329888"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000051EA43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW7"
FT                   /transl_table=1
FT                   /translation="MSRKDDAKAHDGQVTVNVDDFTRTRESVLVSLSNLQAAVSDLTRA
FT                   YINHTNTVLNPSLSTLDLGHASNITAALLENGLLGARSSSPGAKSEVGEKKKRKRAPPD
FT                   PNAPKRALTPYFLYMQHNRPIIAQELGPSARPKDVSDEGTRRWAEMPEAQKEVWKKLYA
FT                   DNLAVYKEKVKAYKAGKPWTEDDNTKAASQLQQDIAGASASGGEESDEQEQEEEADEDE
FT                   ETEESSPEPVKEPTPPRNNKRRRSEVKTPSKRNESPEKKKRTSARKGNEKDKEEEPPAS
FT                   TRKAAAAGADASAKRSKKKRKSEVGGDE"
FT   CDS_pept        join(1289411..1290133,1290191..1291873,1291936..1291995,
FT                   1292062..1292322)
FT                   /codon_start=1
FT                   /gene_family="HOG000075064" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16271367"
FT                   /gene_name="ure1"
FT                   /orf_name="AFUA_1G04560"
FT                   /product="Urease"
FT                   /EC_number="3.5.1.5"
FT                   /function="nickel ion binding"
FT                   /function="urease activity"
FT                   /biological_process="urea metabolic process"
FT                   /protein_id="EAL88166.1"
FT                   /db_xref="EMBL:CAE17672.1"
FT                   /db_xref="GO:0009039"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="GO:0019627"
FT                   /db_xref="HOGENOM:HBG051546"
FT                   /db_xref="HOGENOM:HBG357507"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR008221"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="UniParc:UPI000051F8A1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6A3P9"
FT                   /transl_table=1
FT                   /translation="MHLIPKEVRDRDLLPTTYIHIHIHSKVSTNHFAPAAGQARHLAIG
FT                   ISRPASSCARCAAQSCRGSGMDFPLFSLRDPLRRLIEANSRPGSHLVESARGIFPTSEL
FT                   EAGYHGAYSQQLIRDGHYSVADLMSIGKTMLGRRHVLPSVVHTLVELQVEGTFPTGTYL
FT                   VTVHHPISSDDGDLEKALYGSFLPIPPADTFPDPNPDDYLPEKMPGAVLPVKNERITLN
FT                   DGRKRIRLKVMSKGDRPIQVGSHYHFIETNPQLHFDRLRAYGYRLDIPAGTSVRFEPGD
FT                   TKTVTLVEIAGNRIIKGGNSIASGKVDISRAEEILQRLQVEGFAHVPEPAPTADSALIA
FT                   PFTMDREAYARMFGPTTGDLVRLGLTNLWVRVEKDCTVYGDECAFGGGKTLREGMGQSS
FT                   ERSATECLDTVITNALIIDWSGIYKADIGIKNGLISAIGKAGNPDMMDGVHPDMIVGSS
FT                   TDVIAGENKIVTAGGFDTHIHFICPQQVDEALASGITTFLGGGTGPSTGTNATTCTPGP
FT                   TLMRQMIQACDGLPINVGITGKGNDSGGKSIEEQIRAGAAGLKLHEDWGSTPAAIDTCL
FT                   DMCDKFDVQCMIHTDTLNESGFVEQTVKSFKNRTIHTYHTEGAGGGHAPDIISVVEHPN
FT                   VLPSSTNPTRPFTMNTLDEHLDMLMVCHHLSKNIPEDVAFAESRIRAETIAAEDVLHDL
FT                   GAISMMSSDSQAMGRCGEVILRTWNTAHKNKAQRGPLKEDEGTGADNFRVKRYISKYTI
FT                   NPAIAQGMSHLIGSVEVGKLADLVIWHPSTFGTKPAQVLKSGMIVASQMGDPNGSIPTI
FT                   EPVVMRRQFGAFVPSTSIMWVSQASIDDGIVQSYGLKKRIEAVRNCRNIGKKDMKFNDV
FT                   MPKMRVDPESYVVEADGVLCDAEPAEALPLTQDYFVY"
FT   CDS_pept        join(complement(1294704..1294943),
FT                   complement(1294498..1294651),complement(1293541..1294448),
FT                   complement(1292511..1293491))
FT                   /codon_start=1
FT                   /gene_family="HOG000211345" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271368"
FT                   /orf_name="AFUA_1G04570"
FT                   /product="DNA repair protein, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88167.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051547"
FT                   /db_xref="HOGENOM:HBG329887"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="UniParc:UPI000051F167"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW5"
FT                   /transl_table=1
FT                   /translation="MVVDYFRKNPERPPPLACFLSHVHSDHLQGLESFRAPFIYCSAAT
FT                   RELLLRIEKYPHRMNFSKGILESRRLHYKHLTKLLRPIPLDTPTEIELTPLLSIRVTLL
FT                   DANHCAGAVMFLIEGDGKAVLYTGDIRAERWWVNSLVRHPVLIPYTLGSKKLDKIYLDT
FT                   TFASINHVCRSFPSKAEGLRELLQKVEAYPKETIFYFRAWTFGYEDVWIALSAFLNTKV
FT                   CDGTQIDKRFSLTLQVHIDRYQIGLYRSLISNSRRAISEAPALCGFELGNRFVPGALTE
FT                   DESSRVHSCEPGVHCSAVRSKRTVYIMPIVGRLEDGTRVPEIGAGGGGGDLYQTHELEL
FT                   PDQSSLEQLESLCLEQIGDPETLSQMRKDLTEAFKSRNKALPLDSYGMKDVSDIPLQEL
FT                   VHILGRGRSDKEMWSDDVKVSALRDTSGNRLPKTIYFPYSRHSSYEELCELVSAFKPRD
FT                   VYPCTVDALEWDEDVSMRNLFGHLCSGHEFVHDQYMRDTIANDEELQSRKRARYEDDST
FT                   QSTQQFISVDASIDGSPTVMPNAGEPEVQARRRPTTTLSSRETVPDATIDLKVKKASPQ
FT                   PLPIPTSTPEAAKAKRNEIRRAWHFLRAEGSHHPEIELGALPSSWPTPEEDGFHLPNRG
FT                   SSETGDETRTRTQDNMQFAHDHDDDNEDDMPNSQVTATLSISSSAFASQEQTLGPLQQD
FT                   GPFDVGVDIPLSSEGAPGRPRTLGRSSSSRARRAAYLAARADSYDAWACMGLVSAGDNH
FT                   SMEETEL"
FT   CDS_pept        1296944..1297855
FT                   /codon_start=1
FT                   /gene_family="HOG000211334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058206"
FT                   /orf_name="AFUA_1G04575"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88168.1"
FT                   /db_xref="HOGENOM:HBG051548"
FT                   /db_xref="HOGENOM:HBG329886"
FT                   /db_xref="UniParc:UPI000051FB37"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW4"
FT                   /transl_table=1
FT                   /translation="MHKPSLAQIVHSAIFPRPRTSDPATFSAHITRNLVPEVRIETSTF
FT                   YGSLDSIEAQYPGLDYSYGPHRMRLSRFPWHRKLFKVFDELGLTEAEISSLCRWEGTKS
FT                   ARERYEKEEGIKVRDTTAEAIRPATPSPQPSVEIHFNGSSDPVREPEVKVDEPFEDVIN
FT                   TGHTVDNRGVDRLPQVQKVDEDSSDEEMESCGVELNHRLLAATAAREQGANVPLDEDWE
FT                   LWLKEAGERGSYADLINAIRTGQPLNFLSHMATPLAQLRRTDITQVPPSLPERFMTPAP
FT                   PRVLSSNIGIQRPPNPPPGTAR"
FT   CDS_pept        join(1298568..1298610,1298669..1299097,1299154..1299290,
FT                   1299340..1300485)
FT                   /codon_start=1
FT                   /gene_family="HOG000211323" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209503"
FT                   /orf_name="AFUA_1G04580"
FT                   /product="Nitrogen permease regulator Npr2, putative "
FT                   /protein_id="EAL88169.1"
FT                   /db_xref="HOGENOM:HBG051549"
FT                   /db_xref="HOGENOM:HBG329885"
FT                   /db_xref="InterPro:IPR009348"
FT                   /db_xref="UniParc:UPI000051FB47"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW3"
FT                   /transl_table=1
FT                   /translation="MIRAIFYSKFDTQEGPKVVHQVPDGAIVPSATAPSQPLFLTFSDI
FT                   SFFVIPRQELCGNLIQVCTNGYRILGYPICMKSPRYDRNEFIFNFCLVLAEEEDFSSYK
FT                   SVVQKLADLMHGLEEQNGFLSRDHSKSGEGKVYSLCETLMEDLNNYCECMIPIDELNTL
FT                   NIKLFPVYPAPPQVRAWQVPLFTVRYQAFMDENWDLTMQRIVPHINGVNSIRIISILAD
FT                   TDFSLTCRAIRHLLYYGCLFLLDIFSFSAIYAPTAQFSSTIACDEGMQRECARYVNTLF
FT                   APSLIHGSASAATAPSASTSALSPAAHGLTNAHVSGIPGNLVGLSKHDPDSVWPPVGDY
FT                   RDRRSTSRTPSPSSSYRSSTTTPSNSTILPDDHDPTQPPPPPEVVDGVGIVELYASLKQ
FT                   GQSVRQWYAQNSRKLAYIDIRRFITFGIIKGFLYRVHKYAYATGQPAPQLKSSHHYHNS
FT                   QSQPPSGPSSRGPGTGTNSPYASSVGDDAAPIAQQQQQQQQHHYRQHPGQRGDDAREHA
FT                   TSVHSGSRSAVVFDDEDEEEIVDNKTLSKYLDGMHCFDQICTELEISEKDLTAALKKYP
FT                   GEVLIIHR"
FT   CDS_pept        join(complement(1302680..1303217),
FT                   complement(1302008..1302510),complement(1300966..1301952))
FT                   /codon_start=1
FT                   /gene_family="HOG000211312" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752771"
FT                   /orf_name="AFUA_1G04590"
FT                   /product="Transcriptional regulator Ngg1, putative "
FT                   /protein_id="EAL88170.1"
FT                   /db_xref="HOGENOM:HBG051550"
FT                   /db_xref="HOGENOM:HBG329884"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniParc:UPI000051E810"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW2"
FT                   /transl_table=1
FT                   /translation="MPGANKGKGKGREVRPSRSRNTTPNSSFSAGATSAQASYLDVDVS
FT                   KLLIPGTIQYGEILDRMSGVGPIPDSKSLESLMEHLKTLSQLAEARVDACDAGIRELSQ
FT                   KRKEVVEDQETYDRETASKVKRDIDDDEEEPIRASKGGKLKKRRERGGSTKEDRPLAHG
FT                   AHDIARQDGAETKVEGAPNMDPANEPNLAASPASKKSKNMASEVTSPTCPSSMTSPKYT
FT                   ATAGEASVTAESPSEDDSDEHQPEPAPAIPQIQVFGPNPLKFDDPTIYHIREVTPDMTD
FT                   EEKKEIYCVNRFPKSDLSHMMAGVPPDKDFSNAKPTNQVSANTFLSYIEPYVRPLTEED
FT                   IAFLKEKGDRTTPFIMPPRGKKHYTEIWAEEDGLMNVDQANGDRERLPLNQGRGSIDQV
FT                   TDETVETDKVSVGPLVSRLYSLLRYEHRADPDENSTTGAANGEPSTSNFFNGDSMDIDQ
FT                   PAGESDTKPLPSATSFPDASPSGFKVPAAKLDHAQLDERLKAELRHIGFLGEDDNPDYD
FT                   AHYDDDIAQRLRLLQSELKKQMVTNNARKARLLEIARERMAYQEYTTIHDDLDSQVQQA
FT                   YLKRTRTLGKSKKGSQAKHRPGGAGGGSHVASGAGVSRPAIGDVARTLMDRRKRWEECI
FT                   GPIFKDSKTSVPGKGETIFDPAVMAEYEKAELEGWDEEQE"
FT   CDS_pept        join(1304122..1304138,1304531..1304607,1304711..1305244,
FT                   1305325..1306025)
FT                   /codon_start=1
FT                   /gene_family="HOG000211301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271369"
FT                   /orf_name="AFUA_1G04600"
FT                   /product="RING finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL88171.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051551"
FT                   /db_xref="HOGENOM:HBG329883"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000051EEE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW1"
FT                   /transl_table=1
FT                   /translation="MIVDFGRPIANHGSDFFRRIWESNECNSSTQLLDGTIQTLSTQNA
FT                   PDKGPVRGLLFVPTLNSQDPCTNATASLVPSNSTRHSHVAPLNFPNIGLAPWVSIECTQ
FT                   SFLNASQQQGVKALIFFLPSTNDSKPPAPEDSIWDLGDDGAWKRQNNYPVYAIPGPAGE
FT                   TLMQQLSWYSDNATLVGFDTDSNLNESSALAQDQHGIVRLFALIDYAEDRRNMPSLWGF
FT                   ILAILGMVLVLSIIILLCYQFVQKRRRLALERRISAGETDTENFGLHHIRVSREVLDQI
FT                   PTYVYSAVNIPSKVSLRSSPSQTQITLARADDASSIRSVDPKEPRLVYKETEMQASSST
FT                   IRLPETAITCQSSRPPSARECSDSASRSQPTCAICLDDFVSGITIVRELPCGHIFHPSC
FT                   IDVSLTQISSLCPLCKKSVLPAEYYTTPADDMGVHRDYVVTEH"
FT   CDS_pept        complement(1306488..1307405)
FT                   /codon_start=1
FT                   /gene_family="HOG000211290" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271370"
FT                   /orf_name="AFUA_1G04610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88172.1"
FT                   /db_xref="HOGENOM:HBG051552"
FT                   /db_xref="HOGENOM:HBG329882"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR010414"
FT                   /db_xref="UniParc:UPI0000520201"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJW0"
FT                   /transl_table=1
FT                   /translation="MVKPLTFKGDKPKKRKHREIAATESKFGADSGTTARTPAEESQHL
FT                   EDSAEDQSWVSADTPSDIAGPVVLVLPSDPPTCIASDANGKVFASELENLIEGDAATAE
FT                   PHDVRQVWVATRVAGTESLSFKGHHGKYAFLSTTIPQRTRERMLTNCWDRYLSCDTYGI
FT                   LSASASAISHYESFLALPSTDIPGTFALQTGGGDKEAFVCVREASSSSKASGRVIEVRG
FT                   DASSLGFETTLRVRMQARFKPRIKANKETKAREKISRKELEGIVGRRLEEHEVKRLKRA
FT                   RREGTFHEEVLDVRVKGKHDKFAW"
FT   CDS_pept        join(complement(1309186..1309293),
FT                   complement(1309031..1309115),complement(1308778..1308978),
FT                   complement(1308572..1308717),complement(1308205..1308517),
FT                   complement(1307958..1308151))
FT                   /codon_start=1
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271371"
FT                   /orf_name="AFUA_1G04620"
FT                   /product="Alcohol dehydrogenase, zinc-containing, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88173.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F402"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV9"
FT                   /transl_table=1
FT                   /translation="MGSNLPQTMKALRYEKPEVHSVVQVPLPTLRENDVLIKVKACGVC
FT                   GTDLHIHEGEFIAKFPLVPGHETVGIVAAVGSKVKGFEIGERVVADNSELCGECFYCRR
FT                   GDELFCEHFEAHGVTMNGGFAEYCAYPAKRVFKIKNLSDVDATLLEPASCAAHGLDKIA
FT                   PKMGSSVLLFGAGPTGLILAQMLRLNGGCKVTVVAPEGLKMDLAKNLGAGDEYVALSRK
FT                   DPSAQFEKLKSDNPYGFDIVVEATGNLNILNDSINYVRRGGKLVVYGVYANKDRVSWPP
FT                   AKIFGDEINIVGSFSEVYKFPAAIDYLDTGKVKVNGIVNKVFKIEEWEQCLESMRNKSA
FT                   IKAAIVFD"
FT   CDS_pept        join(1309470..1309613,1309672..1309857)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209504"
FT                   /orf_name="AFUA_1G04630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88174.1"
FT                   /db_xref="HOGENOM:HBG051554"
FT                   /db_xref="UniParc:UPI0000520913"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV8"
FT                   /transl_table=1
FT                   /translation="MRKKREDERRKDKPTYYFKGPESQTVKEGNRGGTAKANLRHAFSG
FT                   ANEAKHQTVLCIGISHRRKLALDSGHYAPSQWVAPSPLSGDVLVPPTRIPEATGKKKVT
FT                   KVNGF"
FT   CDS_pept        join(complement(1314253..1314799),
FT                   complement(1312063..1314201),complement(1311090..1312009))
FT                   /codon_start=1
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752772"
FT                   /orf_name="AFUA_1G04640"
FT                   /product="Ubiquitin-protein ligase (Hul4), putative "
FT                   /EC_number="6.3.2.-"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88175.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG051555"
FT                   /db_xref="HOGENOM:HBG329881"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000520432"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV7"
FT                   /transl_table=1
FT                   /translation="MPSRSAYNQPLPPTLNSSTVYPNAALLSSSAERSAQRHIHHDVPI
FT                   LPTMTGNPATSPPHHRGHSRSISHPFPSSFGGRRRNPNPGFIDSDSDDDDIEVTHLPDV
FT                   LSSSPRKGSSRPLPGGESTSTGKCMTCNSTVRWPRGLKVFRCTECLTVNDLEPYTSKDS
FT                   GGQGISGKDGMTGLSIPRKAVPLSVERTRSIIDNCVSSYLRRLLDAPMPHGLTPGNRSE
FT                   KPLVMGQDENRAHTHDHGSGLLSEPRVDARARSSSASSKPGKPNWFNGASNPLKPTASS
FT                   LAPHADVRSPRLRSRNNSDVQVPPKDERLPRQVGMPSERDIKDRPSHPYIFKPLEEYIL
FT                   ASFKGCDSLNASFSTAQPPLLAENASPDHSAPKPKMESNEALSHAHPAFEIDAKTLLIG
FT                   DLAENSSWWMNDGDPNYGLGHSHSKGKISNPSKAVTSRSPRINWSQLAEWYHLIMTAGS
FT                   SWVERWTAMRPVDERGQEGHGWSKLWDSVDMRAIERDITESRLHLHRTFLKATENLVKR
FT                   PRRPLHKPEEIRFLLILLVNPLIYPSSPSSPHVNLTQSQGGRRPSHPKESRERIPLRDA
FT                   RPSPKEQLGPSAPCSGPPGHHFGIVKRILGLMAHLPNDCHHYLVSWFSRLPTGQFERLV
FT                   DLVGSFVTYRLSRQQGRKRSEAIENDNSLVPSFSSAAGNTPAELHAAINGRGPSKPAKD
FT                   KRIKPVVYGDDWQIRAAARVMSLLFTANNTSAARKPDAAFGQEAGSLANRAAANRRGHK
FT                   VPISAFYNTLLDYSDLVADFEAWESKMAKFSFCQYPYFLSIWAKIHIMEHDARRQMEVK
FT                   AREAFFNSILSRKAISQYLVLKVRRDCLVDDSLRSVSEVVGSNQEEIKKGLRIEFVGEE
FT                   GVDAGGLRKEWFLLLVREIFDPHHGLFLYDEDSRFCYFNPYCFESSEQFFLVGVLLGLA
FT                   IYNSTILDIALPPFAFKKLLAAAPQTSGPQPSSARSNYRCTLDDLAEYRPALAKGLRAL
FT                   LEFDGDVADTFCYDFVAHVDRYGEAVAVPLCPGGETRPVTNANRREFVDLYVHYMLDTA
FT                   VTRQFEPFKRGFFTVCGGNALSLFRPEEIELLVRGSDEALDVASLRAVATYDNWSHPRP
FT                   ENIPVVRWFWEFFENTDPQAQRKILSFITGSDRIPAMGATSLTIRLACLGDDASRYPIA
FT                   RTCFNTLGLYRYPTREKLERMLWEAVGNSEGFGLK"
FT   mobile_element  complement(1315368..1316909)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(complement(1318816..1318902),
FT                   complement(1318591..1318677),complement(1318382..1318538),
FT                   complement(1318087..1318313),complement(1317870..1318010))
FT                   /codon_start=1
FT                   /gene_family="HOG000229584" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904932"
FT                   /orf_name="AFUA_1G04660"
FT                   /product="60S ribosomal protein L15 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88177.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG129246"
FT                   /db_xref="HOGENOM:HBG577798"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="UniParc:UPI000051EC8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV5"
FT                   /transl_table=1
FT                   /translation="MGALKYVEEIQKKKQSDVIRFLLRVRCWEIANFVTNLAFLSRRRM
FT                   MWMWHTRQVIFGLLRQLNAIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPV
FT                   PKGATYGKPTNMGVNQLKYQRALRATAEERVGRRCANLRVLNSYWINQDSTYKYYEVIL
FT                   VDPQHKAIRRDPRINWICNAVHKHRESRGLTATGKKSRGINKGHRYNNTRAGRRHTWKI
FT                   HNTQSYWRYR"
FT   CDS_pept        join(complement(1320533..1322670),
FT                   complement(1319974..1320481))
FT                   /codon_start=1
FT                   /gene_family="HOG000211279" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058207"
FT                   /orf_name="AFUA_1G04670"
FT                   /product="PSP1 domain protein"
FT                   /protein_id="EAL88178.1"
FT                   /db_xref="HOGENOM:HBG051556"
FT                   /db_xref="HOGENOM:HBG329880"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniParc:UPI000051FB29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV4"
FT                   /transl_table=1
FT                   /translation="MATSSEKSTQESKPADPPAVSNASVRLEKTHPGVRRSTPDSEALA
FT                   SSDDDVDHSHLQSTSAAVSAPKPTRRTSWLNEIPLNMPRKVSLTTGSLISGTGASNPTS
FT                   PATDHTGWPSGTSPGLSSPMNWNHVGNSSFTWGTGIWNSESRKEPPPRLSEIVPSPTMS
FT                   NASAANNYFSDELLSPTARTTSGESAIPFSIPLHPTPKTYRSQSYSVGQMDPEYLNTMA
FT                   NKSAAPFSGGRVRNAGQYSALQHRSSRPSLLGELGHDPATLGRVCEDDDDGGSGNSSDG
FT                   SLNAYSANQARTIEQLSRENAILRQAAGQLDNRLRDRAMSSASTASGYAVGSNLRNLHR
FT                   IRGTVPEETDLAVEDLDEVGDMTGYSNIHSSLRRRFSEHSGNLEKQLPSTLNPLENRAL
FT                   ESIRKANWQTSLGFGSLADIPQSRRHSFADIPIRHASVSGDSQVATTSRAGMGDREDHL
FT                   ANISDSSLSNAQSQNREYHRLHMASRPEEHEMEMEYLRARQFAESYFARDQALRVAEGP
FT                   SAVPTSLHQAYTMPNAYGRHQSGLAHGHQNQLLYIVTFKCHRADVFYIQEDTGLQVKPG
FT                   DLVIVEADRGTDLGTIQHANVSLQRARELKQQYAEEHYKWLMMFSRQGQNGTANVTGSV
FT                   PALSGRSTIGGMGPHGPHGVQDLAGDIKPKLIKRLAQNHEILTLRDKEGNEAKAKRVCQ
FT                   QKVAEHRLNMEILDAEFQMDWKKLTFYYFADSYINFNSLVTDLFKIYKTRIWMSAINPA
FT                   SFVTPPTAGLPPPGGVANADGRVYGAARDGMDVGRDTVGNKIGPLRSTYIDPYQSFPHG
FT                   ARQPESGLGELAPSADPFSPYPPNAYGGTLDTSYVDYAAHSPGVGSGPSRVHNAPNDWT
FT                   TRFQGLSLGS"
FT   CDS_pept        join(complement(1329469..1329756),
FT                   complement(1328861..1329397),complement(1328649..1328804))
FT                   /codon_start=1
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271372"
FT                   /orf_name="AFUA_1G04680"
FT                   /product="NifU-related protein"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="EAL88179.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG156732"
FT                   /db_xref="HOGENOM:HBG294208"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="UniParc:UPI00005208FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV3"
FT                   /transl_table=1
FT                   /translation="MSVSRTSTTLLRRALLDSRFSPQSATIQSQGIRPALGSYNSIHNS
FT                   ARLPAITASGTRRRPTLRPHQRPAAQARVNGPLPVTRRTIFIQTENTPNPDALKFIPNH
FT                   RVLPEGFPTSFLEYLSPRSTLAPPHPSPLAANLFNVDGVTSVFYGPDFITVNKSSDANW
FT                   AHIKPEVFSLITQAVTSGEAIVNTVEKTGEHAQESGEQESLSFSEEDDEVVSMIKELLE
FT                   TRIRPAIQEDGGDIELRGFENGIVKLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVQG
FT                   VEQVLDEEEEISMHEFAKFEEKLRQQKGPQATASTGGKGTLDTAP"
FT   CDS_pept        join(1330615..1330685,1330742..1331243)
FT                   /codon_start=1
FT                   /gene_family="HOG000211268" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271373"
FT                   /orf_name="AFUA_1G04690"
FT                   /product="HIT finger domain protein, putative "
FT                   /protein_id="EAL88180.1"
FT                   /db_xref="HOGENOM:HBG051557"
FT                   /db_xref="HOGENOM:HBG329876"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI000051E7F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV2"
FT                   /transl_table=1
FT                   /translation="MPGTCEVCVSEPSKYKCPTCGLLSCSLACTQSHKIYCAPKPQGPE
FT                   PKSATDTTQTTPNVHGEQEVTESSNALANRNAYSVEALASSPQVKDLLAQSPQLRDCLR
FT                   DIYKITLEEEWIEQGPPGRSRPYHRGRGGYRNRGSWTREKGFNRGLGKLRKLRERCEGG
FT                   SETGKHAEAFMNFMALVNGENQHQQPA"
FT   CDS_pept        join(1333784..1333891,1333965..1334292,1334377..1334562,
FT                   1334927..1336440,1336492..1336920,1336969..1337052)
FT                   /codon_start=1
FT                   /gene_family="HOG000211257" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271374"
FT                   /orf_name="AFUA_1G04700"
FT                   /product="Ras guanyl-nucleotide exchange factor RasGEF,
FT                   putative"
FT                   /function="GTP binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88181.2"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG051558"
FT                   /db_xref="HOGENOM:HBG323886"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="UniParc:UPI0000F51AA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV1"
FT                   /transl_table=1
FT                   /translation="MAADTRSKVESPLIEEEEHVLSRSDTSLLPIRDGNGISQKPNFPH
FT                   LTIAVVGQEKAGKSTFIRSALDMKNPLSSRSTTKKMSLDGTVYLVRFVEISTKEITVGS
FT                   NGELAWPRIGNDVTSPKVIDGVLVLHDVTQPESLSELTGLLDTLSASSLPFILIASKCD
FT                   VRRHDRFLEPVLSNYEIHRMSPESPQSQKAYIAKLLRFVVSKKNEFTDHSPSQSEQGTS
FT                   GDAPYRPGSQDRRHTRANSETPTAFFNGAAGGSNSTSVFESGVDGYGDDLYPVDRTDSS
FT                   NLASNSHSPRYARSNSFPVRPHTPPSGATLNLHRQSASGESSPAKDRNRQHRLHSAWRN
FT                   SGGSDAFNSFLETEDEIDVSCSAPSSPGGSSKDKSTSDGSSNETGYTFDELVDRLVAQP
FT                   MSKQDSKFSSIFLCLYRKFAAPASLLNALIHRFERNEKNITDQLARIADQLRLLNVMAQ
FT                   WVSEYPGDLAYPKTRKRILDFVSTLEKSHFYMFAAKEIGSYLEVNTEDDDVGWPFKDGD
FT                   VEEFEDQEALYVNSGWSSPSMFLGGPTSGEDEGEEEEEDPIYNMSALDLSEGPPEQSTR
FT                   LSGTSTVDKPGTISSQSFMSLCIDAAQRESERLELTPTVPLTKIQWRQFMEIPDEDFAR
FT                   ELTRIDWIMFNSFRPRDLVRHVSISGPDKDKIQSLKHVNRMIKQFNHVAFFVASMILLR
FT                   DKPKHRARALEKFMNIAQKLRRLNNYNSLGALIAGINGTPVHRLSQTRDLVPVQVQKDF
FT                   MRLVILMGTQKSHFAYRLAWDNSFSERIPFLPLHRRDLVSAEEGNKTFVGDNRSRINWK
FT                   KFEVMGEVVLGIQRSQKTPYAHIHRYDDVQRLILDIKLSGDEEDLYARSVQVEPSTGID
FT                   TGRKKFGWLRS"
FT   CDS_pept        complement(1338318..1339580)
FT                   /codon_start=1
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904933"
FT                   /orf_name="AFUA_1G04710"
FT                   /product="PP-loop ATPase superfamily protein, putative "
FT                   /protein_id="EAL88182.1"
FT                   /db_xref="HOGENOM:HBG023943"
FT                   /db_xref="HOGENOM:HBG541846"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000051F659"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJV0"
FT                   /transl_table=1
FT                   /translation="MPPTLCFNCKEARAVIIRPKNRHKLCRACFLEVFETEVHETITSS
FT                   SLFYPGERVAIGASGGKDSTVLASVLKTLNERYNYGLELCLLSIDEGIKGYRDDSLETV
FT                   KRNAVQYDMPLEIVGYSELYGWTMDQVVEQVGKKGNCTYCGVFRRQALDRGAARLGIKH
FT                   VVTGHNADDVAETVMMNLLRGDLPRLSRGTSIVTDSAASDIKRSKPLKYAYEKEIVLYA
FT                   HHKKLDYFSTECIYSPEAFRGSARTLIKDLEKIRPSSILDIVKSGEDMAALVPFEVSSS
FT                   GKKCGGTSVATATAEDDESAGGCGSQNGRSSGGEIAEMEKKLAEDDAAQLRETEIKLPV
FT                   APRRKSGKVNNPRAIKSQTMGNCERCGYISSQKICKACMLLDGLNKNRPKTAIEVAVGI
FT                   EEEESSSTLMRQMERVQLTTG"
FT   CDS_pept        join(complement(1340389..1340743),
FT                   complement(1340296..1340322),complement(1339902..1340239))
FT                   /codon_start=1
FT                   /gene_family="HOG000211245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752773"
FT                   /orf_name="AFUA_1G04720"
FT                   /product="C-8 sterol isomerase (Erg-1), putative "
FT                   /function="C-8 sterol isomerase activity"
FT                   /biological_process="ergosterol biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="EAL88183.1"
FT                   /db_xref="GO:0000247"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006696"
FT                   /db_xref="HOGENOM:HBG051559"
FT                   /db_xref="HOGENOM:HBG717428"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="UniParc:UPI000052040B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU9"
FT                   /transl_table=1
FT                   /translation="MPSKSSSPQSNSTRKNSCGCCCFSVRKFGFLAVFVAIFAALYSYL
FT                   DARLEQFYIFNPEHLHDLSQRAIQAHGNDTRAMVDFIVAELDQKIPGNHLNKNEEWIFN
FT                   NAGGAMGAMYIIHASITEYLIIFGTAIGTEGHTGRHTADDYFNILQGTQVAFVPGTFEP
FT                   EVYPPGTVHHLRRGEVKQYKMEQSCFALEYARGWIPPMLFFGYADTFTSTLDFPTLWAT
FT                   TRVTGREMITNLLRRKF"
FT   CDS_pept        join(1342452..1342768,1342819..1343218)
FT                   /codon_start=1
FT                   /gene_family="HOG000181257" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058208"
FT                   /gene_name="xgeA"
FT                   /orf_name="AFUA_1G04730"
FT                   /product="Probable xyloglucan-specific endo-beta-1,4-
FT                   glucanase A"
FT                   /EC_number="3.2.1.151"
FT                   /function="cellulase activity"
FT                   /function="xyloglucan-specific endo-beta-1,4-glucanase
FT                   activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL88184.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="GO:0033946"
FT                   /db_xref="HOGENOM:HBG095917"
FT                   /db_xref="HOGENOM:HBG344761"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="UniParc:UPI000051E7FF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJU8"
FT                   /transl_table=1
FT                   /translation="MKLSLSVALSLAASTAQAATQFCDQWGSVTEGNYILYNNLWGQAQ
FT                   ATSGSQCTTFESLSGNTIVWNTKWSWSGGQGQVKSFANAALQFTPKKLSSVKSIDSTWK
FT                   WNYSGSNIVADVAYDMFLSTSPGGDHNYEIMVWLGALGGAGPISSTGSPIATPTVAGIK
FT                   FNLYLGPNGSMQVYSFVAQSTTNSFSGDMRDFFTYLESNQGLSSDLYLVDVQAGTEPFS
FT                   GSNAVFTVSDYSVSVA"
FT   sig_peptide     1342452..1342505
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJU8 "
FT   mat_peptide     join(1342506..1342768,1342819..1343215)
FT                   /product="Probable xyloglucan-specific endo-beta-1,4-
FT                   glucanase A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJU8 "
FT   CDS_pept        join(1344615..1344621,1344817..1345127)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752774"
FT                   /orf_name="AFUA_1G04740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88185.1"
FT                   /db_xref="HOGENOM:HBG051561"
FT                   /db_xref="UniParc:UPI000051FFC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU7"
FT                   /transl_table=1
FT                   /translation="MLWLVPNHRVQSNRAPKGTVPTLTLEESINQRQSTSHWNPAFEMI
FT                   LDFIRSAPVLLSPIKVGMTGQVFLVAYQLSLWMLLLAEMSVLAAVQPPCTTTLIANIPT
FT                   H"
FT   CDS_pept        1346031..1347314
FT                   /codon_start=1
FT                   /gene_family="HOG000211223" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752775"
FT                   /orf_name="AFUA_1G04750"
FT                   /product="Cyclin (Pcl1), putative "
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="EAL88186.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG051562"
FT                   /db_xref="HOGENOM:HBG329874"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="UniParc:UPI0000520433"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU6"
FT                   /transl_table=1
FT                   /translation="MDVPVALNRAALNDFVTRPVSREMVAYLAQQASLVIRCESHVTSA
FT                   VSRHGHPTPPSTPPLDGLPPLPSLETFIISLVTRSQVQVPTLMTSLVYLARLRARLPPV
FT                   AKGMRCTVHRIFLASLILAAKNLNDSSPKNKHWARYTAVKGYDGFSFSLPEVNLMERQL
FT                   LFLLDWDTRVTEDDLFLHLEPFLAPIRQRFEAQEREAELRRQQQQQQQHYREWRRLHAS
FT                   AELLATRLRRQKVEGRADARRSMVEGGSPRTRLSNHVSSYSLGGSPRSVEGERYTPYNP
FT                   HHHQRQRMSPYRSGRSISPPSVNDVPCLSRAETFNSLSSRSSSVAPSSRGTPASISTSC
FT                   SSISMDEVVVADATTSPSTSSLGYSYVNIPAIQPGTKQSVNDFHEHRHHQQPNKKMRMA
FT                   SNNGSTGFVARFLASAAGYHMGGRHGRV"
FT   CDS_pept        join(1349257..1349320,1349402..1349554,1349607..1350460)
FT                   /codon_start=1
FT                   /gene_family="HOG000211212" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058209"
FT                   /orf_name="AFUA_1G04760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88187.1"
FT                   /db_xref="HOGENOM:HBG051563"
FT                   /db_xref="HOGENOM:HBG398232"
FT                   /db_xref="UniParc:UPI000051F8A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU5"
FT                   /transl_table=1
FT                   /translation="MGATDVPQAQAVTVSLQELVNGTVSFETLTEAFGPSSLGIIVVKD
FT                   LDPAFPRLRAQVLSNASYLAALPNNELESLTSPAAKYLVGWSCGKETLRSGHFDTLKGS
FT                   YYVNCAFYQNPDLQGAPADNFHDLSEYTAPNIWPPADRLPTFRRSLEELCTLIIDTAAL
FT                   VARACDRYALANIDGYKEGYLEHVVKTSLTTKARLLHYFPTDPAAAANAEAEDDDDWCA
FT                   THLDHGCLTGLTSAMFVDEAANPPSLTDASTPLAELPQSPDPKAGLYIQSRTGQVVKVN
FT                   IPNDCLAFQTGEALQLITRGKFRAVPHFVKGARPSGRARIARNTLAVFTQPNLEEEVEP
FT                   GKTFAEFAREVVSRTY"
FT   CDS_pept        join(complement(1353086..1353278),
FT                   complement(1352857..1352925),complement(1352473..1352733),
FT                   complement(1350644..1352208))
FT                   /codon_start=1
FT                   /gene_family="HOG000211201" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058210"
FT                   /orf_name="AFUA_1G04770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88188.1"
FT                   /db_xref="HOGENOM:HBG051564"
FT                   /db_xref="HOGENOM:HBG329894"
FT                   /db_xref="InterPro:IPR018839"
FT                   /db_xref="UniParc:UPI000051F15E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU4"
FT                   /transl_table=1
FT                   /translation="MSVSQHSQTSEEDAETITIPIDRSFSDGDPSTWPTEPRFGMPDDT
FT                   WYREKLAIMWLKETGAYEEVCINVCVISLPDWTGRERTVWIHYSLPEGYAVFDRPRWTN
FT                   PDIVSTATELWDLYTDRPQRDRFLWGHPLGQYFPSTIQFFPHFLYLMKGGKEPCPCILC
FT                   EKLAKKNQRIKVKLKDRGEIDEPISEPLSMDWKSERPGLGEYLQKLRMQPSYVPRAGEI
FT                   VLWVPNFEGELAWNPEHARVEMYDPTVDRFIGVPEWRAGIVGQVPEEDTVLQDIVETAN
FT                   KEWEVNYSGFRVETFPDPNSADKSYSLQYKYVHLKCIKPFNGYELFLQNMPRDELHPSI
FT                   EYAMTVMSSFSLLEKFHFRGRWPNASIYCMGIFIGAELLIVGDAVRLKPVGYSLSSGQK
FT                   AVTDVMVIDEIRLDLIQCVDDIKSDQLAERYQVRLGGKVYTNNRQRAVIDNSMQPPKPL
FT                   SPEEVLSVFQYIGMSGYGDWYSLNGGKTVDISQGMVIGRCYEPDAMRLLFGSLSLGRDL
FT                   HGVLSGRQYSRQADERIPEGKDWFWGDFRTQTLAVETLNGEDVGHYSEIRDVKMWRANL
FT                   KVIEGRATAADLREAKIPGELGRPSHKSRSAFAEVRKTSKLVSTGLGAVITDVSNNSSS
FT                   ADESNAQTRMNTEDEGEEESPEDEEDFTLRLEDLRGGTEETEGGDYVPGNDGHTAKRPK
FT                   T"
FT   CDS_pept        complement(1354133..1356622)
FT                   /codon_start=1
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904934"
FT                   /orf_name="AFUA_1G04780"
FT                   /product="Peroxisomal ABC transporter (PXA1), putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL88189.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000051F881"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU3"
FT                   /transl_table=1
FT                   /translation="MAAQSTLRAREDPLVALYTHYVNLIRTRVKQSSKTSRLIATLALL
FT                   FSIIGSGYGGYNWYQRKAKERAQGRRLLRRNSGIRGKDGSRTIYVPYKDSMTSKVRIHP
FT                   TKPTTFDAHRRLFLNPPASARGNDEESGSMIPPPTTKPGLNLAFLHQFLSLWSIMVPRW
FT                   SSKETGLLVGHGVFLLLRTYLSLLIARLDGAIVRDLVAGKGRAFVWGLVKWCGIGTLAS
FT                   YTNAMIKFLQSKVSIAFRTRLTRYIHDLYVADNNYYKLLNLDGGIGQGADQFITQDLTL
FT                   FCSAAAALYSTMGKPLVDLFVFNYQLYCSLGPLALSGILTGYFSTAVILRKLSPPFGKL
FT                   KAVEGKKEGDFRGLHSRLLANAEEISFYGGADIERVFLLRSFKDLQRWMEGIYSLKIRY
FT                   NMLEDVILKYAWSAFGYLITSLPVFLPAWGGAGGALELANAYEETGRERGRMKEFITNK
FT                   RLMLSLADAGGRMMYSIKDISELAGYTSRVYTLISALHRVHANAYYPPRGSHAELYSLA
FT                   DAQGTIHNGFDGVRLEQVPIVAPALHPRGGDELIESLSFIVHSGEHLLISGPNGVGKSA
FT                   IARIVAGLWPVYRGLVSRPRGFGLDGIMFLPQRPYLSVGTLRDQVIYPHTEIDMREAGR
FT                   TDAELQKILEDARLGYLPAREGGWNARKEWKDVLSGGEKQRMAMARLFYHEPRYAFLDE
FT                   GTSAVSSDVEGVLYQQAKDRGITLITISTRASLKKYHTFSLTLGLGAEGEQWEFEKIGT
FT                   EKEKLGVEKEIQELRKRLDKIDEWKRRREEIDKELHKVWAEEGELAPPPYELGNEEAVA
FT                   EVSNEATEEAHVDKTQE"
FT   CDS_pept        join(1359703..1359802,1359895..1361066,1361131..1361280,
FT                   1361336..1361434,1361499..1361711)
FT                   /codon_start=1
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271375"
FT                   /orf_name="AFUA_1G04790"
FT                   /product="General stress response phosphoprotein
FT                   phosphatase Psr1/2, putative"
FT                   /function="phosphatase activity"
FT                   /protein_id="EAL88190.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG051565"
FT                   /db_xref="HOGENOM:HBG329897"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051E800"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU2"
FT                   /transl_table=1
FT                   /translation="MLGGSSERGSPPNTSSKPTGEVPMPANAGNTDSGPGSSLQDNSKD
FT                   SDASPQPKPVEPTEPASAPVPSTQALGPNAPTNTNDPSKQQHLLVPSQSRSSSKADGQS
FT                   TLDNRQDAAHDDSENTLRGSRRSILKGRRDRSRGSSKRSWRPSQGPTGTDEQKTATDSE
FT                   ARDNPKPETKPKVTLRLFAFLSCCSSSGVDPDDSAIPPKKTTRRPSAPATQPTPEKADL
FT                   NANHSNRTESEEAKLFGEEKPNLTVTSHQPSREEEKPARTSEEGAQLDANLSSSDKVES
FT                   SHEPASQYGQVDTTRTGAPQNAQIPVIVATETEKANDLEIKPEEPMGSLPLPAIEDSST
FT                   STEAQPTSSAVEHNDVKSSHEEETTLPAKIPPPPPPQVPMGKQIQIATPERPQQWLLPP
FT                   PLPHLRNRKCLVLDLDETLVHSSFKVLERADFTIPVEIEGQYHNIYVIKRPGVDQFMKR
FT                   VGELYEVVVFTASVSKYGDPLLDQLDIHNVVHHRLFRDSCYNHQGNYVKDLSQVGRDLR
FT                   ETIIIDNSPTSYIFHPQHAIPISSWFSDAHDNELLDLIPVLEDLAGAQVKDVSLVLDVT
FT                   M"
FT   CDS_pept        join(1363093..1363228,1363347..1363378,1363436..1363507,
FT                   1363566..1363862,1363913..1363987,1364036..1364494)
FT                   /codon_start=1
FT                   /gene_family="HOG000211189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271376"
FT                   /orf_name="AFUA_1G04800"
FT                   /product="Protein phosphatase PP1 regulatory subunit Sds22,
FT                   putative"
FT                   /protein_id="EAL88191.1"
FT                   /db_xref="HOGENOM:HBG526095"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI000051E592"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU1"
FT                   /transl_table=1
FT                   /translation="MKDSKGWDGNLRVEPKATITNPEAVEDPNYSDSDAPPVEEIEADE
FT                   DLLEGEDPETQEIDLVHCRIASIPALRLERFHKLQRICLRQNQITRIDFPSEIAPTLLE
FT                   LDLYDNLISHVKGLDEFRDLTSLDLSFNKIKHIKNISHLVNLTDLYFVQNRISKIEGLE
FT                   GLTKLRNLELGANRIREIENLDTLASLEELWLGKNKITEMKNLDALSNLRIISIQSNRL
FT                   TSITGLSSLKNLEELYLSHNAITDLSGLESNTSLRVLDFSNNKISKLEHISHLKNLEEL
FT                   WASNNELSSFEEVERELRDKEKLQTVYFEGNPLQTKGPAVYRNKVRLALPQIMQIDASK
FT                   FSFFAGRALGWVADDI"
FT   CDS_pept        join(complement(1365560..1365700),
FT                   complement(1364929..1365504))
FT                   /codon_start=1
FT                   /gene_family="HOG000211168" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058211"
FT                   /orf_name="AFUA_1G04810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88192.1"
FT                   /db_xref="HOGENOM:HBG051566"
FT                   /db_xref="HOGENOM:HBG329899"
FT                   /db_xref="UniParc:UPI00005201E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJU0"
FT                   /transl_table=1
FT                   /translation="MPPPAGRLASQAIHIVANPSPISLAESKLILSALQKFGEVVTFRN
FT                   LKYDTTNTSKAPTRPILAIFDSPDAAKQALSSSPLTIRLPNTDPDHTHTHNHDSQFEPS
FT                   ASRTGRPDSRSKPNFLRCEILPSRHNHESALQRNPFHGTFRVYDSTYQYRDLVKTGIPL
FT                   KELADETMSRKRHEPFRVKRQMMKENKRLGATSLMRLYREGLGENILEKGKEGNVQEEA
FT                   ESGNRAEAGVDRLGER"
FT   CDS_pept        join(complement(1367013..1367157),
FT                   complement(1366160..1366947),complement(1366046..1366060))
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904935"
FT                   /gene_name="xyl1"
FT                   /orf_name="AFUA_1G04820"
FT                   /product="Probable NAD(P)H-dependent D-xylose reductase
FT                   xyl1"
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="D-xylose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL88193.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0042732"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000051E57B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJT9"
FT                   /transl_table=1
FT                   /translation="MTTPSIKLNSGYDMPLVGFGLWKVNKETCADQIYHAIKAGYRLFD
FT                   GACDYGNEVEAGKGVARAIQEGIVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGLD
FT                   YFDLFIVHFPIALKYVDPAVRYPPGWLSENNKLEFSNASIQETWTAMESLVDKKLARSI
FT                   GVSNFSAQLLMDLLRYARIRPATLQIEHHPYLTQERLVTYAQKEGIAVTAYSSFGPLSF
FT                   VELDLKDAHETPKLFDHDVIKGIAQKHGRTPAQVLLRWATQRNIAVIPKSNDPTRLAQN
FT                   LDVTGWDLEASEIEAISALNRNLRFNDPLAIPVV"
FT   CDS_pept        join(complement(1370157..1370598),
FT                   complement(1369923..1370099),complement(1368081..1369855))
FT                   /codon_start=1
FT                   /gene_family="HOG000211157" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16271377"
FT                   /gene_name="abaA"
FT                   /orf_name="AFUA_1G04830"
FT                   /product="Abacus"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88194.1"
FT                   /db_xref="EMBL:AAV36792.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG051568"
FT                   /db_xref="HOGENOM:HBG329900"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI00004542CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U9G5"
FT                   /transl_table=1
FT                   /translation="MATDWQPECIAPQHQSGLENIGHHTDRALQNTSGNVQSYSDAILH
FT                   GGMSGRDDHLQHLAYKYSHAPVHPQPMQTATTLHPHHILNARVQAKKLRRVQSLGPNHA
FT                   GARRGRSYLKSQKYLEYRARPRRDTGKDGEPVWSDELEDAFQQALEANPPMGRRKWSER
FT                   GKSYGRNELIAEYIYKVTGKKRTRKQVSSHLQVLDSFLKGDPDWERLVREQPADRSGNQ
FT                   HQPVGPKWRTSLDHPLPSHYGGHMHATYHDHLSPVQPYVGELPPPHYTLGSNMHERSTD
FT                   TIHGFNFDMWVSAPQQANQGDKAFHVYTCLQGDQYHPVAPPMPLENVRDWRTTFPHLNS
FT                   VMEELDGPLDCEIILLEASLKLMNDFPPPGSKLGIQLDIDFAPPGMTDATVLSQMDNWT
FT                   CSTYIYEDGNRLSKADHNLARPLSTKVKPPFESSWWAKLFTELTQDKQMAEKSGRHQNA
FT                   DDHIRQFFRSLSAVQEIRAISQNSRRVSQGSGHPGDCSKRMAILLWKFRQTLPDEVGLT
FT                   TWRKLIPPPDRTMMNSPKPATGIDLPPLSLDSILLKPQPPNVYQNPQGHDLLHQNGTSQ
FT                   PHWPLYPPPHESMSNMYHSTGSFDFLNSVSKAEDGLPDRTAVTSILDSFPAMPPQETSQ
FT                   PSSLNVSSGGPVMLNVHDMSLSHHNLAGYALSHDNHYVPSQQHGVSVHDSSNVLNNIFG
FT                   PGSQPMDEIGNSQSAWGPPIPSTTIPSDVGSNHYTHLPYHHHDHQTSASRESHPPNGFE
FT                   GLMGPDDLMDKIVGSMPDDPGMNGAGPDHASAAYADTNATEAVQ"
FT   CDS_pept        join(complement(1374234..1374461),
FT                   complement(1373362..1374120),complement(1372854..1373126),
FT                   complement(1371578..1372795))
FT                   /codon_start=1
FT                   /gene_family="HOG000211156" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058212"
FT                   /gene_name="mrd1"
FT                   /orf_name="AFUA_1G04840"
FT                   /product="Multiple RNA-binding domain-containing protein 1 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL88195.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG012874"
FT                   /db_xref="HOGENOM:HBG412223"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051F62D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJT7"
FT                   /transl_table=1
FT                   /translation="MENTRVFVSGLPPTFTNDQLRMHFSSRFQITDAHVLPKRRIGFVG
FT                   FKSSEAAQQAASYFNKTYVKMSKISVEIAKPIDSEPVKKAEKHRKGSTSNDSTAGKALK
FT                   RKRDGDNTQKDPQLQEYLSVIERPSKTKTWANGDDFLNTIQNQPATSELREEQRDDTSE
FT                   KVEEHSHKQRKKPRVDDVPKAAHDREPEPMVLDKTEEEHERANADGQVEAIPPTQEEAE
FT                   PVSDADWLRSKTSRLLGLLDEDEQAEFDSTAQRKPDPSSEPETVSKAGAQHSDDDKAAV
FT                   ESSVEEEEVDTNIEHIRLSSRLFVRNLPYDASESDLEPVFSKFGKIEEIHVAFDTRSTT
FT                   SKGFAYVQYIEPDAAVQAYKELDGKHFQGRLMHILPATAKKTYKIDEHELSKLPLKKQK
FT                   QIKRKLEASSSTFSWNSLYMNTDAVMSSVAERLGVSKADLLDPTSADAAVKQAHAETHV
FT                   IQETKAYFTANGVNLDAFKQRERGNTAILVKNFSYGVKVDDLRKLFEPYGQITRLLMPP
FT                   SGTIAIVEFARPDEAQKAFKGLAYRKVGDSILFLEKAPANLFDATTAPQTSVLETKAVS
FT                   QGFSTADTFAAEDGDEPVVTSTLFVKNLNFSTTNERFTEVFKPLDGFVSARIKTKPDPK
FT                   RPGKTLSMGFGFVDFRTKAQAQAALAAMDGYKLDQHELVVRASNKAMDAAEERRREDTA
FT                   KKIAARRTKIIIKNLPFQATKKDVRSLFGAYGQLRSVRVPKKFDRSARGFGFADFVSAR
FT                   EAENAMDALKNTHLLGRRLVLEFANEEAVDPEQEIEQIEKKVGEQLDRVKLQKLTGTGR
FT                   KKFTVGAQEDEEA"
FT   CDS_pept        join(1374762..1374792,1374849..1374871,1374924..1374957,
FT                   1375007..1375041,1375096..1375122,1375180..1375249,
FT                   1375299..1375363)
FT                   /codon_start=1
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752776"
FT                   /orf_name="AFUA_1G04850"
FT                   /product="Dynein light chain type 1, putative "
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="microtubule associated complex "
FT                   /protein_id="EAL88196.2"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005875"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG051569"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="UniParc:UPI0000EA5A5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT6"
FT                   /transl_table=1
FT                   /translation="MATEKKEKLEPQIKSVDMTEEMQQEAVEVATEAMEKYHIEKDIAQ
FT                   YIKREFDSRKGATWHCVVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ"
FT   CDS_pept        join(1376040..1376070,1376202..1376255,1376329..1376362,
FT                   1376420..1376444,1376503..1376535,1376585..1376625,
FT                   1376696..1376885)
FT                   /codon_start=1
FT                   /gene_family="HOG000076655" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271378"
FT                   /orf_name="AFUA_1G04860"
FT                   /product="Rhodopsin family protein "
FT                   /protein_id="EAL88197.2"
FT                   /db_xref="HOGENOM:HBG051570"
FT                   /db_xref="UniParc:UPI0000F51A3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT5"
FT                   /transl_table=1
FT                   /translation="MAICITFGTHEFTSMLEGYENVRAYCYNCQHWNGHCITRWPWFTI
FT                   CFIPCIPLSTHKYKEVTCYTCRFTQDLRDRPDITPATRPPQGIPPGPAPPPQAYYAAGA
FT                   TGGGYPPQGYPPPGQWQGQPQAPPPQNYNYK"
FT   CDS_pept        join(complement(1379496..1379617),
FT                   complement(1379222..1379394),complement(1378644..1379154),
FT                   complement(1378492..1378526),complement(1377814..1378432),
FT                   complement(1377184..1377757))
FT                   /codon_start=1
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209505"
FT                   /orf_name="AFUA_1G04870"
FT                   /product="Urea transporter (Dur3), putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL88198.2"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051317"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI0000F51A7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT4"
FT                   /transl_table=1
FT                   /translation="MSSEEVKFVAPLSQGFGYGIIIGLGFAFALVMIFITWALRRYQHE
FT                   VQTSEMFSTAGRSVKSGLVAAAVVSSWTWAATLLQSSAVAYQYGVSGPFFYASGACVQI
FT                   ILFATLAIELKRRAPNAHTFLEALRARYGTAVHLVFIVFCLMTNILVTAMLLTGGSAVL
FT                   TSLTGVHTAAACFLLPIGVVLYTLFGGIKATFITDYMHTVVIIVVIFIFAFSAYATNAE
FT                   LGSPGKVYDALVAASELHPVEGNAQGSYLTMRSKEGGIFWVINLVGITVFLDNGYYNKA
FT                   IAASPVHAFPGYVIGGLCWFAIPWLCATTMGISALALEGAQRISSDDVTAGLVLPFAAV
FT                   RLLGYSGAVCTTLMVFMAVTSAFSAQLIAVSSIVTYDVYQAYINPAAKGKRLVWVSHMS
FT                   CIVFALIMAAFATGLYYAGIGMGYLYLLMGVIISSAVFPGAMTLVWKQQNWIAAACSPV
FT                   LGLAVSLIAWLVTAKKEYGELTVASTGANYPMLAGNVAALLSPIIFSPVLTYLFGTQNY
FT                   DYESMRSIRKVDDTDVAAAAHVDIELIPGELDVRDAEAEEEEQRKLNKAALYSRTLTLG
FT                   MVVCFLLLWPLPMYGTSYIFSKKFFTGWVVVGLIWLFCTTFGVVIFPLWEGRQSIMRVV
FT                   RLMALDLTGKKPALVGQKSRVHKDNSSGVETPTEKMEPKTSI"
FT   tRNA            1380646..1380717
FT                   /gene_name="tRNA-Glu"
FT   tRNA            1380814..1380885
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        join(1383778..1383842,1383907..1384345,1384405..1384599,
FT                   1384652..1384942)
FT                   /codon_start=1
FT                   /gene_family="HOG000211110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209506"
FT                   /orf_name="AFUA_1G04880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88199.1"
FT                   /db_xref="HOGENOM:HBG051571"
FT                   /db_xref="HOGENOM:HBG329907"
FT                   /db_xref="UniParc:UPI000051F3F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT3"
FT                   /transl_table=1
FT                   /translation="MWTWSFAIVTFIQTVITLALECYIFANYQSQLKAKAEVVTASKTI
FT                   PIFLALYSFGFLYELVLVYDALRMKNTIQVIGLCLCNIGLLIYGAVQVQQVKEAVSILT
FT                   DNTAINEDVWGETEPFLIIIPCVVAMGTVLMMMVAWKLYDEFAWSIYKHISADLRMKRR
FT                   YLTYQIYVALLKFDFFFFLGFTVQFVVIVTDKADIEFSLTLAAIPVTILILVCAAIFVR
FT                   RESSIGMIIIILLYFAAMAYFLFKLVRMYQPETYKNYLPARRSLTFFAVITIALIIMTI
FT                   INACMCMHNFHKGLKPHINKRKSSKEAEKTTELSSNVAGAIPSRMMID"
FT   CDS_pept        join(1386063..1386423,1386485..1386519)
FT                   /codon_start=1
FT                   /gene_family="HOG000211109" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271379"
FT                   /orf_name="AFUA_1G04890"
FT                   /product="Translocon protein Sec61beta, putative "
FT                   /protein_id="EAL88200.1"
FT                   /db_xref="HOGENOM:HBG178092"
FT                   /db_xref="HOGENOM:HBG749385"
FT                   /db_xref="InterPro:IPR005609"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="UniParc:UPI000051F640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT2"
FT                   /transl_table=1
FT                   /translation="MHLLQASARAASPLTSGAESGPDTKSSGAGAGASATGSVNRPSSP
FT                   TPPGGPRAALRRRAAADHKESLRNARPSSTRAAGAGGSSGTMLKLYTDESPGLRVDPVV
FT                   VLVLSLGFIFSVVGLHVIAKITRKFSS"
FT   tRNA            complement(1387248..1387319)
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        join(complement(1389046..1389400),
FT                   complement(1388709..1388995),complement(1388632..1388649))
FT                   /codon_start=1
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271380"
FT                   /orf_name="AFUA_1G04900"
FT                   /product="Proliferating cell nuclear antigen "
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="EAL88201.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG049725"
FT                   /db_xref="HOGENOM:HBG749295"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI000051EA44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT1"
FT                   /transl_table=1
FT                   /translation="MDNSHVALVSMLLKAEGFSPYRCDRNIALGINLVSLTKVLRAAQN
FT                   EDILTLKADDSPDAVNLMFESAETDRISEYDIKLMDIDQEHLAIPETEYAATVEMPSAE
FT                   FQRICRDLNALSESVVIEATKEGVKFSCQGDIGSGSVTIRQHTSVDKPEQNVSIALSEP
FT                   VALTFSLKYLVNFCKATSLSSKVTLCLSQEVPLLVEYGLGSGHLRFYLAPKIGDEE"
FT   CDS_pept        join(complement(1392274..1392537),
FT                   complement(1391723..1392204),complement(1391205..1391683),
FT                   complement(1390479..1391143))
FT                   /codon_start=1
FT                   /gene_family="HOG000211077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209507"
FT                   /orf_name="AFUA_1G04910"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="EAL88202.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG051572"
FT                   /db_xref="HOGENOM:HBG329912"
FT                   /db_xref="UniParc:UPI000051FD6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJT0"
FT                   /transl_table=1
FT                   /translation="MSPWRFTHMFALVNDDIVGHSGEGEHDPDWPVQETKSEDDPFDSA
FT                   ASDFAPRGTSKFQERIRNKLPKPLELRSSRQRAILGKLYDACATALNARVGRSDNERFL
FT                   EQFGYVIVASQLLNEHSAPSYTSAADVLSNSNPVDLPSLSTTFGVQGAVVTASTSFSIA
FT                   WLVHWSRSRTGSGFNPRKVGVLLVLVPVLGVLFYAFARRQWLKYLRHQAVDAAVVFISN
FT                   AQSFDSAASASVVFIQEVELVSRGYRMAENADPSTRSTPLPPVSRLEDQAQTRRCLRLR
FT                   RTVSECFYSMLKRYLQAQHVLQPLTDNDNLAKYHDIYDVSLEELTEAETALAERETEDQ
FT                   YSLRALRTLFGRLYNVRKSILCCLLALGADGGGSDIVRWSTAVEQMRDLTQVTGANTRK
FT                   MTNILNEDDRDMIPPSPLPTASPNRENLRAQYRKLNTLTQGIRALHAKMHLIRELSTAS
FT                   EPTDTEELEATLLAQYESIGTDIRGLLQEWEAGKAALVSSIDKRSSVDHMSRPPSGLKL
FT                   PLSPTPSLGGATAVEGSPADALRALNGDIKPDPSIIQSVDEDEEIFESVVLPSRNKRAS
FT                   LTREERIARVKEDRAKQAAARERADANTSMLKELEMVIKQRPRTTASKRVTSI"
FT   CDS_pept        join(1394909..1397570,1397624..1398009)
FT                   /codon_start=1
FT                   /gene_family="HOG000211066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271381"
FT                   /orf_name="AFUA_1G04920"
FT                   /product="Calmodulin-binding protein Sha1, putative "
FT                   /protein_id="EAL88203.1"
FT                   /db_xref="HOGENOM:HBG051573"
FT                   /db_xref="HOGENOM:HBG329914"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="UniParc:UPI000051F168"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS9"
FT                   /transl_table=1
FT                   /translation="MSGLLQEVGTPCPVKSKNSRNSDTVHTFDSSWERILECGDDTANL
FT                   EFTTVIKNNTLIGVKPKRRVKTGTSFAIHDESKERPTHAVPKRKGESTITARVSSRKSS
FT                   LLAQPAHRFRPKVSFTSSSPSKAQLQKEEAKHQKQNIDASAKANRSLLMRINSGGVEDE
FT                   HKDKLKREVRRNTVFIPPDDTTIASVFMSLFSPLKSDNLDHYVPEDTEINSLESQIVRK
FT                   RQAKTTMASGRKTPLQPSLKVVQRSAMNIDIAGKITGKENIPPGEMIFSSNDKGLWKSN
FT                   TEDKFLNSESPRILSDKARPFANPVTERLAKVATNQGLRRSVPGEKRYNARASVNGIGS
FT                   KMDGIVRSRSRLEGAAVLSASRKTPLSNAFEQSKTYKMNASLVKKETAMTDFALISDDI
FT                   VSPAMYEDRWLVHQEIVITQLINRLFDRTNGQVRYDDPAARRHELLQLYQSGPFVELHK
FT                   RLQASLTYGSLGIPKDALTQTKRLKHDLGMKRKFLDIWLETYDLRALRAAAETVTGRRV
FT                   ENESLDGDSHHFSVETTADKEKILRRKLERFLDVFLVQNKDMDRDSQDLSHAGSDMISQ
FT                   AYRRTVLRSIMIVILLDKARLCPGTVLPSCLFRFSSSFKSSTAVIQALARLLLPASGDI
FT                   LRSLKHLDCHLSYEQHQLQEYEYQLSNLAVDLRDGVRLTRIVELLLYSSAGAVGGSVPP
FT                   LDNDQWPLSRRLKFPCSSRTVKQFNVQIALDALRLAPDAAPLVRDVRAEDIVNGHREKT
FT                   IALLWGLVSRWGLSELIDWDDVRKEIDRLRQKATSQLGYGQVNDANLFKEKSPKDGITD
FT                   DNEAILLLKEWAIILAHLSGFQLENLSTSFADGRIYEAIVNEYEEYILGNVASSPGQKP
FT                   TSLAARLRALGCSSQFANLVSPSNSRKAHIFDSSFTVGGLAFLCSRLLSSTKRARAAIV
FT                   LQSAWRRVLAHREAHRRDVARNLALQCAAVVQTRDRLLRAKTIILRWWRRLKKQRQQRS
FT                   KMGSRSEKRLQAATRAPRCGYGRTRV"
FT   CDS_pept        1405669..1407804
FT                   /codon_start=1
FT                   /gene_family="HOG000211055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271382"
FT                   /orf_name="AFUA_1G04930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88204.1"
FT                   /db_xref="HOGENOM:HBG051575"
FT                   /db_xref="HOGENOM:HBG329921"
FT                   /db_xref="InterPro:IPR018853"
FT                   /db_xref="UniParc:UPI000051E801"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS8"
FT                   /transl_table=1
FT                   /translation="MAYLRGGDRPFSIHKLLKMLLSPHQSNKPVQQESDMLEDVDEPPD
FT                   HRFLNTSAMNVDDGVVYVKSPTTMSRGKESLLTRALKHSPELAPADHQDHPFYRSYHSG
FT                   TVSGISTAELTSDGGLTSPSLSNTPSPPLSPQLNGRSGLDATESTVEANLGRKRCISFA
FT                   CGRKAEEMKPERPTAPESTANSTPAEPPKRKTVLTFVCPARDSCSTRERPPVRTAALRS
FT                   RPRGSPAPVARKASPDKDVSCPVKAQQDEKPSASSSQRGVPVKGLGKFEESEATRFHEF
FT                   ASSVSEDDEWVNKVGEFTEKITMTDCMRKEIAIRKLGEEAEEEALEEEDEEEDEDDADS
FT                   TIHDFSSDDGNESDNEAGFADSDDESDDGSEYEFWAPTAITTATSPQALDSARQALERR
FT                   GSNTSLDSVTDDPHKKWPPALAWKANGRSPFKPPPVKMRPGTPNLPDSTDFVCGTLDED
FT                   RPLEVAYKSCIEQRRLSKQVIIPQDIDPSFPTSDIDDQDDLEEDEMELSFRADELTRGR
FT                   TGGDSVRQHSPRLSPRRMMSPPPRRYSRMSPRRLRSPPPPVKMGPTQSGDGVSDDQLPS
FT                   RRPQGVNISELVQRPLMTRTKSLPRTPNPFFTSLDKAHRWSSIADVQESPECGSSCTRE
FT                   VHTRGPIDIVEGLEKKRQKRREKFWRQHCRKAAKEQMERRPIPGKGAERMKELGLEVAE
FT                   RFRAYGVGHDAQLVLSV"
FT   CDS_pept        join(1408563..1408581,1408769..1408872,1408951..1408990,
FT                   1409063..1409128,1409206..1409505,1409599..1409639)
FT                   /codon_start=1
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058213"
FT                   /gene_name="sar1"
FT                   /orf_name="AFUA_1G04940"
FT                   /product="Small COPII coat GTPase sar1 "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="EAL88205.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1M2O"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000051EA39"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJS7"
FT                   /transl_table=1
FT                   /translation="MWIINWFYDILASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRV
FT                   ATLQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFP
FT                   ESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQTTGKGKVPLEGIR
FT                   PIEVFMCSVVMRQGYGEGIRWLSQYV"
FT   CDS_pept        join(complement(1411837..1412013),
FT                   complement(1411343..1411744),complement(1410888..1411187),
FT                   complement(1410732..1410824))
FT                   /codon_start=1
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904936"
FT                   /orf_name="AFUA_1G04950"
FT                   /product="Serine/threonine protein phosphatase PP1,
FT                   putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88206.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI0000520202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS6"
FT                   /transl_table=1
FT                   /translation="MADQEVDLDNIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIF
FT                   ISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFVLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI
FT                   IDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGV
FT                   SFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAM
FT                   MSVDESLLCSFQILKPAEKKQKYVYGGMSSGAPTPPRKPKKK"
FT   CDS_pept        join(complement(1417084..1417125),
FT                   complement(1414663..1417011))
FT                   /codon_start=1
FT                   /gene_family="HOG000211044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271383"
FT                   /orf_name="AFUA_1G04960"
FT                   /product="Leucine Rich Repeat domain protein "
FT                   /protein_id="EAL88207.1"
FT                   /db_xref="HOGENOM:HBG051576"
FT                   /db_xref="HOGENOM:HBG329929"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000051F8B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS5"
FT                   /transl_table=1
FT                   /translation="MEKLNTEDGQLFIKNLASFVRTHEKALANALQLRRQTNKNAQPTQ
FT                   SGLSSSSTSSTLAAALSFGSLRFASHNIKPAKLTLTPHHLFYLLSCFEDLSISVGPMNV
FT                   RLENIHNDVSQSYVSFLNKPQRSKGDRDSIHSVSSVRSVMSGMSALWSSIGLGSKDSAS
FT                   KSEKVKAALDADLKYLYSAFTKIPCLRLAPDHRARLIRGYEEFPFDTAVPLHAFKNLSV
FT                   LEIIDIDYRSFFGWDRLSEQLRTLTLKRANVEDMADLLTGIVLDDIDKRRRRSSKAQHS
FT                   PVLGWNGNAHPQPVHKPDISGSVSAPGSPVVETAFGTSTSPKAVSMMRVGSEGAAPGRA
FT                   RTESVSPSRLTSSKHSSHRHNRGTSSRIRRTGSGSSNSSENSGYRNGSSSSLPSGILPP
FT                   SKWRFLRHLGLPDNSLTSVTAAAFAPVANSLHSLDLSANLFTEVPDSLASLVALRALNL
FT                   SHCMIDSLHSLSRNPLPAITALNLRGNRLRSLAGIERLPSLERLDLRDNNLFDPTEIAR
FT                   LTNLPEIREIWVSGNPFVKTHPNYRIVIFNLFRRTPGYSEDIIIDGSGPGYTERKQLVD
FT                   RVAEVESAPVIRSAAADHLAVAVVSKPPNVALAAAASKASQPPAPENDRGIGTSRRKQG
FT                   ARRRIVDISLDKPADDNGDTGAVVPSVSPMQHVHLSVDPFVSTPTDRQWKSDGGPQAEP
FT                   SNVPHPDGTVDTSFSSQIKRSSALQNMPQNSNWKADEEFYMQKLEALKQEFGSSWLSVM
FT                   GDRTRDKSISMPRTGTSIGESNLLSAGTFPRAANQPILSGGNP"
FT   CDS_pept        join(1423502..1424935,1425001..1425705)
FT                   /codon_start=1
FT                   /gene_family="HOG000048302" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058214"
FT                   /orf_name="AFUA_1G04970"
FT                   /product="Patatin-like phospholipase domain-containing
FT                   protein AFUA_1G04970"
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL88208.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG176740"
FT                   /db_xref="HOGENOM:HBG396101"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI000051F3D9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJS4"
FT                   /transl_table=1
FT                   /translation="MTSDEKSATRDIYDPNTLPDYDREFIEPDDLRQFEKALNAPEAAP
FT                   LVALNDWRPVNQRVRKSRRTKPRRSKDETREGVLYTVLKWPFLFTVFAWITVLGFAYTL
FT                   TRLYIFLYEQFVTWRGKREQLRRELSMQTNYQDWLKAAQALDTYLGNLKWKETDEYAYY
FT                   DHLTINKVVAQLKQTRKAAEMEMQNGRPGLSDPPAVEELCFLLEACVKNNFAGVENPRL
FT                   YSETYSGTKDLVQEYIDEVHSCIRLVLDSKQISNEDKYQFFKHLDTNFGRTALCLSGGA
FT                   TFAYYHFGVIRALLDNDVLPEIITGTSGGALVAALVATRTDEELKQLLVPALAHRIRAC
FT                   HEGFTTWVRRWWRTGARFDTLDWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHS
FT                   PTILANYLTSPDCVIWSAVLASAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRT
FT                   DIPIKALNLHFNVNFTIVSQVNPHINLFFFNSRGSVGRPVTHRKGRGWRGGFLGSAIEQ
FT                   YIKLDMNKWLRVLRHLELLPRPLGQDWSEIWLQKFSGTITIWPKSIPSDFYHILSDPSP
FT                   ERLARMLHVGKQSAFPKIQFIKNRLKIENAIMQGLQQCSSGGGRVMSPILSRRRQDRAQ
FT                   EHADRMVERLDQSFPERQSDYKDESHYAEVSDSLSATSSRPHTPDARRSSMFEEMRRQS
FT                   AVFFDDPDMYADEDAVTT"
FT   CDS_pept        join(complement(1429539..1429837),
FT                   complement(1428451..1429486),complement(1427563..1428394),
FT                   complement(1427288..1427503),complement(1426330..1427234))
FT                   /codon_start=1
FT                   /gene_family="HOG000211033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904937"
FT                   /orf_name="AFUA_1G04980"
FT                   /product="RNA polymerase III transcription factor TFIIIC
FT                   subunit (Tfc4), putative"
FT                   /function="binding"
FT                   /protein_id="EAL88209.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051577"
FT                   /db_xref="HOGENOM:HBG329922"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000051EA56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS3"
FT                   /transl_table=1
FT                   /translation="MEYHGDGNGSGHPSQSQESAYPDIDETLQYPWQGSQPAVAGESSL
FT                   HSVIDPRLYKDLFSRSASGQQAMEYGDEEDAQEYSQLDGSAEDSTYEFSAEESSTEEEP
FT                   SDVEENAADEGDDDSVGRRRRRRRGTGPFSGRWGARGGKGIKRGPRKPLEPSAEFKMLH
FT                   SDATSAFIDGDYETAIDLVKRAIHINPEMFAAHSLLSEIFLAQGQKDKALTALFSGAHT
FT                   RPRDASVWFKVAQMILDRAGDDRPAALNDVIYCLSRVIDIEPKNYNARFQRAAVYRELG
FT                   HNGRAVTEYERILKEVPHHPRALRNLAEAYIDLNEVTKAVDQWTESVEYYKSFEPEDAP
FT                   DFSWSDANIYAELFSYLGRYEEGLKALKSVSRWLLGRRDDTMWENFNEDDREWDANDSP
FT                   RRIKVDGYIPGRWPRDSYGLGLPLELRIKLGLFRLRMGYDHKNEALHHFSWLNPEDTSE
FT                   GARLYDYGDLFREVADALKEVGLLEDALRYYTPIQQTTEYADISYFMAMGDCFMQLGNI
FT                   EEAENCYLTVADYDTRNIESRAQLAKLYESIGMTEQALKYVNEAVLLGRQETKTHRRRK
FT                   DTRLEQLALEFRTETDPELPGLRIAVPPERAEGLAPTLTTTSVNATRRKVQEAEEERTE
FT                   LVQFLYGKLLDIHPRVKEGNAEAIEDWLDIADALLREFRSNKVFYPFQRNIVFLGYSRE
FT                   AQRKAGKYKNRTLMDEMQEMASRLQESLGTVTDESLQDAVPTDYHGISFDEWLDLFLQY
FT                   ALVVSGQGEPDEAYDSLAAAADASIWYHSKPCTRLIHVCWFTCALKAQDEETLANEARW
FT                   FIKEYQFVTDTYRLFSMLSRLCGDPHRSLFHSSPNMKFMLRQIKAMDFSIPDGPNDSRP
FT                   SKAVRESIYRERATLTTRDESGEAIPADQLDVALLVLYGHILYSGNSFYPALNYFFRAY
FT                   DLDDQNPAVLLSIALCYIHHSLKRQSDNRHYLIMQGLSFMHEYRRVRERKGSLLQERQE
FT                   MEFNFARVWHLLGLAHLAIEGYQRVLALGEQIQTESQNKIPQPLTTNADPADSSDVVKE
FT                   DTHHAGQVGIRFVEDFSREAAVALQNIFALSGDLESAREVTSKFLVI"
FT   CDS_pept        join(1431250..1431751,1431805..1433084,1433138..1433194)
FT                   /codon_start=1
FT                   /gene_family="HOG000211022" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904938"
FT                   /gene_name="vts1"
FT                   /orf_name="AFUA_1G04990"
FT                   /product="Protein vts1"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL88210.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG051578"
FT                   /db_xref="HOGENOM:HBG323888"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI0000F51A3D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJS2"
FT                   /transl_table=1
FT                   /translation="MASHIIGNRNSTPDASKSSLRPPSSSRNLGSHQLRASADMSGFPS
FT                   PLSSRSIRPSSEVYYSQQSQAQNNAEDPLDRAAQQWLADIDQYETTLEEMAAATLDQDF
FT                   KDELSAIEQWFRVLSEAERTAALYALLQQTTQVQIRFFIQVLQQMAKSHPMSGLLSPAN
FT                   FSEKDAMSNRLNDAMSKLNIDSSRNSLGRPPPSPGAKRNSGLDSSTINAMFPDAAAAIA
FT                   KKKAEFTQQTGNAPPSNRNSAVYGDRSSLVAPTISAPDNTDNLGQPPASPWAQRGNEPQ
FT                   PPIARPKSSSGQQPMGQFSQASSGLRSPLPTQTATITAPEIEAPLLSPYNVGNASWASM
FT                   TNTPMTATFGQQVHQPPNSQADMVANATAMKLAALSTVNNRIALDDARKYRRARSNDGQ
FT                   GRSSNTNVNQTIQGGLASPGLPGANHLVAGQLLNAQQLAALQAQQQAAMAGRRSRPTSP
FT                   GIAMQGGALAAMGFTSPQNNGFLAAYDPNNPLLGNGLGALGLSQFGLGGHEGYLSDHSE
FT                   VTRGRSPRGRRGSSKPPEDPTDPNLLKDIPSWLRSLRLHKYTDNLKDLKWTELIELDDK
FT                   ALEERGVNALGARNKMLKVFEQVKEAKSEGKLDSIA"
FT   CDS_pept        join(1433868..1433942,1434008..1434352)
FT                   /codon_start=1
FT                   /gene_family="HOG000211011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752777"
FT                   /orf_name="AFUA_1G05000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88211.1"
FT                   /db_xref="HOGENOM:HBG051579"
FT                   /db_xref="UniParc:UPI000051FFA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS1"
FT                   /transl_table=1
FT                   /translation="MPATKQELSLLINPLVPESVQHNNRVLSQLHSLTSFLLGLTAGIL
FT                   ALQSATGFAFYLLGTVLVSGLFHLLVLKRSGGKGAGVFFPGAGGEIAGIDERGLVKGNG
FT                   GRRGAWRDVWLGGGVLGEALSGFILGWAGVGGVLR"
FT   CDS_pept        join(complement(1436118..1436873),
FT                   complement(1435958..1436002),complement(1435500..1435896),
FT                   complement(1435336..1435464),complement(1434636..1435288),
FT                   complement(1434477..1434575))
FT                   /codon_start=1
FT                   /gene_family="HOG000210999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271384"
FT                   /orf_name="AFUA_1G05010"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL88212.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051580"
FT                   /db_xref="HOGENOM:HBG329925"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EA4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJS0"
FT                   /transl_table=1
FT                   /translation="MFAATKYIYNKTRTGPKSGGETEPLCQHRLQSSQPAPAADDGLST
FT                   ERTSIKTEDQQILPQSAPGPEGDSKCHLCQQQCRHDRIYRWKLICGLTLPYILSTLDLT
FT                   IVATAVPSIASHFRAFPPHIVLTPTFTKYSPLADKFDELTWIVTAFTLTSTTFIPIFGQ
FT                   LADVFGRHAVLQLAMFLMLVGSTLCAAAQSWGMLLLGRALQGTSSAGIMNIIMIVLADR
FT                   VSLRENARNNSIFVFVGGLGYGVGPVVGGYGNWRYCFLVPIPVGLIAFISHIVIFVLLR
FT                   NELVEGTVFQKSSRWSALLPALATLDIVGAVLFIFGVGLIILGTAWGGSTYPWSSPEVL
FT                   VPLIVGGVCFALFFVYECFLEPDRLFARMFPKQVPMLPYSMFARRDTIWLAVLEFSSGA
FT                   GTDAGIAAMYSVFYFIGIYFTLVEAYPASRAGINLLYYIPGLGDKAGVYIAVFLCNVYP
FT                   AQTFFTINTGTVAETAGFALLIWAISTQNTALINGMMVLAGAGTGLRLMPVTLHTAGVW
FT                   PEKIAPAMSLMRFALPFGGTLGLTIMGSVFNNFLSSKSSASGDMARLDVHDGASLEYIA
FT                   GLPGPEQEAMRTAGKEAIMWAFIAIMPVIGLSLATGLVLGNVWIKPERLRQRQRQQQVE
FT                   TRSDGADESGDSEVIYAPYLWALLTGNVTTHKHTNKPKPRHEEETELHPLPSEPSIA"
FT   CDS_pept        join(complement(1439855..1440155),
FT                   complement(1439653..1439798),complement(1437499..1439595))
FT                   /codon_start=1
FT                   /gene_family="HOG000210988" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209508"
FT                   /orf_name="AFUA_1G05020"
FT                   /product="Sulfate transporter, putative "
FT                   /function="secondary active sulfate transmembrane
FT                   transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL88213.1"
FT                   /db_xref="GO:0008271"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059921"
FT                   /db_xref="HOGENOM:HBG328073"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniParc:UPI000051F3F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR9"
FT                   /transl_table=1
FT                   /translation="MSADLKTKIGHGLAKGLGIKLPYRDPLGANADPVTRGESMFSVGT
FT                   VDTYSYVEPEPTSAEWLRELCPTWRDVGHYFYRLFPFLTWITRYNWQWFLGDLVAGVTV
FT                   GAVVIPQGMAYAKLAALPVEFGLYSSFMGVLIYWFFATSKDITIGPVAVMSTLVGTIVL
FT                   KAQKEIPDVPPYIIASAMAIICGGIVCAMGLLRLGFIVDFIPLPAISAFMTGSALNICS
FT                   GQVKDLLGETASFSTRGATYNIIINTLKHLPSAGLDAAMGVSALAMLYIIRSACSYGAK
FT                   RYPQRAKTFFFLSTLRTVFVILFYTMISAAVNIHRRQHPAFKLLGKVPRGFQHAAVPVV
FT                   NARILKTFAGELPAAVIVLLIEHIAISKSFGRVNNYTIDPSQELVAIGVTNLLGPFLGG
FT                   YPATGSFSRTAIKSKAGVRTPLAGCITAVVVLLAIYALPAMFFYIPKASLAGVIIHAVG
FT                   DLITPPNTVYQFWRVSPLDAIIFFIGVFVTVFTSIEIGIYCTVAVSAAVLLFRVAKARG
FT                   QFLGRVTIHSVIGDHLVQGDGKYGPANGYTPADGKGNFQRSIFLPIDHADGSNPEVEVQ
FT                   QPYPGIFIYRFSEGFNYPNCNHYTDYLVQTIFQQTRRTNPFSYSKLGDRPWNNPGPRRG
FT                   KEAEDRSHLPTLRAVILDFSSVNNVDVTSVQNLIDVRNQLDQYAAPQSVQWHFAHINNR
FT                   WTKRALAAAGFGYPTPASEDGFHRWKPIFSVAEIEGSASAAALAELMNNQQAHKTEQKQ
FT                   GDIEEGLKNDSHAKERETHGIETPSDSSSTDDDKLQRDLTESKAYRNRRKVALVQGLNR
FT                   PFFHIDLTSALQSALANSAPDLHVDPAEVNATTDA"
FT   mobile_element  complement(1442620..1443456)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(1443534..1444130)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(complement(1448150..1448185),
FT                   complement(1448022..1448091),complement(1447141..1447959),
FT                   complement(1446768..1447084))
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271385"
FT                   /orf_name="AFUA_1G05040"
FT                   /product="Protein mitochondrial targeting protein (Mas1),
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL88215.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000520434"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR7"
FT                   /transl_table=1
FT                   /translation="MVKDTKLYDILGVPETASEAQLKSAYKKGALKYHPDKNANNPEAA
FT                   EKFKEMSRAYEILSDPQKRQIYDQYGEEGLEGGAGGPGMGAEDLFAQFFGGGGAFGGMF
FT                   GGGMRDQGPKKARTIHHVHKVSLEDIYRGKVSKLALQKSVICPGCDGRGGKEGAVKSCT
FT                   GCNGSGMKTMMRQMGPMIQRFQTVCPDCNGEGEIIREKDRCKRCNGKKTVVERKVLHVH
FT                   VDKGVKNGHKIEFRGEGDQMPGVLPGDVVFEIEQKPHPRFQRKDDDLFYHAEIDLLTAL
FT                   AGGSINIEHLDDRWLTVNIVPGEVITPGAIKVIKGQGMPSYRHHDFGNLYIQFDVKFPE
FT                   KDQLQNLGLLERVLPPRMEQPQPPADSMVEDFELEDIDASEGSQRRAHGAATAMDEDDD
FT                   DVPPGAERVQCASQ"
FT   CDS_pept        join(1449702..1449860,1449972..1450237,1450332..1450353)
FT                   /codon_start=1
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058215"
FT                   /orf_name="AFUA_1G05050"
FT                   /product="Cytosine deaminase, putative "
FT                   /EC_number="3.5.4.1"
FT                   /function="cytosine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL88216.1"
FT                   /db_xref="GO:0004131"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG220403"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000051E57C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR6"
FT                   /transl_table=1
FT                   /translation="METDAGFIAALEEAKKGAAEGGVPIGAALVSKDGKILGRGHNMRV
FT                   QKGSATLHAEMSALENSGRLPASAYEGATMYTTLSPCDMCTGACILYKVKRVVIGENKN
FT                   FMGGEEYLLNRGKEVVVLDNEECKQLMEKFIKEKPELWNEDIAV"
FT   CDS_pept        join(complement(1451730..1451784),
FT                   complement(1451629..1451670),complement(1450609..1451532),
FT                   complement(1450481..1450554))
FT                   /codon_start=1
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209509"
FT                   /orf_name="AFUA_1G05060"
FT                   /product="Uroporphyrinogen decarboxylase "
FT                   /EC_number="4.1.1.37"
FT                   /function="uroporphyrinogen decarboxylase activity "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL88217.1"
FT                   /db_xref="GO:0004853"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG090899"
FT                   /db_xref="HOGENOM:HBG628392"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniParc:UPI000051F179"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR5"
FT                   /transl_table=1
FT                   /translation="MQEKFEPLKNDLLLRAARGERVPRPPIWVMRQAGRYLPEYHEAKG
FT                   NRDFFECCRNPEIASTLTIQPVDRYAGLIDAAIIFSDILVIPQAMGMQVEMVDKKGPHF
FT                   PEPLKSPDDGQYEKVMQKEVNVKEELDYVYKAITLTRHKLKGRVPLIGFCGAPWTLLCY
FT                   MVEGGGTKLFVQSKMWIYKYPKESQALLQKIAEICVEYLALQVASGAQLVQVFDSWAGE
FT                   MSPAAFKTFSLPYLRYISANLPKRLDAMGLERVPMTVFAKGAWYALEDLCESGYNVVGL
FT                   DWLHDPAEAMQIAKGRVTIQGNADPGILYGSREAITEAVEVMVKGFQGGKQGWIANLGH
FT                   GITPFVKPDDLKFFFEEIHRLTAA"
FT   CDS_pept        join(complement(1453243..1453658),
FT                   complement(1452492..1453187),complement(1452042..1452438))
FT                   /codon_start=1
FT                   /gene_family="HOG000217089" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271386"
FT                   /gene_name="trm82"
FT                   /orf_name="AFUA_1G05070"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase subunit
FT                   trm82"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88218.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG051582"
FT                   /db_xref="HOGENOM:HBG329936"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00005208F3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WJR4"
FT                   /transl_table=1
FT                   /translation="MVVNYQHPIQCIRYVEKQTAGFRNLFLASAGSKIYTYAAETGRKL
FT                   AIWPEAPNASHSTVVSVAPSSEGDEPSAKKRKVSPVPEQTAKGGQPEASTAWSTIPILT
FT                   VSSDGNFLVAVTGEDKCLRVFEIEESGHLKQLSERHMPKRPSAITLVDDDKTILCGDKF
FT                   GDVYSLPLIDTGKSSIAPKIHAKMKPNQPAATTLTVHSKRNLASLEQQLRHYSQNEKTA
FT                   EEKPTSAFELHLILGHVSMLTDLVYVSVPVDATSGRQRPYIFTADRDEHIRVSRGPPQA
FT                   HIIENYCLGHTSFVSSLCVPQWAPEYLVSGGGDNHLIVWRWNESRLVQKVPLLEEGTDS
FT                   EVVVRRIWALSLTKAANSQENANVILVALDGSSKLLCFTLESDGSLKAQNSIQASGNVL
FT                   DLTVPSENSSIVVSVDAVREAGSTQEWRTSPSSPSTLVEAFRLKPASEGPLDWERTSEA
FT                   ITAQINSEGTSDISADLDEKQKKELNDSLYSLGNLRKKNMGEDD"
FT   CDS_pept        join(1454060..1454233,1454290..1454359,1454437..1455134)
FT                   /codon_start=1
FT                   /gene_family="HOG000210987" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271387"
FT                   /orf_name="AFUA_1G05080"
FT                   /product="60S ribosomal protein P0 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL88219.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG232283"
FT                   /db_xref="HOGENOM:HBG601294"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI000051F639"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR3"
FT                   /transl_table=1
FT                   /translation="MGGKSATKAAYFDKLKSLLDEYKTVFIVGVDNVSSQQMHEIRLAL
FT                   RGQAVVLMGKNTMVRRAIKGFVADNPEYERLLPHVKGNVGFIFTNGDLKDVKTKILANR
FT                   VAAPARAGAIAPADVWVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGA
FT                   KVGPSEATLLNMLNISPFTYGMTITQVYDNGQCFPAHVLDIEESQLLDAFSSAIKTITT
FT                   VSLALNYPTLPSVMHSLINGYKKVLAVAIETDYSWPEIEELKDRIANPDAYAAAAPVAA
FT                   APAAGGAAPAAEEKKEEEAEESDEDMGFGLFD"
FT   CDS_pept        join(complement(1458347..1458425),
FT                   complement(1456487..1458282),complement(1455738..1456427))
FT                   /codon_start=1
FT                   /gene_family="HOG000210966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271388"
FT                   /orf_name="AFUA_1G05100"
FT                   /product="GARP complex subunit Vps53, putative "
FT                   /protein_id="EAL88221.1"
FT                   /db_xref="HOGENOM:HBG329938"
FT                   /db_xref="HOGENOM:HBG489184"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="UniParc:UPI00005201E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR1"
FT                   /transl_table=1
FT                   /translation="MSVSTPTSSTGHVPPNGAADLDPLDAADYDPIDHLNAIFSHPSTL
FT                   SSVSEVSQALREYEDELDHDIATLVEEQVTSNAESVERIQAAKADLTELFKKIDEVRDR
FT                   ASKTEQAITEMTADIKQLDNAKKNLTQSMTALKRLQMLTTAYDQLRALSKTRQYRDCAQ
FT                   LLQAVIQLMAHFKSYRSIDQIALLSRNVADIQRELLEQVCEDFELAFAKGEVAQNRITL
FT                   SEGCQVIDALGESARSRLVTWYCNFQLREYRQVFRNNEEAGSLDNISRRYSWFRRILKI
FT                   YDEEYAAIFPASWRVNEILANVFCEGTRDDFKGILSRSVRNGQTIDVNLLLSCLQETLD
FT                   FEHSLERRFASPARPSTDTFASTETPVFGQAISEAFEPYLSVWVEAQDKQLAALIPKYR
FT                   QQPIRPPDEEFDCHIVISSSTELFTFYRHSLQQCAKLSTGGSLADLAKVFAKYLDQYAQ
FT                   QVLLNYISERPTGHTPSNVPSLEDLILVLNTADYCYTTCNQLEEKIKGRLDKNLKQSVD
FT                   LQSQADSFMGIASAAIRGLVRKVEINLEPSWREMRNTPWSRLDAVSDHSPYVGELLSKT
FT                   QATFSEILQFLHKQQYARAFADHVVELLSTQFISNISQCKPITETGAEQMLLDTYTLKT
FT                   GLSSLLPAPAPASFVKRVNASFSKIETLLKTLQVQPSPPEALVQAYLIHIADRNNANFR
FT                   KILDLKGIRSRQEQNQLVELFQVHRTSDRYASNLQQSNPVLAAMQTTPALSSSSVSQGL
FT                   GLGAAASISASNLPTRFDPSMLGSALISAAKDGVDRFGTPSSGTNPSSSTGGVSTPPHS
FT                   GTTGQGQGQGGEMSSNLNENLKNIGKFFRRDLGGFGGRFGGS"
FT   CDS_pept        join(complement(1460953..1461372),
FT                   complement(1460813..1460917),complement(1459232..1460752),
FT                   complement(1459113..1459160))
FT                   /codon_start=1
FT                   /gene_family="HOG000210955" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209510"
FT                   /orf_name="AFUA_1G05110"
FT                   /product="MRNA export factor mex67 "
FT                   /biological_process="mRNA transport"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL88222.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG051584"
FT                   /db_xref="HOGENOM:HBG329939"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI00005201EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJR0"
FT                   /transl_table=1
FT                   /translation="MKGKGSRARSGASDRGGIRKRGSTRIDRDGDLSMDGDAARARGKR
FT                   TRGDAGRATPAGGRPQARDRTLNAIQKAIASNADSQANIRQGTRGAGLEQVSVRGWKQS
FT                   KAASNRDGGLESLIAFLEKKLTASDSKAGARARITKQKRAAVVLSGLSSSSPGMVFQND
FT                   DRQRLGSFFLLSSRVEGDSVIVSIRPGLLDRMLQMNGFSFAGAPLTIEAYGPSANGMTD
FT                   QPMLSDIAQNGGAPSTADTKSKMTAILSKRYYQQTKLLDLSKLGSDPDLLAMGIFNSTS
FT                   TESKFFPALMKVWEMSFDNSTTRREAVESVSLADNQLANIAVVTSLAQTIPDLRNLDLS
FT                   NNNFKDAQSLIGWRWKFRNLEFLDLTGTPFSADPTFKETMMKWYPKLRVLNNVEVRTAE
FT                   EIAAQKKTPIPVQPPHFFDESQIAENFVRAFFVGYDNDRNDLLNGVYDNHSTFSLNVNT
FT                   SAPRAQQTETAGWDPYIKKSRNLLKINHLPARMSRAYVGVEKIREVWNSLPKTKHPDVA
FT                   AHPNEWLIECFPVPGLPDLSGQSSTGVGGLLIMVHGKFEELIDGKVEVRSFDRTFILGP
FT                   GGGVGGIRVISDVLCLRAYGGHEAWIPETPTVPPSVQTTIHPAAPQAVPEGYGMPLPGK
FT                   PETQVQQEQLVMQMSTKTNMTLQYSEMALSGNGWNMDAALKNFEELKAQGTLPPEAFLP
FT                   GTV"
FT   tRNA            1461859..1461966
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        join(1462605..1462797,1462863..1463043,1463105..1464047)
FT                   /codon_start=1
FT                   /gene_family="HOG000210954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752778"
FT                   /orf_name="AFUA_1G05120"
FT                   /product="COPII-coated vesicle membrane protein Erv46,
FT                   putative"
FT                   /protein_id="EAL88223.1"
FT                   /db_xref="HOGENOM:HBG059099"
FT                   /db_xref="HOGENOM:HBG619751"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniParc:UPI000051E7F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WJQ9"
FT                   /transl_table=1
FT                   /translation="MPAKSRFTRLDAFAKTVEDARIRTTSGGIITLASLVVILYLVWGE
FT                   WLDYRRVVVLPELVVDKSRGERMEIHMNITFPRLPCELLTLDVMDVSGEQQVGVAHGVN
FT                   KVRLSSPAEGGRVLDVQALDLHSKEEIAKHLDPNYCGDCGGADPLPGSIKEGCCNTCDE
FT                   VREAYAAKNWAFGKGTNIEQCEREGYAARIDAQRREGCRLEGILRVNKVVGNFHIAPGR
FT                   SFTSGQVHAHDLQNYLDSELPDNEKHTMTHHIHQLRFGPQLPDEVSDRWQWTDHHHTNP
FT                   LDSTSQETNDPAYNFVYFVKVVSTSYLPLGWDPLFSSAAHNAHDQTPLGSHGIAYGSGG
FT                   SIETHQYSVTSHKRSLRGGDASDEGHKERLHAANGIPGVFFNYDISPMKVINREARPKS
FT                   FSGFLTGVCAIIGGTLTVAAAIDRGLYEGALRVKKLHSS"
FT   CDS_pept        join(complement(1468600..1468615),
FT                   complement(1468184..1468513),complement(1467969..1468123),
FT                   complement(1464920..1467910))
FT                   /codon_start=1
FT                   /gene_family="HOG000210933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271389"
FT                   /orf_name="AFUA_1G05130"
FT                   /product="PH domain protein"
FT                   /protein_id="