(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_2

ID   ASFUM1_2; SV 1; linear; genomic DNA; GRV; FUN; 4844472 BP.
XX
AC   CM000170_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   2, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000170.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4844472
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 2"
FT                   /db_xref="taxon:330879"
FT   CDS_pept        join(4456..4595,4890..5495,5652..6234,7130..7183)
FT                   /codon_start=1
FT                   /gene_family="HOG000048619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265132"
FT                   /orf_name="AFUA_2G00090"
FT                   /product="Telomere-associated RecQ helicase, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL87107.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG052475"
FT                   /db_xref="HOGENOM:HBG325235"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051F6A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ8"
FT                   /transl_table=1
FT                   /translation="MHHSRETGLRIYGRVIASFQGVRADIQIALVTFSQRWHAYLGLAP
FT                   DQQLDPSRSNLASHQQLDEGLLDHMLKEFMQDDQVTFRSPEQRQAFHLIMKQVPYLFLV
FT                   LPTAAGKTTLFLFGASLATSQVTIVIVPLISLKLDLSRKAAALGLQPTIWEPGQVMPLA
FT                   SSRVILVQIEHLDHPRFNELADELITQKRLARIIWDECHLIPLAKSYRPIMLRAWHALA
FT                   LPVPMVFSSATLPHHLQAELVDMMKLGSSTTAQASAQASAQASAQASASARTRANVIIF
FT                   CRTKRLVDALSDQMDPEAAKFHSDLSDQAKLDQLDRFQSSRYILVATGAIGAGFDFHDI
FT                   DLVIHFLPGEYEMTSFMQESGRAGRSPDQPGWSYCLVRAYQLQARPNQKGKALEVSTFL
FT                   DYLGEQVCRRRTISRVFDSRAIESCDPGWALCDLCDHRQSRLGLAPLAAKSPSLAISNH
FT                   PT"
FT   mobile_element  8822..9193
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(complement(13766..14289),complement(12168..13708),
FT                   complement(12043..12080),complement(11922..11928),
FT                   complement(11798..11809),complement(11532..11730),
FT                   complement(11184..11418))
FT                   /codon_start=1
FT                   /gene_family="HOG000048329" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265133"
FT                   /orf_name="AFUA_2G00100"
FT                   /product="C6 transcription factor Aro80, putative "
FT                   /protein_id="EAL87108.1"
FT                   /db_xref="HOGENOM:HBG052496"
FT                   /db_xref="UniParc:UPI000051EF2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ7"
FT                   /transl_table=1
FT                   /translation="MWQAGDPVSVHDEAAMVKELKWYAFYIALESSQQSHYSLDSSLNT
FT                   APIQRVTRSQMNNSSDAACRGFLLSLKDLPKEHVSSKRPAEGIFNTVLREKVTSGKEAL
FT                   NILFEAAVQQDQAPIVSGTETDKTPQQPSLASTSLKIDCISETDVLKIWSGCRFVKMGW
FT                   FTAREALLYVDLFFHNMAPLSPILTDFFASHHTHYWLITQEPVLCCTILMISSRYHTLP
FT                   GPSGATRGFFIHNRLWQHCQHLILRIMLGQEKFSKAKTRHLGTVEALLLLSEWYPRALH
FT                   FPPENDGWDSDLMLTAPSERDPPPVTEESPMQDRWREDVVEPTRRSDRMAWMLVSSALA
FT                   LAHELGVFSTSNRSDLGDSRIVEPDVKAYVYHLDVRRQRLPSLLYVIINNLSSRIGCTS
FT                   LMPEKCQLTGLHNLSGVSSEWARLMKSWVELTDFTRTLRETFFADASPRDRRQIDNDLL
FT                   GEWIGRLGLWRRQHQAVDSKSATNGLCPDLILRTDLYYDTVIEIEYQYLRVLSNSLGVQ
FT                   GIVERVLSQTESHGTINTTFISHARQIPLSRSEHGFIEEVIDGACAILTHIISLPGPKP
FT                   LSFYPVRVFLRVISSSIFILKALALGARPTKLQESLDLLDQAIAVLDSDLLDDIYLVSR
FT                   YAALLKIHVSRLRQTFANCSQVSSKGESYNQEPGTPVPTAAERFDWDPSMMDLDLGTAS
FT                   GDLNLDFIMLSPREYENLLPNGKTDQYIQCTRQRLDSPVKYHFFRPKTPGGRDILFLGS
FT                   LELETTDDRLYTRKSSTWAASIMPEIFLIKECPSEGRFEWTDDGHVDPGHGYGFTQISN
FT                   SSYQLRPRQLNPYLLGFVLQETQSSKRIYIGSSGFGSTI"
FT   CDS_pept        join(complement(16994..17000),complement(16829..16952),
FT                   complement(16759..16782),complement(16609..16630),
FT                   complement(16500..16534),complement(16178..16446),
FT                   complement(15483..16125),complement(15313..15423),
FT                   complement(15175..15224),complement(14882..14985))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265134"
FT                   /orf_name="AFUA_2G00110"
FT                   /product="MFS transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87109.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG052573"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005206EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ6"
FT                   /transl_table=1
FT                   /translation="MITAWTPSRRRALATWKTFISKTWRSNLSKSRLLLLIKLIFGECL
FT                   TTVSCLLPDRLSMVRTYMLLHCVYGAWGAAAMCSGAVHNLAELIVCRCLLGVFEAAFGA
FT                   GAPYFLSLFYQRRELGFRVSLLLGMSPVANCFASALAYGITHIRHSIASWRYLFIIEGA
FT                   PTVLFSAIVFFFLPDSPGTAKFLNETERTQAVERLQTFDRTAKNRLDRSQVFRGLTDYK
FT                   NWVHTFIHFCCNFSFAGLSNFLPTILHDMGYTSINAQGLAAPPYLASFILCVVAALISD
FT                   RYGRRGLIIAVSAATGMIGYLILAVVQDESKTGVRYLGVWLATCGIFPALSINITWLLN
FT                   NQGGDSKKGAGMAILAVLGQCSSFVSSTAFPRTEGPFYVRGCAIGCALTGCIVVFALGL
FT                   YAKLVHENKVRDSYLIAEGTCGSFCRWGVEDIEWVESPYMEDIKWFESLYMEDIKYFKI
FT                   FNIL"
FT   CDS_pept        join(17442..17919,17984..18465,18528..18602)
FT                   /codon_start=1
FT                   /gene_family="HOG000220040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265135"
FT                   /orf_name="AFUA_2G00120"
FT                   /product="Carboxyvinyl-carboxyphosphonate phosphorylmutase "
FT                   /EC_number="4.1.3.30"
FT                   /function="methylisocitrate lyase activity"
FT                   /protein_id="EAL87110.1"
FT                   /db_xref="GO:0046421"
FT                   /db_xref="HOGENOM:HBG421907"
FT                   /db_xref="HOGENOM:HBG728656"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI000051EAA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ5"
FT                   /transl_table=1
FT                   /translation="MTVPYPFKFSTPDRPTSSSNGETTSISVTLENVRGRIPSAQASRL
FT                   RTMMLEAHNDPNKIIAHACSYDGLSSRLVEEAGFPIIFLAGYAVASGFGLPDTGYIAME
FT                   DMCRKIQEVVRVTSIPVMADGDTGYGSPMNVKRTVECFAAAGAAGIMIEDQTWPKRCGH
FT                   TKGKSVVSRGEAYARVQAACDARNEGQDIFILARTDALIHGWDEAITRAKEFKRIGVDA
FT                   VFVEALPDREAMKRCSEEIGIPVFANIIEGGKTENLSALELAQLGFCAVAYPWTLVAAK
FT                   LKSIRETLDDLKKSMTIGAPPMILGYSEVCEGVGFNRYWARETRYEYDENGLVNNFEDG
FT                   ARQS"
FT   CDS_pept        20452..21843
FT                   /codon_start=1
FT                   /gene_family="HOG000216898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265136"
FT                   /orf_name="AFUA_2G00130"
FT                   /product="Solid-state culture specific protein, putative "
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL87111.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG052714"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI000051FDE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ4"
FT                   /transl_table=1
FT                   /translation="MYSSTPSPITLDYTLHDLYIASQEDGLNTVLIYYPLQFGHNHEGK
FT                   SAKFAYGYKVEEEDEFATSLTMAANLVPQRYAFSAGRMPLVILDIITQRRLAGGSEGDS
FT                   RATDSMPAHHLDIYQTFAQLHPDQRPIVSFAEDSDRIQLGSDARVAVLLPTDCLSHLPH
FT                   LICPETHYEILSKRGLAVSGLPTPPSRVIDTILGDSEDPTLLTIEIARMTAPIDQHQIP
FT                   FIVKLPQSISGMGTFAVTSETDRTRIKAMLTSQLGAMLRQLNQTNRHLHPCSLVLQDFV
FT                   DGPVVALSLFVTKTGKPFFVACCEQLFNHHSHWIGGRISYRRQDWYRKTFCALMGKVAA
FT                   FLHRKGYHGPAGVDIVIDQRSGEQLVIDLNVRVTGTFHLGPLMGHFTRRGLFEAAMTSG
FT                   HLFCTRDEFEEIFLEELRQGSMIVSGFVHNESQSKSHAAITVGARDHDSLQEYLERVRA
FT                   VGLQN"
FT   CDS_pept        join(complement(24117..24169),complement(23851..24037),
FT                   complement(23313..23790),complement(21957..23254))
FT                   /codon_start=1
FT                   /gene_family="HOG000251017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265137"
FT                   /orf_name="AFUA_2G00140"
FT                   /product="FAD monooxygenase, putative "
FT                   /EC_number="1.14.13.-"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87112.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051032"
FT                   /db_xref="HOGENOM:HBG327146"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI000051E5E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ3"
FT                   /transl_table=1
FT                   /translation="MGDSFRTDVLIVGAGPSGLMAAAWMSRMGVKTIMIDQKSHQTRCG
FT                   RADGLESRTLEILDSFGLADKVWAQANHTVEIALWGSTADGKLERQSVSANSKPGWSRF
FT                   HESTLSQGEIEEYLMEFVRTGKHVEVKRETIPTSFEIDYAMINDHDAFPIRVNLEDVPC
FT                   NPKTPFDGVATPNSELSEAPSDDSGYAGMGTTVEAKYILGCDGAHSWVRKQLGLRLEGE
FT                   SYNDCWGVLDIIPLTDFPDIRKRFIIKSKHGTLMMIPRERKLVRVYVELPPEVANRYRA
FT                   DRNADILTEQVATIMQPYTLKTNRIDWSTIYTVSSPFLCSFDAVPGTPKLITNQVGQRI
FT                   CRKIGLHNRIFLAGDAIHTHSPKAGQGMNVSMQDTFNLGWKIASVIKGVLHPWVLETYQ
FT                   EERLPVAERLIALDQRICRGMCSQRSGHPEVQQGHFDEDHKRALEDENSSMSGLAVIYQ
FT                   PNSLVTSTAWDAPLLKDVASCISRPSVAQNLQVGARIPSVLILNQSDSQACHLQQILPS
FT                   TGQWNLLVFGGDIADADQKSRVQDLADALNSSGSVFEKLNDPVSVARRGFPALGVYLIH
FT                   CADRLSIELNDLPMVFRPWTKDGVDYGRVWADGEAYHHAGGGKLYSSFGIGDKGCMALL
FT                   RPDQHLAFLSDINDVESLEQFLRSIMPEATQKPMPI"
FT   CDS_pept        join(24673..24738,24793..25566)
FT                   /codon_start=1
FT                   /gene_family="HOG000171638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903338"
FT                   /orf_name="AFUA_2G00150"
FT                   /product="Catecholamine-O-methyltransferase, putative "
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="EAL87113.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG052860"
FT                   /db_xref="HOGENOM:HBG328951"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="UniParc:UPI000051F44A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ2"
FT                   /transl_table=1
FT                   /translation="MAALATNTSISQGFYKPEENVFCNDGREDQLLHFITTHPQLSAIR
FT                   NSPEAVLAAVDEFARTKDFLMNVGPYKGGIITDIIATEQPSSILEIGGYIGYSAIMFGS
FT                   AMRNTGVLAPRYVSLEMNPKFASVSRTLVEVAGLSDVVEIQEGPCRKSLHRLAAGTSNK
FT                   GPSSKKWDILFLDHSKISYLNDLKLAEELGIVAPGSIVIADDMKRPGNPMYSDYVMADT
FT                   ATKTEAYMPFVGCLSDGGISLGNPYLMYQTVLLEGLEPTGHMVSFYYPRLLRFAKAS"
FT   CDS_pept        28971..29579
FT                   /codon_start=1
FT                   /gene_family="HOG000178752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265138"
FT                   /orf_name="AFUA_2G00160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87114.1"
FT                   /db_xref="HOGENOM:HBG052924"
FT                   /db_xref="HOGENOM:HBG659007"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051F6A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ1"
FT                   /transl_table=1
FT                   /translation="MSAGQQQPKPLRCIITAHDPKSGKAVFSNAISEQVSFSGFPVPPG
FT                   KPPATDYVLAYNTNELPVKGLSPPSSTNPASKADLDIKHYQSHLSQPSPLPPVNGTSCT
FT                   IIEVPPGSAVPMHRTTTLDYAVIIDGTTELVLDSDEKKVLKKGDVIVQRGTAHAWRNVT
FT                   EQSDNSGVLRIFFVFLPIEKVQVESGLIDMDLTLSLKQT"
FT   CDS_pept        join(complement(31616..31721),complement(31463..31558),
FT                   complement(31168..31395),complement(30504..31105),
FT                   complement(30194..30472))
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056603"
FT                   /orf_name="AFUA_2G00170"
FT                   /product="Glutathione-dependent formaldehyde dehydrogenase "
FT                   /EC_number="1.1.1.284"
FT                   /function="S-(hydroxymethyl)glutathione dehydrogenase
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87115.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0051903"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520239"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIZ0"
FT                   /transl_table=1
FT                   /translation="MSTSITTHVSNYGEKHGDPSQTMKALTWQGNRTVKVETAIPKIID
FT                   PGDAIVKVTGSTICGSDLHLYHGAIPELQKGDILGHEFCGIVVTVGQGVQKVKVGDRVV
FT                   ASFQIACGQCYYCKQGLPTMCERTNTGESATRLYGHRMSGFFGYSHFTGGFAGGLSEFV
FT                   RVPYGDVNLLNLPDDVPDEKGLYLSDVLGTSWNAVVDTGVKEGNTVAIWGAGPVGQMAA
FT                   EYSFFHGAKRVILIDGGQGKWRLDFIKKILPKLETIDFANLPKGESVPSTLKKMCDGHG
FT                   PDVAIECAAGEYEKGWAHYFQRLLGMETDTSELVNEMLMSVRGFGHCGITGVYAGYVRG
FT                   TFFMCNHFNIGALMECGIKLHGNGQAPVQKYWKELLRYIQEDKIHPLDMVTHRFKLEDM
FT                   EKVYDLFDKREQGMQKVFIQTRFSAPPSPGSRPLTVL"
FT   CDS_pept        join(34771..34937,35005..35018,35081..35153,35208..35539,
FT                   35605..35963,36016..36213,36270..36500)
FT                   /codon_start=1
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265139"
FT                   /orf_name="AFUA_2G00180"
FT                   /product="Neutral amino acid permease "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87116.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG051937"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000051ECC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY9"
FT                   /transl_table=1
FT                   /translation="MEAINANPPPYRTEKVEETKYTSDYEEEGQLKTGQVADAFGNEES
FT                   AEIKYKTLKWWQCGLLMICESVSLGVLSLPAAVATLGLVPAVILIVGLGLLATYTGYNI
FT                   GLFRERYPRIQNLGDAGEILMGPIGREIFGLGQFLFFIFVMGSHILTFRVMMNTVTEHG
FT                   TCSIVFSVVGMVISMVLSIPRTMKGLTWISFASFLSIFGAVMITMISVGVQDHPGRIIE
FT                   ATVDTTLYSGFQAVSNIVFAYCAHVAFFGLIAEMENPRDFKKSLFMLQSFEISLYLTAA
FT                   VVIYYFVGKDVASPALISAGPVMKKVAFGIAIPTIVGAGVVNGHVGLKYIYFRLCHKSD
FT                   LIHRRSKRSVGIWIGLGLTCWVVAWIIAEAIPVFSDLNGLISALFASWFSYGLSGIYWL
FT                   HLNYGQWFASPRKILLTILNISIALFGLALCVLGLYASGTAIHNDTSSSSFSCANTDA"
FT   CDS_pept        join(38452..38666,38734..38856,38912..39041)
FT                   /codon_start=1
FT                   /gene_family="HOG000235020" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265140"
FT                   /orf_name="AFUA_2G00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87117.1"
FT                   /db_xref="HOGENOM:HBG052006"
FT                   /db_xref="HOGENOM:HBG328268"
FT                   /db_xref="UniParc:UPI000052022F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY8"
FT                   /transl_table=1
FT                   /translation="MIANVSTILPLLPLLAMAMPSTPEIATNKRSVTCLKVGAVATATW
FT                   VNSAGQSCSFVGVVGSNYGTNSAGTGDYSCNGRCGAGCTGTALGNAYTQDCFSHDICSY
FT                   FNNASGGPSDPNCGAAYDAAVDDFLLGVADGCSQTNPALSVSKPSSTPTCK"
FT   CDS_pept        join(complement(41128..41446),complement(41017..41075),
FT                   complement(40800..40961),complement(40623..40747),
FT                   complement(40487..40573),complement(40190..40433),
FT                   complement(39912..40107),complement(39331..39860))
FT                   /codon_start=1
FT                   /gene_family="HOG000087852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265141"
FT                   /orf_name="AFUA_2G00200"
FT                   /product="Catalase, putative"
FT                   /EC_number="1.11.1.6"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="EAL87118.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052085"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI000051EF4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY7"
FT                   /transl_table=1
FT                   /translation="MASHPLQAIGEAVGAAGADPRPMQLSSLFQGANDGPAKTAAKLTG
FT                   VQAAGKRADDGPYFTNNEAIPFPDPAHSKTAGGIPVASDTFLFQKQQHFNRSKPLERMV
FT                   HPCGSGAFGYFETTKDVSSLTKAHFLRSVGVRTPVFARFSTVTLGREFPDEARNPRGFA
FT                   VKFYTGEGNYDIVGLNFPVFFCRDPIQGPDVIRSQYRNPQNFLLDHNSLFDLLANTPEG
FT                   NHAGMMFFSDHGTPVGWRNLHGYGCHTFKVNKRGEFVYIKYHFIADRGQKQSTADEAIQ
FT                   MCGEDPDFSKRDLYQAIEKGEKISWTAHVQIMKPEEADPTKLGFDPFDVTKLHEFGKLV
FT                   LNKNPENFHRDVEQAAFSPGSMVPGIEDSPDPLLQFRMFFYRDAQYHRIGVNLHQIPVN
FT                   CPFMASSYSSLNFDGPLRVDANHAMNPQYAPNSFVHKFRPDTAEAPYQLADNTVSRKSH
FT                   FYHEGKLSEYDQPRALYQKVMDARGREHLHCNTARMLKVVEYPEIQLRYLTQLYCIAPE
FT                   YARGVYDLLPEQKFDFSQVKAQAQGAERVGKEAKFRPSKDTDILAGKCPATPVYNQ"
FT   CDS_pept        join(complement(43200..44001),complement(42726..43144))
FT                   /codon_start=1
FT                   /gene_family="HOG000181347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265142"
FT                   /orf_name="AFUA_2G00210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87119.1"
FT                   /db_xref="HOGENOM:HBG052161"
FT                   /db_xref="UniParc:UPI000051FB6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY6"
FT                   /transl_table=1
FT                   /translation="MALETLPAELKIHILKSMPDVETLHDLIRVSAAYRSTYRLSQRSI
FT                   LDRLVREHYGAVGLEEPIMAIRSAGLHAEDSANKQRILEVLDRQRVSDSVPSKLNPSDS
FT                   IDLLHLHQKFQTILNSLCSHARRPSQAEPLPQQQNAPLQLSSTEKARILRALCRLQTYC
FT                   NVFGAREWIEPADDICRSSTSPCKRTSSTWYKNFTIHEMWRLCFGSLAPWEVEEFGSVW
FT                   VLVRNEYKRMFDEIRQEFPRTDSRWRSLRPASLPADPWELYPSSSDDANDYDIYLNHLV
FT                   LLGPTFLHKVLSQNSREDRWRLLACNAISSKSSFMDTVRVVRDPSPRLWSVERFTSDDT
FT                   LQGLRAMPAIDQPNLGWKQHWHGRDVTGSEIFAFRSAVGESGDAQVRNFGHCAGWEWGY
FT                   ALWDAAS"
FT   CDS_pept        join(complement(46115..46367),complement(44733..46054))
FT                   /codon_start=1
FT                   /gene_family="HOG000051000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207907"
FT                   /orf_name="AFUA_2G00220"
FT                   /product="Aminopeptidase, putative "
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL87120.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG052239"
FT                   /db_xref="HOGENOM:HBG670222"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI000051E5EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY5"
FT                   /transl_table=1
FT                   /translation="MVASTIHLLCTAFALTAEGAALQLPLFGASEPQIPVAGKELISSS
FT                   ALQSQIDVGKLLNRAKHLYSIAELGSDEYNHPTRVIGSKGHLGTLDYIYATLTEFDDYY
FT                   TISNQTFPAVTGNVMESRLVLGHTVPESALPMGLTPPTKNHEPVYGPLVLVSRLGCEAA
FT                   DYPPELQGAIAFISRGSCPFGTKSALAGKAGAVAAVIFNNEKGGLGGTLGTPSPDHVAT
FT                   FGLSDSDAAPFLEQLRRGQKVDAIAYMDATVETITTTNIIAQTKEGDADNCVMAGAHSD
FT                   SVMEGPGINDDGSGSLTLLEIASLLPHYRVNNCVRLAWWAGEEEGLLGSDYYVSVLSEA
FT                   ENLKIRLFMDYDMLASPNFAYQVYNATNAVNPVGSEQLRDLYTEFYEAHGLNFTYIPFD
FT                   GRSDYDAFIRNGIPGGGIATGAEVIKTEEEQKMFGGVAGDAFDPCYHQLCDDVSNVNLT
FT                   AWEVNTKVRVDFCVYTRRRLLICTQLVAHSIATYARSFDGFPKRIKVESMKKGDEQRKY
FT                   HGHSLLY"
FT   CDS_pept        join(complement(48666..48719),complement(48568..48612),
FT                   complement(48473..48520),complement(47954..48423),
FT                   complement(47347..47892),complement(47213..47294))
FT                   /codon_start=1
FT                   /gene_family="HOG000116440" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265143"
FT                   /orf_name="AFUA_2G00230"
FT                   /product="Amid-like NADH oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87121.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052312"
FT                   /db_xref="HOGENOM:HBG328262"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000051E39A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY4"
FT                   /transl_table=1
FT                   /translation="MATPLKNIIVVGGSYVGRATAQELARVIPETHRVLLIEPHSHFHH
FT                   LFAFPRFAIVPGHEHKAFIPYTGIFSSVPRPSAHAVVQARVLSVSPQFVTLDRQWQDSK
FT                   QILYEYLAIATGTRLAEPAGMKSDDKVSSVQYLRNHQADIQRAKSILIVGGGAVGVQMA
FT                   TDLREYYPDKDVTLVQSRARVMPLFHEQLHELIKKRFDELGVRLIVGARASVPPEGFPT
FT                   NGKPFDVELTNGSKVSTEFVILATGQRPNNDLLTSLTSSSSGSLINPDNGFIRVRPTLQ
FT                   LQDERFSNIFAVGDIADTGAQKAARPGSVQAGVVARNIQALIEGRRAEEEYVPPPAAIH
FT                   LTLGMVSSILKEDAGLAEAYWRQKSNVIFRNPNTAEGQTEPWINEKTDGQVDMGVEGWW
FT                   ERLGVPVENTRSYHL"
FT   CDS_pept        join(49434..49800,49867..50136,50221..50495)
FT                   /codon_start=1
FT                   /gene_family="HOG000168975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751272"
FT                   /orf_name="AFUA_2G00240"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87122.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG052391"
FT                   /db_xref="HOGENOM:HBG324006"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniParc:UPI0000F51815"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY3"
FT                   /transl_table=1
FT                   /translation="MSTLQISEDNPFLTLITETNNDAVSNIQRFVIRDYVKPLYQDQLQ
FT                   SRYENHRVNRNAQQAAKILAPDFAGWDLDEILMRLDGPTKEEGFVDPRNCLVIWARPPS
FT                   PIRDLVEFVQSELRRVAPTLWFMPPENLHTTVLEIAHSLTEEQIEGLVNTLESSQNISS
FT                   ADIADHAFTHRTRLVKPMVGFDSAAMALTFVPAAGEASDAQRSIADETYTHLTIARFVT
FT                   QDGFVEPAAVGEEHLNPSKVKELIDKIEEINQKLQDEDWPSENGTIKAGGEWLIGQEKG
FT                   LAIRRGRLWYGGGNDVQLGKGY"
FT   CDS_pept        complement(50745..51623)
FT                   /codon_start=1
FT                   /gene_family="HOG000251171" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903339"
FT                   /orf_name="AFUA_2G00250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87123.1"
FT                   /db_xref="HOGENOM:HBG052476"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniParc:UPI000051F1BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY2"
FT                   /transl_table=1
FT                   /translation="MAFDQEGTAQLTETTTSYEPPPIYDTIADPIILRTLLVEDIYLLG
FT                   GQFAILCQFAHPALAKGSYNHSNFATRIPNRLQNTARFLNAAVFGTQQDKAAIFSIIHR
FT                   YHARVRAEDYDANDPELHKWTAATLFVAVVIVHETFFGELPRDKMEALYRESAVFGTSL
FT                   RMPPEMWPTTLAEFWEYWNHNIETLEVTDMARKLSRDLLYPVHLPMWMRVLAPLSRLLT
FT                   IYFLPERLAKEYDLQPTMLSRIQFQATVRVMRIAYPSMPQHLRQTLHRQYMEDLGKAVD
FT                   RIRKTGHWAGV"
FT   CDS_pept        complement(52219..53265)
FT                   /codon_start=1
FT                   /gene_family="HOG000185940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265144"
FT                   /orf_name="AFUA_2G00260"
FT                   /product="Phenylacetaldoxime dehydratase family protein,
FT                   putative"
FT                   /protein_id="EAL87124.1"
FT                   /db_xref="HOGENOM:HBG052484"
FT                   /db_xref="UniParc:UPI000051FFFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIY1"
FT                   /transl_table=1
FT                   /translation="MAQFPADMDRVFTAYIGVQQRGAQTDEGLLAESVDAAVNSIQRWI
FT                   AEGPSTAPASIEQFQVLDGDDVPNSTVWVCYWNEASKYEDSIRRLSLVNIHQQLSASHR
FT                   ESVGLWCERFASHLSRVETNYSGLDYLPGLARLPGVSTVEHTLTAYWGAARDRIPASAT
FT                   DRFAQNEGLGRTQLGPEPASPHKTSGYHVVGTNPDNIVHIRSGQFWANCAEDETNAYEE
FT                   ALEPTLRAGLAYLWDNPQTSGAMGLRYLYNRPLSSGVREKTCETKESCVAGFFRNLADL
FT                   EHWAKSHPSHLAIYTGAIKHAKKFGERRKFRTWHEVSVLKHGEAHFEYVNCVDRTGVIQ
FT                   GCVSLESL"
FT   CDS_pept        join(55061..55253,55299..56312,56369..56437,56493..57038,
FT                   57086..57360,57414..57577,57628..57883)
FT                   /codon_start=1
FT                   /gene_family="HOG000216899" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056604"
FT                   /orf_name="AFUA_2G00270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27300.1"
FT                   /db_xref="UniParc:UPI0000F51835"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V3"
FT                   /transl_table=1
FT                   /translation="MRQSLVLLALTWLLNAVIAVENDLIDLQPLARHVWDKDALRKRDD
FT                   PAGSVALQDHEQFMWTSGNEPNTKVTAVSMVVWSRQDERILDMDKISFALDSVSCTDGM
FT                   TLKFKNKLFYLAAKFAWEWVNYNDMRSFVMVSSWEGCGTPRERDPWVVSNAVFDDKAST
FT                   AKLAATKSTWQKVSNTTVLDFGDIVVGHQGTKDKRFLDVSLNKAFTLDVSSSFPTEIVN
FT                   WTMNTPFVDASLAINCVNCGTTGTLAFAGHVEASLFGGLEKFELSAAPRNIAANLDLSL
FT                   EFKGEVDFDGLPAPGKEWTLVELPLPSGWRVPGVLTFGPNVKINAGYTIEYIGGEASVT
FT                   TGISARVPDSSVAKVDLASKNPVTISGWIPEIETKPLEIEAQIHARAKLYTEVAVAASI
FT                   EAFDNGLNVEVGIKVPDITVTAAAGYTGFCANDPNKAYGVKLDAALGASLGLQGYTEVK
FT                   GERDVFLDVTLYETPTLYTFPQLCLAAGEESPGTCIPQSDPLDPDDGVAPGVLRRDTRS
FT                   SVALARRDADSAFYQGRDPYYLACDEGRTKQIWVQKYQRPSRLRNNAAVPIIQPGMSCS
FT                   NSAQNQCPASTWNIKEVPKDDRAGVTRQGWASEHIYEGNWVRDFIDYLVTNYYPATIED
FT                   PNVQDNTKCKGAMNTFGIQRDISTPNPTVAFNYSEALMQNLGTVHTASTLMAIFPNRQN
FT                   GMKYTMFAGNDIDGKFKTSEKNINQRVCSLGRIVTICQYMNHEEIRTRMKATIAAIDGL
FT                   LDTMQQDVNIYLPSSLKTETLKTAHAKFFEEKYKGGFRNARNRLQDYASWLQGQAGFGN
FT                   LDQATKDEVAKLASNPEAHCTEIWPL"
FT   CDS_pept        join(complement(58601..58739),complement(58370..58557))
FT                   /codon_start=1
FT                   /gene_family="HOG000048330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751273"
FT                   /orf_name="AFUA_2G00300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87128.1"
FT                   /db_xref="HOGENOM:HBG052512"
FT                   /db_xref="UniParc:UPI000051FDE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX7"
FT                   /transl_table=1
FT                   /translation="MEMQRAKVKSFHSTPGSNLMGSEYALFEAERTERVEERSTGIWDP
FT                   GAQIAQPEHNCGVSRRGNSEGNSWDGEVIGLINASFFEVVHIPETFQYRSYMDIYITAL
FT                   TDHV"
FT   CDS_pept        58880..60622
FT                   /codon_start=1
FT                   /gene_family="HOG000185918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903340"
FT                   /orf_name="AFUA_2G00310"
FT                   /product="Amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87129.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124519"
FT                   /db_xref="HOGENOM:HBG324256"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000051F6A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX6"
FT                   /transl_table=1
FT                   /translation="MADHPPSLPHVRDDQREAEILSQHLHPQFTGSLHEESPLQAQAAV
FT                   EASSSSDTPEQQSSLKLLGGDVHRDLYRLEAKAKQALQERRAASFSYPARPPDDVIEEG
FT                   VAAMEPGSFRRHFVQQKRGWASDALVARSFLDFLDLYGSFAGEDLAEPEDESAIAAEDL
FT                   EHEAERRPLLGRRRTTRAARPGDASRVKTFFTLLKAFIGTGIIFLPKAFRNGGILFSSV
FT                   ALVTVAAVTSLCFHLLLECRKGHGGGYGDIGERIAGPRFRSLILGSIVISQLGFVCTGI
FT                   IFTADNVRAVLSAVAEHSEKALSTSVLIALQLVVLVPLAFIRNISKLGPAALLADIFIL
FT                   MGLAYIYYYDIATIASRQGLASSVELFNPKSFTLTIGSCIFTFEGIGLILPIQSSMKHP
FT                   EKFDGLLYTVMIIITVLFTAVGALSYGAFGSDTKIEVINNLPQGDKFVNAMQFLYSMAI
FT                   LIGVPVQLFPAVRIMEGKLFGQVSGKRDPWIKWKKNGFRSLIVLACAVMSAVGAADLDK
FT                   FVSLIGSFACVPLVYIYPAYLHWKGVADSPLAKFGDLTMVVLGFVFMIYTTLSTAAVWI
FT                   QGHK"
FT   CDS_pept        join(61020..61243,61307..61812,61876..62153)
FT                   /codon_start=1
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265145"
FT                   /orf_name="AFUA_2G00320"
FT                   /product="Sterol delta 5,6-desaturase, putative "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87130.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG028850"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000051EF2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX5"
FT                   /transl_table=1
FT                   /translation="MDVVLDVLDTFVFDKLYALLLPAKSFDLLDQDSVVDYNSHINRYV
FT                   TLTPSQYAVESSLARDNILRQFLSLFITIWAFGLLLYLTTASLSFALVFDKRAMQHPKF
FT                   LRHQIRLEIGQALRAMPVMAALTAPLFLAEVRGYSKLYDFPTGSPFPLYTYLQYPLFIA
FT                   FTDFAIYWIHRGLHHPAIYKRLHKPHHRWIISTPYASYAFHPVDGWCQSLPYHVYPFLF
FT                   PLQKAAYLGLFVFVTIWTVMIHDGEYALDSPVINGSACHTIHHYYFNYNYGQFITFWDR
FT                   IGGSYRRPNRELFDKQQRLQQTEIQRQVEEMERLVKEVEGSDDRCYEQDTKKTS"
FT   CDS_pept        join(62537..62703,62754..63071,63119..63937,63990..64059)
FT                   /codon_start=1
FT                   /gene_family="HOG000241290" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751274"
FT                   /orf_name="AFUA_2G00330"
FT                   /product="Beta-alanine synthase, putative "
FT                   /EC_number="3.5.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amidines"
FT                   /protein_id="EAL87131.1"
FT                   /db_xref="GO:0016813"
FT                   /db_xref="HOGENOM:HBG251606"
FT                   /db_xref="HOGENOM:HBG583284"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI000051ECD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX4"
FT                   /transl_table=1
FT                   /translation="MAIIQCFRRANYRFLRRTSRGLSTACQGSGLKINANRLWETLHET
FT                   CQWGAAHRHGEDPTDTGMARLTLDDNDASVRRWFAAEVDKLGCSLSIDQMGNMFARQQG
FT                   KLQTSAPMVAMGSHLDTQPRGGRYDGILGVMAALEVLRTMKENGYQTYYDVGIVNWTNE
FT                   EGARFPKSMCSSGVWAGAIPIEKAWDLRDIHDSNVTLKSELERHGFLGQLECSHTAYPL
FT                   AAHFELHIEQGPILQETGRSIGVVQGAQGYRWFTFTVKGRDTHTGTTPLSARQDPLLAA
FT                   SRMIAASNDIARKHNALASTGIFKIPSNASTNTVASEVSFTLDIRQPQDGVVHTVQEEC
FT                   LQAFSAIAAQDGKGVTFDWTLDTDSPAVKFDQGCLESIQAAANHLVGPDQWMNISSGAG
FT                   HDSVYTSHHCPTAMIFVPCRDGVSHHPTEYCSPEHCALGAQTLLEAVVHYDRTKAQNT"
FT   CDS_pept        64452..65852
FT                   /codon_start=1
FT                   /gene_family="HOG000220594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903341"
FT                   /orf_name="AFUA_2G00340"
FT                   /product="Diaminopropionate ammonia-lyase, putative "
FT                   /EC_number="4.3.1.19"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="EAL87132.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG052541"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000051F1BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX3"
FT                   /transl_table=1
FT                   /translation="MHILLHCCKTLSPGKMSRRPIYFNPSAADERCDFSTIHGLRHFHH
FT                   SLPGYCPTPLVSLPEIATELGVKAVFVKDESDRFGLPSFKVLGASWGCYRSVVSHLGLS
FT                   PTVALDDVKQRLKESPVTLFAATEGNHGRAVAFMARQFGVTARIFVPASMDEETRNRIA
FT                   SEGAEVAISDGDYNLAVQEAWIASQNDGGLLVQDTAFDGYEEVPAWIVEGYSTMMTEID
FT                   EQLSQLGLQSTLTVTPVGVGSLGHAVVRHCKSRTTPIAVVAVEPDSGPCLISSLEAGTM
FT                   VSVTSSETIMNGMNCGTVSATAWPDLQRAVDAAVTVSSYESHCAVQYLASHSVRAGPCG
FT                   GASLAAIRRLRASGQAASLLHRDAVVVLLCTEGARPYPIPRDVAVEDVVGLTQVLTQID
FT                   SSNPTLSVADGVGETEIANYLAAWLAHRGIEYHRVEPVAGRPSIVGVFRGSGGGQSLMF
FT                   NGHIDTVS"
FT   CDS_pept        65937..66758
FT                   /codon_start=1
FT                   /gene_family="HOG000243774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265146"
FT                   /orf_name="AFUA_2G00350"
FT                   /product="Acetylornithine deacetylase (ArgE), putative "
FT                   /EC_number="3.5.1.16"
FT                   /function="acetylornithine deacetylase activity "
FT                   /protein_id="EAL87133.1"
FT                   /db_xref="GO:0008777"
FT                   /db_xref="HOGENOM:HBG052548"
FT                   /db_xref="HOGENOM:HBG728841"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI000051F8EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX2"
FT                   /transl_table=1
FT                   /translation="MKGGLAAALAALAAIKASGRTLRGDVIVAAVSDEEDASQGTRDII
FT                   AAGWRADAAVVPEPTMGAIAIAHKGFVWVEVDILGVAAHGSDSQAGVDAILQAGWFLQS
FT                   LEQYQKRLPIDDTLGQATLHCGLIKGGQEPSSYPQRCTITIEFRTIPAQSNESILEDVN
FT                   ALLSGIAKEKPRFRYAPPRLTISRPTQKLSADHPLVQTAVACATEVLVDGPGVISVPFW
FT                   CDAALLSEAGVPAIVYGPSGAGLHSKEEWVEVDSLQEMSRVFEKLIQELCA"
FT   CDS_pept        join(67194..67790,67839..69023)
FT                   /codon_start=1
FT                   /gene_family="HOG000185409" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903342"
FT                   /orf_name="AFUA_2G00360"
FT                   /product="Homeobox and C2H2 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87134.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG052557"
FT                   /db_xref="HOGENOM:HBG326508"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051EF47"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX1"
FT                   /transl_table=1
FT                   /translation="MDHPDYLHSLTSHSAPDPAENGTWFNADDTVDPTLFGINLQHDST
FT                   LDTNQLNNMYGLSSESWFDGNGPEASELFPSAATQDPGVLQAAGSTTEEIRSEMQTQTP
FT                   ATAIVSQSMLNVTQWLDGAHRPPQPCSYCRKHRLQCLILRTTPANPNPITACSSCVALF
FT                   RECSLARGEKRQPSRFETLSPVMGHLHGVTELEEDEGDQAEASAPDVNCVDRQKESKQF
FT                   VRRGVRILKEWFRDHRDFPYPSEDEKARLVRETGFSRKRMSTWFANARRRQKERFDTPP
FT                   AAQICRSGSPMPASRLTLMTPMERWQNSPPEEEAVPESAILNAISSWEVAPRSENEDAM
FT                   FDSFLNLDETSSHLGSSLSSMGSRRSESSTSVSSAWSHHSGDSSLPFPLHHPRPRVRRR
FT                   TRPRGPMNEGQYQCTFCTQSFKKKHDWLRHEKSVHLQLDAWICTPDLNDLQPGNLPSGC
FT                   RFCDHSASSIDHWNDHEFEVCAQKPIADRSFSRKDYLWQHLRKFHGCTKLPIENLDQWH
FT                   SARSDVRSRCGFCDASLPTWAARGDHLADHFKQGCRMHQWVGDWGLDPDMLGALQNAVL
FT                   PSERTMEATTDLPLSAG"
FT   CDS_pept        join(complement(71980..72862),complement(70207..71930))
FT                   /codon_start=1
FT                   /gene_family="HOG000185420" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903343"
FT                   /orf_name="AFUA_2G00370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87135.1"
FT                   /db_xref="HOGENOM:HBG052564"
FT                   /db_xref="HOGENOM:HBG327149"
FT                   /db_xref="UniParc:UPI000051E3B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIX0"
FT                   /transl_table=1
FT                   /translation="MASESQQSKQYLLPPVSELLRRDDTTNKNNNHNDNEDHSFLPKSW
FT                   NPFDRSPSPDRDYIRYQPASSTNDDPASPPAPREPALGLGITNTFPQSPYKRPGPDDAD
FT                   DGDLATKSPYPEPSEPSEPTPLQYQTSRTTLLPHSPEYIKCPTHQGIVQKRLSWVPITI
FT                   LVLAIYSTIFSGIYLVLALVKPRYGKKIGEDGGLAPSTASLLSALFAKTIELSYVTVCV
FT                   AFLGQVLSRRAITKGSRGITISDMSMRTWIMQPGSLIVHWETVRYSALTVLGVITLTAT
FT                   LVAMLYTTAAEALVAPKLRMGPLEPRVLVGNVSTEFANPAYLITHCSTPVTLAMDPEAA
FT                   GSTCLDLELVGQAYHNYQAYISAWSDLAKTNNGTTSTLAARPPPTGSLYDNTTVTGSWI
FT                   DIGNMTELSLRYGRMVNNVTAAMPHAGVIAAAADPRNGIRQPADVTGEGNFEIEASVPS
FT                   PAVNVLCVGMTEEELTPLVYERWPDGHNFNPLTWDYEGHQVVPVDWFNRTVVDDIFGWD
FT                   PTANAEVKQTPPVFGKLPIANNTITNSTGFWPTNAIYILGAAPNKTMKPPFVLCALRAK
FT                   LSPVCSTKYSAAASGASFSAHCENPANPLQYNHRNQSAHDGVWDGNWKNVAGEWARSLS
FT                   LNSGITDGRASNARLLMQFLPTLDPRTKTYSLDPKLPSVGEALAVLAGSTLLLGSRNAP
FT                   FVQFFNYTKPDNVSAEPVSQYFEATVRAVGYASGGTEQWQNVFYLILVFAFLTSAIILA
FT                   FMLFEVRGRQITDFTEPQNLFALAMNSPATAQLQGACGAGPQGRQLNERFYVAMEEEDE
FT                   HYYIRTKAEENVRPASMRARRSMASMEVDEMPKAVSPAMDEYRRLSSRSSLLSRFY"
FT   CDS_pept        join(76008..76383,76435..76638,77178..77500)
FT                   /codon_start=1
FT                   /gene_family="HOG000048331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265147"
FT                   /orf_name="AFUA_2G00380"
FT                   /product="GNAT family acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL87136.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG052574"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000520015"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW9"
FT                   /transl_table=1
FT                   /translation="MVFALDTATEADAPRIADIHMAAFHTNGMLLAQFPTPAVRKGLWT
FT                   SLVDKVVKEIRDPQWEVLVAREADDRVVSFAKWCLPLSESTVYEEEPWVWPEGTNMAIL
FT                   NAWVKKVEQAAKEIMGKTPCYRLSFIATDPSYALRGAGSLLVNWGIERSKEENIPIALE
FT                   STLDAVPFYQRLGFQTEARISMPLEGIGKDVLAEMPWNVVMVWENGNQVISSLKNVTAH
FT                   IQVSPRRRHRAWLHPQHKRAPQRAVPPQVQVPYGRLEMNTIPGFEQFGLNDQEEYTGHT
FT                   FLSHTLPGRERLAQLLDQS"
FT   CDS_pept        join(complement(79675..80248),complement(79557..79622),
FT                   complement(79295..79509))
FT                   /codon_start=1
FT                   /gene_family="HOG000048332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265148"
FT                   /orf_name="AFUA_2G00390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87137.1"
FT                   /db_xref="HOGENOM:HBG052580"
FT                   /db_xref="UniParc:UPI000051F8EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW8"
FT                   /transl_table=1
FT                   /translation="MGAPNFYRSGLVSLLFVSLCVSSLANADYNRFCPDKTSQIQVDST
FT                   FYTVACDTSYISPAPKKVREGASPEDCARLCTAEPAYHAIVWYLGNCWQSDKTDAVSFR
FT                   VPGAVLLTPGEKHDHATGTSEEQKQCLAEKEQLAQKNDQCGRSLEQCETEKSSISAAKT
FT                   TCENSLEAANKEIARLSNQQTVTDRFVPTEKDDGLEIVVGGKRWKIYYSKLNDPGAWDV
FT                   GTLSQPSYMACMELCASKPTCVRTAWVNNYAGANTCWMRSYGQNTVQTITRGWTSTHLI
FT                   APA"
FT   CDS_pept        81102..83219
FT                   /codon_start=1
FT                   /gene_family="HOG000048333" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265149"
FT                   /orf_name="AFUA_2G00400"
FT                   /product="Cell wall cysteine-rich protein "
FT                   /protein_id="EAL87138.1"
FT                   /db_xref="HOGENOM:HBG052588"
FT                   /db_xref="InterPro:IPR006150"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="UniParc:UPI000051E39F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW7"
FT                   /transl_table=1
FT                   /translation="MKHPLALLLATGVLQVSCQQAPGFSKVLDYPSRLITLDDIVPFTW
FT                   RNPTTAETDVKCCPKGTLYDGTRCLLYYKGICPENMIFEDGMCVHTKGPQCPPGFKYQD
FT                   HLCVSTQHPICPSESTWINGTCTLSIPPRCDAGYEFKDGHCVYQEGPQCPHGFFPENGR
FT                   CFSRSNPDCPDGLRYDGESCIARDGPSCGRQDLVVLDGKCVSKEQPQCPPGYKNDGSHC
FT                   RLTRDPECPPGTVPRNGQCASQTPPTCTSGRFENGQCRTDQTPQCPPGLDLENKRCVRR
FT                   ENPVCPPGFASSFHRPSQTGRCCPTAWTWDGSSCILIPSDPASCPEGTKFDGEKCVTTS
FT                   LEQPLCETSLELRDGYCISEETPICDVGVWNGQYCLFDETPHCPSPTRFNGVECVSTQP
FT                   PTCPPGSHVHANQCRGDKPASCPPPLRLVKDHCVDATPPECPTGFTLVGTVCRSVKPPH
FT                   CPDGQMYWNGNCIIPTTPQCPDGFPPVGDKCLADVQPECPPGFRVEGKNCVSTENPECP
FT                   PGLDRVGADCVHRGSPSCAPGTVPDGNRCISLVPPQCPDGLVPRGSECVANDNPECPPG
FT                   FRFLDNHCVSENKPQCPPGSTLVGEECVVEKAPDCPPGTEFHSGMCVSTKRPECPPGLE
FT                   LKNNKCVRTSEPECPRGQKFNGSFCASTDDPQCPEGTSYDGARCSVNANPSCYELQYCP
FT                   PTAPSRNVLVK"
FT   CDS_pept        join(complement(83711..85572),complement(83465..83657))
FT                   /codon_start=1
FT                   /gene_family="HOG000185431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903344"
FT                   /orf_name="AFUA_2G00410"
FT                   /product="Amidase family protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL87139.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG052595"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI000051EF2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW6"
FT                   /transl_table=1
FT                   /translation="MNPWKSVFVKCLFFCTAVSGISNREIPMTDVQPSAQGITYELGNV
FT                   TYFANIEHPRAIFDLDYTTTSRLVPSAVLLVNQSLVTGSYLKSTISSYLTDDDVFSADF
FT                   LHAIYFTSTVPRSRLDSTAEEYLRSLGVAGLLFNASSFDRIPSNGYALKEDHDAPLPPG
FT                   PFTILVNNGSISFLDTYRLYVDNFRTFVTGVYSSNDGVGSFAALPAMNPRLGGPLIPAP
FT                   SRIHSWNDDRPLAGKRVAVKDLFDIKGLQTSAGSQAWIHVTPIADSTAPAIQRLIDLGA
FT                   VIVGKSKLAQFASAADPWNWTDEQAPFNPRGDGYLTCSASSSGGGCGIAAYNWFDAAIG
FT                   TDTGSSMRRPASVSGTFGNRPSQGMMSLEGAVPLNAGEDTVGVFSRDPVEWAEFAKAWY
FT                   TPSLHQDPSINSLPPLSVPDTTAFPKRILYPVEYLPLANPAAQAILDKFLHGMIRVFNM
FT                   TIERTNFTATASNASIYPGAAGDAMVNWNLLYDAGATLQLWTQSTKVYGPLISTWAARN
FT                   DGRFPPVDAQWREAWTRYDASHITQSGYEQALHTKAAAVNWFQEEVLYETSDSCSEAVM
FT                   ICDGGTGGLPSFREQALNNSPNATFMSVFPEHADVSCSGICTLFGCVDFTIPLGQVDYY
FT                   SPVTMVTEQWPVTINIIARRGCDFMLFNMIKQLAEEGVLRSVTTGRTAF"
FT   tRNA            complement(87109..87180)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(88794..88816,88861..89186,89236..89945)
FT                   /codon_start=1
FT                   /gene_family="HOG000168864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751275"
FT                   /orf_name="AFUA_2G00420"
FT                   /product="RTA1 domain protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87140.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052450"
FT                   /db_xref="HOGENOM:HBG330893"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051F1B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW5"
FT                   /transl_table=1
FT                   /translation="MNPISQLILSLDLPSNTCTPTINPDANGWVPATECNALYNYYPSF
FT                   GVAIAFSVLFGVLMVPHFIQATVYKAGFVWFIVMSAAWECVGFVVRTLSTREQQDNTLA
FT                   TITQLFILLSPLLEGVNAFDYMVLARMIHFFVPDRRIGIFKPSMLAMIFVVLDLGSFVI
FT                   QLTGGSMAGAGADHDTMMKGIHIYMGGIGIQEFFIVLFLFIAIQFHRQMLHLNRHGRLV
FT                   GPKAKWRGLLYALYASLLFITVRIIFRLVEFSSGNDASNPILQHEWYMYVFDAVPMWFS
FT                   IVVWNVVHPGAIIKGPDAKMPPSPLRKILCCAFCCSGCRKRKNKDMQMIPDNDHLGDET
FT                   LPLRERAASPYR"
FT   CDS_pept        join(complement(93677..93690),complement(93294..93589),
FT                   complement(92822..93240),complement(92400..92774),
FT                   complement(91875..92351),complement(90737..91825),
FT                   complement(90342..90689))
FT                   /codon_start=1
FT                   /gene_family="HOG000185486" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207908"
FT                   /orf_name="AFUA_2G00430"
FT                   /product="Exo-beta-1,3-glucanase, putative "
FT                   /EC_number="3.2.1.58"
FT                   /function="glucan exo-1,3-beta-glucosidase activity "
FT                   /protein_id="EAL87141.1"
FT                   /db_xref="GO:0004338"
FT                   /db_xref="HOGENOM:HBG052608"
FT                   /db_xref="HOGENOM:HBG330508"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051E3B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW4"
FT                   /transl_table=1
FT                   /translation="MSNNGTITFPIQNKTARPWDPVTQGSTGNLTSHDRQKRASCGGPT
FT                   PDNPSKFWLETITHSGESSFLDSSYKHNYKVFRNVVTDFGADNTGAKDASAAIQNAINA
FT                   GASNGPNRASHSMGTTGQPAIIYLPAGTYLMEGSLQLYVGTVIVGDALNPPTLKASANF
FT                   PNDHIVYGKDPHLGGTINFYIGFKNVIIDSTSVAASKSITLLDWTVSQATQLTNVVFNM
FT                   PTYSNHVGVTSQYDSNSNIILNDLTFNGGAIGMELSGQQWILKGITINGANVGIKAGAF
FT                   QLVCLDCNLSNGATGIDASGISGSLTVIDSSGNSLGNMIVSSNAGGSAQNSIILENVQC
FT                   TNSGSTVSLNNNAVLSGSVTSTWVHGNMYSGGATTPTHAQGSQVTTPRANVLLGANSKY
FT                   FTMAPPTYAQYSSSQFINVKTVSGLPVMGDGATDDTANINAILAQYAGCKIIYFPAGTY
FT                   IVTGTIFVPAGSIIVGDAYASAISATGSNFWNPNAPTTMVKVGNAGDVGVAQFTDMMFT
FT                   VADVLQGCKLVEVNIAGAAPGDVGFWNTHFRIGGAVGSKVQTSCYGSPDQCKAAWGLLH
FT                   LTSTSSAYIENMWGWTADHDLDGNGGTTTIATGRGLLVEATKGTWLVGTAMEHHTLYQY
FT                   NFEYAQNVFSAFQQSETPYWQGWGSPDLAPAPWSSNLIASDPNFSNCDANDAGCRMAFF
FT                   ERIRGSSNLFLYGGCVWTFFNHNGGCNGDCQANAVRILSSAGSVYLYGTNVKAISNIVL
FT                   ENTAAAAKESDNSGGWGGVVAAYLHNVGSGSRRRRSSNANGAAVTGNGLNWYSSSLTSG
FT                   AAGYQDPEYYYCFRGSAANFPPIQNWMGFTAMFDLNQQTSMALVESGPIQGAIWNAIVE
FT                   VSAAAKVDPRLILAVVMQESSGNVYVGCTNNGVQNCGLMQAYAGSVSFNPNDPQGSITQ
FT                   MIIDGTQGTAQGGGLVQWFNNENVGANTGGNPYNVLRGYNSGSINFNDLDDPQGATASY
FT                   VSDVANRLQVSSVCQN"
FT   CDS_pept        join(95387..95552,95603..95689,95992..96173)
FT                   /codon_start=1
FT                   /gene_family="HOG000216901" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751276"
FT                   /orf_name="AFUA_2G00440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87142.1"
FT                   /db_xref="HOGENOM:HBG052615"
FT                   /db_xref="UniParc:UPI000051E858"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW3"
FT                   /transl_table=1
FT                   /translation="MVSTYRFSSSSRNIALLSIFAVVAGGYLAFRAQSPSKNEPLVSKK
FT                   EVETMSGSPAGLMAYFSVEMKAVLTVLFVRLRVDESDLFAQMCRYMPVSHPVIAQHRPT
FT                   GAAPRRHGVACEAAESIRWSVLANPENLHKKDIEMMVRDS"
FT   CDS_pept        join(complement(97383..98153),complement(96508..97329))
FT                   /codon_start=1
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207909"
FT                   /orf_name="AFUA_2G00450"
FT                   /product="Hexokinase, putative"
FT                   /EC_number="2.7.1.1"
FT                   /function="ATP binding"
FT                   /function="hexokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="EAL87143.1"
FT                   /db_xref="GO:0004396"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG130961"
FT                   /db_xref="HOGENOM:HBG522186"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI000051E5EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW2"
FT                   /transl_table=1
FT                   /translation="MSTTASVVVTSRMSALGGSHRDMANYLLAPTPRLAQKVTGDALQD
FT                   EFTQLRELFTVDSAKLKQITDHFVHELEIGKYILPGYLDAVDANMFQGSVAKAATLYVI
FT                   TAYCLPATIQANGNEQPMNPTWVMELPRGDEKGAFFTMDMGGTNFRVCKVTLNGTAGKY
FT                   DVIQMDNKIPKSLKSGTAEQLWHYVADCLQQFVDRYSISQKELAETPLAFTFSYPVTQT
FT                   SISHGILQRWTKGFDIKGVEGTDVVAALQKVLKDKNLPARIVALVNDTVGTLMASSYVD
FT                   PKTEIGSIFGTGSNAAYMEQCSKIPKLADQHLPDDAFMAINCEYGAFDNSQRVLPFTVF
FT                   DAEIDRASPRPGQQRYEKMVAGFYLGEIFRLILLDLHNRKVIFDGQNSSKLSEPYVLDC
FT                   CFLATIESDNSADLQTVKDTFEKTLSITPTPPELRFCYDLAHTISLRSARLYACGIAAI
FT                   MKKRGLESCHVAVDGSVFNKYPCFPERAIGALREILEWPADTPDPIRLIPAVDGSSVGA
FT                   AVIASLISKSQQS"
FT   CDS_pept        complement(100348..101055)
FT                   /codon_start=1
FT                   /gene_family="HOG000048334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265150"
FT                   /orf_name="AFUA_2G00460"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87144.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052627"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F437"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW1"
FT                   /transl_table=1
FT                   /translation="MGFVYPQLFVTPKYPTQEFPGRTVIVTGANVGLGLEAARHFCRLG
FT                   AAKVILAVRNTAAGEIAEESIEKSTDRRGMCEVWELDLASYTSVQAFAAQASRQLSRTD
FT                   ILVANAGIATTQYTVAEGHERSLTVNVISTVLLAMLLLPKMRETALRFPSEIPHLSVVT
FT                   SEVHAWTNLPEWKADDVFAALDNETTADHAIALCGLEASADSDCTGTRVEDGWFWGRSE
FT                   HAPAWDVSFAADS"
FT   CDS_pept        complement(101402..102655)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265151"
FT                   /orf_name="AFUA_2G00470"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87145.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052634"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051FFFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIW0"
FT                   /transl_table=1
FT                   /translation="MTPPSSHGYGRFRLDSARGKPRKTVQTGRRSHQKSRTGCRTCKKD
FT                   RLKCDETHPTCRRCSQRKRMCEYDGIHRYYSESSTACSPVVASQGGLSLEHSLMDGLIN
FT                   QSFTHSLSITNTTHLMHNLVGSVHTSLATPIGKFLFDHYILPHCAATPRLLHSLFALSA
FT                   RHLQHLQPRCLSHTTAHYFHASHAAELLNDELGRVASSPQNLGMIYATCIVLNMGCFAS
FT                   DDYHPSSSWVFQDTAEIDQSFTWFTLQSGLGYVSSMLKNQVHQTFWRLKAGSRGSSIGN
FT                   LLTWATKDPSHTGSLEKIPDFLLDLCEITPDSSPENNPYYIPICLLSQMLPLKKPVAQE
FT                   FDHLLIFGPLIPHSFRILLRDRDERALVLFLIWLRLLGRGDFWWVNTRVEAESRALMAF
FT                   LRHSEDGEIRSVVDKIDF"
FT   CDS_pept        join(103064..103217,103249..103338,103486..103824,
FT                   103855..104219,104322..104363)
FT                   /codon_start=1
FT                   /gene_family="HOG000250275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265152"
FT                   /orf_name="AFUA_2G00480"
FT                   /product="Aryl-alcohol dehydrogenase (AAD), putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87146.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000051F8FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV9"
FT                   /transl_table=1
FT                   /translation="MDFQTPEPPTELGRYRILSSNCGLRVSPLQLGAMSIGEAWSSFMG
FT                   THEQGAAGGNFIDTANAYQNEQSEAWIGEWMSARKNYWIDILYLHWWDHTTSIEEIMNS
FT                   LHILVEQGKVLYLGISDTPAWIVAAANAYAAAVGKTPFCIYQGRWNVMLRDFEREILPM
FT                   ARHFGMALAPWNILGSGKFQTREQVEERKKKDTTDNQTEAEIRMSEALANVAAEHGIKS
FT                   VTAVALAYILCKAPNVFPIVGGRKVEHLHDNIQALKIKLTEEQIKYLESVNHFDPGFPS
FT                   NFLGEDPRVSGKAGRLLATSAPLAFVRAPTAIGYEYLRIGTVAAPRLY"
FT   CDS_pept        join(107482..107774,107849..108077)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751277"
FT                   /orf_name="AFUA_2G00490"
FT                   /product="Glycosyl hydrolase, family 31 "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87147.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG052650"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051FDD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV8"
FT                   /transl_table=1
FT                   /translation="MGRVPGCPDGAVELQHRHAEYRELYVRWLQWATLLPFMRTLGSRK
FT                   CNVQNAHTCNNEWWSYGEENTPMIVSYIQLRYQLKVYLQALFEQIHHTYDAAVTCLACG
FT                   CLSSGDDTQCTEWEVYLPQKGQSETKPWTYRWTNETYAGGLTVTVPAPIEHVPLFYLGK
FT                   REDIMSGCVF"
FT   CDS_pept        join(complement(109648..109690),complement(108274..109625))
FT                   /codon_start=1
FT                   /gene_family="HOG000185508" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903345"
FT                   /orf_name="AFUA_2G00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87148.1"
FT                   /db_xref="HOGENOM:HBG052655"
FT                   /db_xref="UniParc:UPI000051ECDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV7"
FT                   /transl_table=1
FT                   /translation="MLWTLLLAALQGHIDDIGLTRSALGLAVTASSITISPSPTSESST
FT                   TSGQWLIISGTSIFWPTYTDYFYGPTTGPEAPVVTCNAKWVEYYGRSDGLRSLGPTGTS
FT                   ITFDPYPTSGGACRTSSSLEGYSDTHTGPVTTLCDGIPRALGPREMVTSYYPGTGPCST
FT                   YTITFTDTVELYQEPPAPDCELNTQECIPIWSTYSELSSSYDATATTVTPGDTKSPIPP
FT                   DGCPSTTRTYPEDPCTACHFLPGTATVFYWPVTTAGGDLCLQNGTTIPATPTGNGPNTA
FT                   VVNGQTFVSPSIYVSFTSIYAWSNRRAHPGSQCGDTHNDAIIAVDPASVSSVRNHRNAK
FT                   YPTIGTAYPFNFAEFMPQDVGNYTMPLIPWPQYRGGSQCPLYDPSCTMIRDDYMPFLDL
FT                   PEAVRQIDPLWTQCDAHWYIPPVTLVPLTGNVNVQPTPTAEANVMAAMAVPESVAAVPT
FT                   PEATGW"
FT   CDS_pept        join(112578..112737,112790..113458,113509..113837)
FT                   /codon_start=1
FT                   /gene_family="HOG000216903" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751278"
FT                   /orf_name="AFUA_2G00510"
FT                   /product="Cellulose-binding GDSL lipase/acylhydrolase,
FT                   putative"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87149.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG052665"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="UniParc:UPI00005206F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV6"
FT                   /transl_table=1
FT                   /translation="MLHISIVAVTASLALVLSANAQAALYAQCGGEGYSGPTSCVAGAV
FT                   CTVWNPWYSLRSMRPWNKHCTRHCAKYDNNDNNDNNDNNHNNHNNEHRYTHRAKVLHHF
FT                   VSYPKLPIERSWAHPASGDSYSQTGFDISSTKPSASNPLGNPTLPGWTTSGGLNWVGFL
FT                   VSKYNTSLTLSYNFAYGGATTNASLVAPYTSTVLSFIDQVTEFTNSIASKPSYAPWTSG
FT                   NTLVGVWMGVNDVGNSYWLSNIDELLLKIMDSYFGQLQILYDAGVRNYVLLGVPPINRS
FT                   PLMLAQGTDVTTAEAAVIAKYNNLIATYLAQFKSKNSGVTATVVDTQAPFNQALDNPTA
FT                   YGAPDATCYNSDGTSCLWFNDYHPGIAIQDLTAQAVASALKELFF"
FT   CDS_pept        join(115045..115257,115313..116017)
FT                   /codon_start=1
FT                   /gene_family="HOG000185519" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265153"
FT                   /orf_name="AFUA_2G00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87150.1"
FT                   /db_xref="HOGENOM:HBG052672"
FT                   /db_xref="HOGENOM:HBG325783"
FT                   /db_xref="UniParc:UPI000051E84A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV5"
FT                   /transl_table=1
FT                   /translation="MYSHTIVSSFFASCCLSGLATASSPLHDADGKPDYSFDELWSLET
FT                   GFWDVFLYPTNVAQINATDDSVFAENVQGRVDITRTFDGRELNNEYIFGLFSDPDHLSL
FT                   VGVPIAYSITQFTANDDIASATTVVTFNSTSFNIIIPVTIDTWIEWDAQKKILQYDATF
FT                   RWFGPLLDALLKAQAARMNTTDPVVVQAALTQLLADTICQTHEDHCQGEYQQYESRDAC
FT                   MDFLTNKTRFGQAFELGRDTLLCREVHEHMVKYRPDIHCSHIGPTGGDYCVDDLSYEQV
FT                   VLEKYFRDSFIAYGHGQEQNIWVA"
FT   CDS_pept        join(complement(116797..117163),complement(116718..116747),
FT                   complement(116069..116670))
FT                   /codon_start=1
FT                   /gene_family="HOG000169986" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056605"
FT                   /orf_name="AFUA_2G00530"
FT                   /product="DUF1275 domain protein"
FT                   /protein_id="EAL87151.1"
FT                   /db_xref="HOGENOM:HBG052680"
FT                   /db_xref="HOGENOM:HBG330503"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniParc:UPI000051ECC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV4"
FT                   /transl_table=1
FT                   /translation="MLHRLAWTDWPGLISGKSVPISPHSAANNQGLNSAWGKIRRSHEV
FT                   FWNCHFEDIPRFPTSSLLQFCFSLQRSHQESVTMSTSLDSKKSVAGFLKRDINAKHAEV
FT                   LLYGCCLSSGLVDSTLYNAYNTFVSMQTGNTIFVGLGASNQNLKPYGWARSLTSIGCFV
FT                   IGCFLFARLNRLLGPRRRVTLVLSFLLQVAMLVITASLVQSGVIAGIPSNPASSETHWS
FT                   QEAPIVLLSIQSAGQIVASRALGFNEIPTVVITSLLCNLVSDPKLFLLRNEKRDRRMVA
FT                   FVLTLIGAIAGGWITKATRDISPVLWMAAGLKLIISVSWIFWRENEGASAV"
FT   CDS_pept        join(118257..118466,118523..118670,118718..119340)
FT                   /codon_start=1
FT                   /gene_family="HOG000220040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207910"
FT                   /orf_name="AFUA_2G00540"
FT                   /product="Carboxyphosphonoenolpyruvate phosphonomutase,
FT                   putative"
FT                   /EC_number="4.1.3.30"
FT                   /function="methylisocitrate lyase activity"
FT                   /protein_id="EAL87152.1"
FT                   /db_xref="GO:0046421"
FT                   /db_xref="HOGENOM:HBG421907"
FT                   /db_xref="HOGENOM:HBG728656"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI000052047D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV3"
FT                   /transl_table=1
FT                   /translation="MSITITVEKDGFYEVNGESREPTVNLYMIAGATKLRRYLRDTDEL
FT                   IVCPGVYDGLSARIAMQLGFRALYMTGAGTTASRLGMADLGLAQLYDMRTNAEMIANLD
FT                   PFGPPLIADMDTGYGGPLMVAKSVQQYIQAGVAGFHIEDQIQNKRCGHLAGKKVVSMDE
FT                   YLTRIRAAKQTKDRLRSDIVLIARTDALQQHGYDECIRRLKAARDLGADVGLLEGFTSK
FT                   EMARQAVQDLAPWPLLLNMVENGAGPVITTKEAKEMGFRIMIFSFASLAPAYLGIKSAL
FT                   ERLKNEGITGIPEGLGPKKLFEVCGLMDSVRIDTEAGGDGFTNGV"
FT   CDS_pept        join(complement(121593..122008),complement(121446..121516),
FT                   complement(120903..121403),complement(120662..120817),
FT                   complement(120504..120595))
FT                   /codon_start=1
FT                   /gene_family="HOG000216905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265154"
FT                   /orf_name="AFUA_2G00560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87153.1"
FT                   /db_xref="HOGENOM:HBG052693"
FT                   /db_xref="UniParc:UPI000051EF4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV2"
FT                   /transl_table=1
FT                   /translation="METRVVMDEGRYAAEPIDLINGIRQLYSLALEAEERCPRQTEETE
FT                   EMRHAAMKLIQQKAQHIVDLTNRLNDLQYHPDILDDDEATQAIVSLNHKLDVWVKGTFR
FT                   NPELLENLPRLKLVHVPYSPLPLETTDSSQRPQQNPDTVDNLISMELDIFEKCMFPSGS
FT                   PGHVAGNWRLATSMAIESFNRGYLEDTAMHCMKAIAQLSSCASASPEVREQKLYGLFQS
FT                   CLHFKRRLGRQPTQYRFSHASSGDEFISGTMQSLTGEEGQGAVVEFCLWPVLWKGDVLL
FT                   YPETVWSKIDDTSVEDSIPGRETALISQYEADFRSQIQGSPRIHLQTHNIFAVFLSSPC
FT                   LLRSMRSMALWVLEQLTHLPVLLPLHSASVFCVASASHSPVYYSQDMKPSGLPNYFSTQ
FT                   SLPPLPLSDLHA"
FT   CDS_pept        join(122164..122219,122288..122468,122538..122597,
FT                   122731..122883)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265155"
FT                   /orf_name="AFUA_2G00550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87154.1"
FT                   /db_xref="HOGENOM:HBG052700"
FT                   /db_xref="UniParc:UPI000051EF3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV1"
FT                   /transl_table=1
FT                   /translation="MRESSCIMRISFTDTCHRCGAVVRGLGGNQVGQRIARCHYVVTFV
FT                   EEYNSRLHSARDKYWDAVTETWCVDGRMKWYIEKGKPISEDEPIRMSWHQHVSKSRSLR
FT                   GLHLEGRPQRNTTVLIPQLHQFLGADILRCCFRDCHDVYFGVYFI"
FT   CDS_pept        join(123553..123624,123676..123978,124028..124414)
FT                   /codon_start=1
FT                   /gene_family="HOG000185541" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207911"
FT                   /orf_name="AFUA_2G00570"
FT                   /product="GNAT family acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL87155.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG052708"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051E393"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIV0"
FT                   /transl_table=1
FT                   /translation="MDNFCFPLDLSKLEDDRLRLVPFDSNFEELSATYVELSSETPEVF
FT                   QYLPYGPFESPEAYDQWYSNRIRPTKESIIFAIILKAGIVRKRKPGSDQFEELKVEDGT
FT                   FAGTTGLIRADPANSVVEVGNVVILPRFHRTFVGTAAHTLLLTHMLDPPPNGLHLRRVQ
FT                   WQAFSDNQASIAAAQRLGFQLEGIIRWQRVLPEGKKGNANGVIDDKMPGLDPTGQKKLG
FT                   PGRHSAMLSLCWDDWENGARERLHALSQKYA"
FT   CDS_pept        125715..125945
FT                   /codon_start=1
FT                   /gene_family="HOG000185552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265156"
FT                   /orf_name="AFUA_2G00580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87156.2"
FT                   /db_xref="HOGENOM:HBG052715"
FT                   /db_xref="UniParc:UPI0000F51843"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU9"
FT                   /transl_table=1
FT                   /translation="MSSKSFKSTTTLDNASTRTTSSTASTLKGMFTKSWKLKAPEKAPS
FT                   SPKPSSKKAPAKDYTGEAVHHEAVAQYLALR"
FT   CDS_pept        join(126934..127086,127136..127696)
FT                   /codon_start=1
FT                   /gene_family="HOG000185567" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265157"
FT                   /orf_name="AFUA_2G00590"
FT                   /product="Glutathione S-transferase, putative "
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="EAL87157.1"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG052724"
FT                   /db_xref="HOGENOM:HBG332425"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051F44B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU8"
FT                   /transl_table=1
FT                   /translation="MSAPKITLYTNHRCPWAHRAHIALKELGLDYEEVIIDLNTPREPW
FT                   YLEINPRGLVPAISYNGTIITESAIVAQFLADAHPSHLLPPSNSVEGALQRARIAFFVD
FT                   TFFSKVAPHFLASQRATSDQDRVAAGEAIVAAIEKELEPILASQKGPGPFFGGREKLTL
FT                   AEVLIGSFLLRLLSFHKPEHGLLREDLPQLLEKRTPAFTKWANATVEQESVNFIWDEKS
FT                   VVELTKKKIASLAKK"
FT   CDS_pept        127896..128492
FT                   /codon_start=1
FT                   /gene_family="HOG000216906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751279"
FT                   /orf_name="AFUA_2G00600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87159.1"
FT                   /db_xref="HOGENOM:HBG052741"
FT                   /db_xref="UniParc:UPI000052048A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU6"
FT                   /transl_table=1
FT                   /translation="MVAVQSRFIMNASNVNDITQDARLRVRMGLYSRAAILQQLVDIYE
FT                   LPEHGTTVVQQLIQSLWNQQREEESTWPDQPTDVEKLQAAFSRLEDEDRIICRMDYTCC
FT                   QTCGDAEIGGEANESHTGYCFFHRQDTEAAVRGGGLSLRYSDLEEDSKDESLVHIGRKI
FT                   AARRREEGLTVDWNGDPRKTIELYPFQWRVRLGRS"
FT   CDS_pept        join(128867..128896,129082..129208,129256..129262,
FT                   129309..129345,129390..129442,129487..129619,
FT                   129659..129816,129866..129959,130005..130061,
FT                   130105..130341,130389..130691)
FT                   /codon_start=1
FT                   /gene_family="HOG000185578" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207912"
FT                   /orf_name="AFUA_2G00620"
FT                   /product="GDSL-like lipase/acylhydrolase domain protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87160.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052746"
FT                   /db_xref="HOGENOM:HBG324032"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI0000F5184A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU5"
FT                   /transl_table=1
FT                   /translation="MVLETGFSAVARLNPYPGQAEIITLDKKTWRNYKPSAKEISYKGR
FT                   WDDKHISWWSAPGFKLAFTGAKLALSFGQYTSQGVLVAYRLGGQDWQFSNVTANATYQF
FT                   IGPTTTGLNLTNAGDAKSFELRGRHLQTGPTDTCPRSVYRRNLLTMSTIQLAGVSVAAD
FT                   ATISRIDEYPKMVEIIGDSLSSGDFATYEGLSSWAYDFAAGLGNVEYSITAYPGICLHD
FT                   QNCWGNPRGQAYQWYRTSDTSWRAHEIYGDNPPKWNFAAQRPADLVVINIGTNDNNPAN
FT                   NVSSTDYYNDYITLVGNIHKIWPKADIVLMSLWGGFGASGDTYVQGPLWVDEIKRVYQH
FT                   YEKQGFIHYFDTAGILQHNDIAPQWHPTDVGHLKIAAHLMQWVKLKFGWEFGATGPEVY
FT                   HGTLYWNDQANY"
FT   CDS_pept        join(complement(134860..135441),complement(134749..134808))
FT                   /codon_start=1
FT                   /gene_family="HOG000185589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265158"
FT                   /orf_name="AFUA_2G00625"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87161.1"
FT                   /db_xref="HOGENOM:HBG052753"
FT                   /db_xref="InterPro:IPR000007"
FT                   /db_xref="UniParc:UPI000052048B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU4"
FT                   /transl_table=1
FT                   /translation="MSHALPDVQPPPFPIAIRPESITRHEVIVTVTNRPEPWHSLDYSI
FT                   EYAGTELFTVLGQPWKVSQARMFHDRSGLPLFELRCQWYDSSSLCLRLPGGDQCILEAK
FT                   LRVAMNAPRAVVTFRNAAEQPRTAPSNEIVLEVHAQDLYNVLQVVVVQNRNVAYIHRIT
FT                   DRSVLAQGQRPPFRFRPKWTVRVAQGVDLSLIAVVVVIVGQRAGLDVEDG"
FT   CDS_pept        join(complement(136906..137097),complement(136227..136856),
FT                   complement(135944..136177))
FT                   /codon_start=1
FT                   /gene_family="HOG000185600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056606"
FT                   /orf_name="AFUA_2G00630"
FT                   /product="GDSL lipase/acylhydrolase family protein "
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL87162.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG052761"
FT                   /db_xref="HOGENOM:HBG324460"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniParc:UPI000051FDD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU3"
FT                   /transl_table=1
FT                   /translation="MHRWQLLLGLVFAIEAASAHPRSWGPRKFTSLVSFGDSYTDQSRL
FT                   NYFGSHNGSAPPIGWEQPDSNNTASGGYVWGHYVSQYADVNLYNYAVSGAVCSNEITPR
FT                   TFSSINAPFPSVLEYEVSAFLADSKHKVSGKRFLHIPPRETVYSIWIGTNDLGNYAFIT
FT                   DSQVKDKTIPDYINCVYSVLDRVYVSGGRYFVLMNLAPLQLAPLYATPENGGVGANHYW
FT                   PDKPDNLTLTSYRMWEQVATVNHVFQYQTPYELLVARRYPGARFAVMDMYGLLSEVYYN
FT                   PTKYFNGSAQANVTGFNNHCTLDGGQCTRLPSPDSFMWFDELHPSQRTDQIIAEEFVKV
FT                   VGGDSKWATYW"
FT   CDS_pept        complement(137258..139501)
FT                   /codon_start=1
FT                   /gene_family="HOG000185611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751280"
FT                   /orf_name="AFUA_2G00640"
FT                   /product="Beta-N-hexosaminidase, putative "
FT                   /EC_number="3.2.1.52"
FT                   /function="beta-N-acetylhexosaminidase activity "
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87163.1"
FT                   /db_xref="GO:0004563"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG052766"
FT                   /db_xref="InterPro:IPR001540"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051EAA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU2"
FT                   /transl_table=1
FT                   /translation="MGLLISRMQGADVTSTTTECNPCVYLFCTASAICSGQFQNMYLNV
FT                   ILCFSLVTAALQTLPPVDQTTLGPLPGFDVHSVERVVYIKADFASHRDENGLTLIPPSA
FT                   LEFATTFLHDLQEVTASQWTLRQVNHFSAKQGIFLDRLGTDCNLTYENGTPTEEGYEVE
FT                   IRPRRVDIRGSGARGMWWGTRTMLQKLILADGKPLPGGRIVDAPSVPTRGYMLDAGRKW
FT                   YSPGFLKDLCTYASFFKMSEFHYHTSDNYPLNRGHNETWSEVYAQFSLHPESPDLHGIV
FT                   QRPNETLSRADYEELEQHCAQRGVTVVPEIEAPGHCLFLTKWKPELALEKKDLLNLSHP
FT                   DAVPLVKSVWGEFLPWFHTKEVHIGADEYDSTLADDYINFVNEMAQFIQKESGKRIRIW
FT                   GTYEPSDTLSISKDVIVQHWQYGQSDPVSLANDGYIMINSEDQWAYMSLKNDHMPIFPA
FT                   PYPYLFNTSRVLNFANIDGWQWTPALFNPFNVTEQPNKQAVQGAILVAWNDNGPDATTQ
FT                   LEAFYAMRNGIPIVASRAWTGDRGPRLDESSLSWSAKLLTARAAGQNLDRRFTGGVNHK
FT                   TDSLFSWTSGKQSGERIHLGYGSKGMNYTLELDVAGPFVLSSEDCALSLSASGTLAFTS
FT                   DGWEYPLRSVAENAGFDPGYPGRIWTNETSSTHEPVQIPLHSQIIIRTDVIGGSRVWVD
FT                   GSFVGRFEVFVFGGKNQLFSWSQMAFVAPLEWIQGGLHGLRIAEYDGSYSSSD"
FT   CDS_pept        join(141038..141784,141831..142031,142120..142620)
FT                   /codon_start=1
FT                   /gene_family="HOG000115352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751281"
FT                   /orf_name="AFUA_2G00650"
FT                   /product="Arabinosidase, putative "
FT                   /protein_id="EAL87164.1"
FT                   /db_xref="HOGENOM:HBG052771"
FT                   /db_xref="UniParc:UPI000052049A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIU1"
FT                   /transl_table=1
FT                   /translation="MLSCRFDSTPFIIISSMGMGCLVAIIWPSDNMLMRGIMATILRRS
FT                   LSLAGITAELGEVGCCLSYSDVVASLGKVLRRLGIILLLHILLTSLGHRQFGPPSVDTE
FT                   KDHRGNGSIVSSVEARIYKPRAAQQFSQLQSFTEKMKSLTTICAGILALLTPTMALPQP
FT                   LPLDLHTADPTKVGYLDFYWKTEDESVYLALSNNSNPLDFRPINGGKPVVSPTLGTKAV
FT                   RDVSIVEGVGRDKGKYWLIGTDLDIDTTNWDKATRTGSRAIFIWESRDLIHWTNERLVT
FT                   VEDETAGMVWAPDAIWDPKAGMSQCASGQLNMTNSYAANDPNHTGNPTTTDIIRYAHTS
FT                   DFKTFTKPQTYIDHETSTIIDLSILRVDDNTFVRFYVSGKVSGPVVEVSRNGLFGDWVT
FT                   PSGTIQDSTHFEGPYPFWDNVQPGKAYLLCDKVGSVTGLSPWVSTDVTSGTFTPASGGN
FT                   LGALRHGSVLSVTKQQYDALAALG"
FT   tRNA            complement(142956..143028)
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        complement(143674..144174)
FT                   /codon_start=1
FT                   /gene_family="HOG000185677" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265159"
FT                   /orf_name="AFUA_2G00656"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27301.1"
FT                   /db_xref="UniParc:UPI0000F51848"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V4"
FT                   /transl_table=1
FT                   /translation="MSNFNHAPNYNPNSLPTINNGMDESFYTNMDHTMNNAHNLGMHYL
FT                   AAAPPTNTSHTAIDHPLYTSFNYCMVFSNVPDQPWPSYNLLQQCLDKVRARDAKVYSSI
FT                   DAILRYDGAKTGDLILSFTAAALTDGVIWTSAEGVILRQMRNWDRDSRMEGWTLVGEFG
FT                   LAQ"
FT   CDS_pept        join(complement(148297..148380),complement(148211..148245),
FT                   complement(147575..148144),complement(145280..147520),
FT                   complement(145109..145232),complement(144922..145061),
FT                   complement(144779..144875))
FT                   /codon_start=1
FT                   /gene_family="HOG000185666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265160"
FT                   /orf_name="AFUA_2G00660"
FT                   /product="Sensor histidine kinase/response regulator
FT                   TcsB/Sln1, putative"
FT                   /EC_number="2.7.3.-"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27302.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0000F51844"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V5"
FT                   /transl_table=1
FT                   /translation="MRIPIAVQLGLLVLVTALVGLAVLSIATWVNNYNFVVDVQSDGLE
FT                   LVAKIKARQIASNLQLLESTCKTIVTRLLIQGALGRFYNGNSSDSNWTSSVTDVQSALG
FT                   SNNYMDLYQVIIFSRNGQGDRHGLLNVTAKDIAEIALPYTHPDGTAVMLGEEGLGYPPA
FT                   LYPNLTYVAASDGSSTTDVYAFSDYKLGLDTALLLGPLPINSSFSLISVTVPIINNTSA
FT                   TDILGYMTVVASAANLQATINSRDGLGQTAQILLLGPSRLDNQFARDAYAATATSAPDV
FT                   ERLSHAEVHYVFEPTPLPGQSSRHGGNLSMSSFALSRYPLAWKLMSKPWAESNDSISDL
FT                   STRNEHGYQVAVGAIRPKTSMAQWILLVEQTQAEAFAPINKLRKIILACVFGTIGFIIL
FT                   IVPPLTHLAVAPIRRLSEATRKSIEPPSQPPHDCPPSSGPYIVGTAEAETEPRAFGDHM
FT                   DEKGLVAWVKHFRRRDRPHSTHSNGSRNHAGAFQIPGRVKERKHLITDELTELTSTFNE
FT                   MSDELSIHYHRLEERVAERTRELEAAKLAAETANESKTLFIANISHELKTPLNGILGMC
FT                   TVCMGEDDLPRIKKSLQVVYKSGDLLLHLLNDLLTFSKNQIDQAIRLEEREFRLSDIRS
FT                   QLAVIFQNQVQEKHIDFNVNFVSNDTLPPQADGFQEKTSLPAAPALGPPGTGRLRDMVL
FT                   WGDQHRILQVLINLVSNSLKFTPEHGKVEVRIKCVREAETPGSPRTSLQDSRRNSRLRS
FT                   QPPSHDSSQPRDPVDGLVQEEYHTPVLSQLRTLIFQFEVEDNGPGVAPHLQKRVFEPFV
FT                   QGDLGLNRKYGGTGLGLSICAQLSRLMNGKITLESEPGKGALFTVEIPLKFVKEAAPST
FT                   PSSSAAGSRTPSVFSLDDLPGLARPPSNNGSVRSDPLTNFEKQDLQPRLVGLSQPFFTP
FT                   TPSSPAPSTPRATPADGAKPEVKDNTSGKVRVLVAEDNVVNQEVVLRMLRLEEVYDVTV
FT                   VKDGQEAYDTVKANMEEGKVFDVIFMDIQMPNLDGLESTRLIRGMGYSAPIVALSAFSE
FT                   ESNIKDCMDSGMDMFISKPIRRPALKQVLNRSRKSRRMRKIHSPGRSQ"
FT   CDS_pept        join(149434..149666,149766..150234,150282..150677)
FT                   /codon_start=1
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265161"
FT                   /orf_name="AFUA_2G00670"
FT                   /product="Protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87166.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG052787"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051E5E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT9"
FT                   /transl_table=1
FT                   /translation="MALILLYGYVMRRGVLWLFLFEMMTSTNLDLASEQKYVAVKVLAS
FT                   NHQEQALSGELGIYKHLSRLKSSHIGSAYIRGLDRRFSESLFKETLLCILQALDFLHRE
FT                   GNVVHTGMSPATADRREYLLEMTDGVTDIKATNIMLRIDDESILEDFEKAEQQSPSPEK
FT                   VVGKNRTIYTSRRLRLPHDDLWGQPVLCDLGLARIGRAHTGLIQPEIYRAPEVLFDMGW
FT                   GHSADIWNLGVMAWDIFEGRPLFSALDEDQEYSPSHHVADGDGGCSWAATVVLHPAKPG
FT                   NSQCIFRERSFSLSSLADQANDFIGEWLGEGGVTIPNTSLERLEEKLNGNGQQSFLQFT
FT                   RSMLQWTPETRKTAKELLKDPWRNS"
FT   CDS_pept        join(complement(152162..152632),complement(151863..152113),
FT                   complement(151412..151817))
FT                   /codon_start=1
FT                   /gene_family="HOG000185655" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903346"
FT                   /orf_name="AFUA_2G00680"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87167.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052795"
FT                   /db_xref="HOGENOM:HBG332067"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000051E85E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT8"
FT                   /transl_table=1
FT                   /translation="MRAGFVFPILAPSVAAITPTARAETALEALQTWYNTTSGIWNTCG
FT                   WWNGASCMTVVADLADVDDAVREVAVGVFENTFSVAPRSNPAPGRGNDTYNGVIKHHRP
FT                   QPVSRRRAGVDVSQWLDGAYDDDAWWALAWIAAFDVTGRPEYLDLAEGVFDELSKVWPS
FT                   RCGGGIYWDYTHTYVNAIANELFLSLAAHLANRASDKEYYVDWAQREWDWFQGSGMINA
FT                   NHTINDGLTESCENNGQTTWTYNQGVILGGLAELYRASPNATFLESAGEIARAAIAALS
FT                   DSDGVMHEPCEPSSCTGDSTQFKGIFIRNLRLLHSVAPDEEYSRVITASADSIWVNDRD
FT                   ANNQMGVNWAGPIERVDASSHSSATDALVAAIGLS"
FT   CDS_pept        join(complement(154919..155144),complement(154585..154868),
FT                   complement(154442..154538),complement(153085..154373))
FT                   /codon_start=1
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265162"
FT                   /orf_name="AFUA_2G00690"
FT                   /product="Glucoamylase"
FT                   /EC_number="3.2.1.3"
FT                   /function="carbohydrate binding"
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="EAL87168.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG052802"
FT                   /db_xref="HOGENOM:HBG324178"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008291"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000052023D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT7"
FT                   /transl_table=1
FT                   /translation="MPRLSYALCALSLGHAAIAAPQLSARATGSLDSWLGTETTVALNG
FT                   ILANIGADGAYAKSAKPGIIIASPSTSEPDYYYTWTRDAALVTKVLVDLFRNGNLGLQK
FT                   VITEYVNSQAYLQTVSNPSGGLASGGLAEPKYNVDMTAFTGAWGRPQRDGPALRATALI
FT                   DFGNWLIDNGYSSYAVNNIWPIVRNDLSYVSQYWSQSGFDLWEEVNSMSFFTVAVQHRA
FT                   LVEGSTFAKRVGASCSWCDSQAPQILCYMQSFWTGSYINANTGGGRSGKDANTVLASIH
FT                   TFDPEAGCDDTTFQPCSPRALANHKVYTDSFRSVYAINSGIPQGAAVSAGRYPEDVYYN
FT                   GNPWFLTTLAAAEQLYDAIYQWKKIGSISITSTSLAFFKDIYSSAAVGTYASSTSTFTD
FT                   IINAVKTYADGYVSIVQAHAMNNGSLSEQFDKSSGLSLSARDLTWSYAAFLTANMRRNG
FT                   VVPAPWGAASANSVPSSCSMGSATGTYSTATATSWPSTLTSGSPGSTTTVGTTTSTTSG
FT                   TAAETACATPTAVAVTFNEIATTTYGENVYIVGSISELGNWDTSKAVALSASKYTSSNN
FT                   LWYVSVTLPAGTTFEYKYIRKESDGSIVWESDPNRSYTVPAACGVSTATENDTWQ"
FT   CDS_pept        join(155988..156118,156527..156683)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265163"
FT                   /orf_name="AFUA_2G00700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87169.1"
FT                   /db_xref="HOGENOM:HBG052808"
FT                   /db_xref="UniParc:UPI000051F8ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT6"
FT                   /transl_table=1
FT                   /translation="MRNRRYEASPQLRRPLLRLGMDTWMSDLSAVSASDWHSSSKLSKA
FT                   LDPALPNSIGAGVETRVITPDGSQGNGDIRQSTRWDDRQLNAQDWASVAY"
FT   CDS_pept        join(156794..156967,157015..157053,157097..157212,
FT                   157256..157364,157410..157638,157685..157847,
FT                   157893..158039,158084..158324,158369..159043)
FT                   /codon_start=1
FT                   /gene_family="HOG000165530" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903347"
FT                   /orf_name="AFUA_2G00710"
FT                   /product="Alpha-amylase, putative "
FT                   /EC_number="3.2.1.1"
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /function="carbohydrate binding"
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL87170.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG324773"
FT                   /db_xref="HOGENOM:HBG434453"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000052048C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT5"
FT                   /transl_table=1
FT                   /translation="MKWIAQLFPLSLCSSLLGQAAHALTPAEWRSQSIYFLLTDRFGRE
FT                   DNSTTAACDVTQRLYCGGSWQGIINHLDYIQGMGFTAIWITPVTEQFYENTGDGTSYHG
FT                   YWQQNIHEVNANYGTAQDLRDLANALHARGMYLMVDVVANHMGYNGAGNSVNYGVFTPF
FT                   DSATYFHPYCLITDYNNQTAVEDCWLGDTTVSLPDLDTTSTAVRSIWYDWVKGLVANYS
FT                   IDGLRIDTVKHVEKDFWPGYNDAAGVYCVGEVFSGDPQYTCPYQNYLDGVLNYPIYYQL
FT                   LYAFQSTSGSISNLYNMISSVASDCADPTLLGNFIENHDNPRFASYTSDYSQAKNVISF
FT                   MFFSDGIPIVYAGQEQHYSGGADPANREAVWLSGYSTSATLYSWIASTNKIRKLAISKD
FT                   SAYITSKNNPFYYDSNTLAMRKGSVAGSQVITVLSNKGSSGSSYTLSLSGTGYSAGATL
FT                   VEMYTCTTLTVDSSGNLAVPMVSGLPRVFVPSSWVSGSGLCGDSISTTATAPSATTSAT
FT                   ATRTACAAATAIPILFEELVTTTYGESIYLTGSISQLGNWDTSSAIALSASKYTSSNPE
FT                   WYVTVTLPVGTSFEYKFVKKGSDGSIAWESDPNRSYTVPTGCAGTTVTVSDTWR"
FT   CDS_pept        join(161113..161158,161216..161666,161750..162455,
FT                   162525..162800)
FT                   /codon_start=1
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751282"
FT                   /orf_name="AFUA_2G00720"
FT                   /product="Aldehyde dehydrogenase, putative "
FT                   /EC_number="1.2.1.3"
FT                   /function="aldehyde dehydrogenase (NAD) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87171.1"
FT                   /db_xref="GO:0004029"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051E3B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT4"
FT                   /transl_table=1
FT                   /translation="MSTITVTGAAGRQITVPTGLFIHNEFTPSSSNETLTVENPTTGST
FT                   LGTVSAATAADVERAVTSATTGFQTWRTTPGPERGRLLLKLADLIERDAEEFASLEAVD
FT                   AGILYTDSMGMNIPQAVANLRYYAGWADKIDGKTLEIPGGVGYTFREPLGVCAAIVPWN
FT                   APLMITIWKLAPALATGNSLIIKTSENSPLYGQKLAQLIVEAGFPAGVVNILAGLGLPA
FT                   GQSLAEHPAIRKVSFTGSSATGRKILAAAAKTNLKKVSLELGGKGPSIVFDDCDLDNAL
FT                   LWTRIGITANNGQICAAGSRIYVQDTIYDKFLAAYVRAAKENPGVVGDPLDPATTKGPI
FT                   VNGAQHRRILGYIAQGKETGARLLFGGEKVGETGYFVENTAFADVAEDAAIMKEEIFGP
FT                   VASIAKFSTEEEVIRKANDTLHGLSAAIFTTNVNRAHRVSRALESGQVTVNAWAMLSAN
FT                   APFGGVKESGFGRDMGEEALEGWTSVKTVKYMIM"
FT   CDS_pept        complement(162960..164147)
FT                   /codon_start=1
FT                   /gene_family="HOG000233306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056607"
FT                   /orf_name="AFUA_2G00730"
FT                   /product="FAD binding domain protein "
FT                   /EC_number="1.5.3.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87172.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052826"
FT                   /db_xref="HOGENOM:HBG324466"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000520703"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT3"
FT                   /transl_table=1
FT                   /translation="MPTEAEDVRAALLWAPEHQIDLAVKGGGHSVAGTSSSDGGLVIDL
FT                   SLMNSVSVDPAAKTVTVGGGATWKEVDEAAAAHGLAAVGGTVNHTGVGGLTLGGGYGWL
FT                   SGQYGLTIDNLLSATVVLATGQVVTASATENADLFWGLRGAGYNFGVVTSFTFRAHEQP
FT                   NPVYAGLLAFPPDQVEAVIEQLNRTLEHPDPRSGAICIFAQPPGAPVPMVNVIVFYNGT
FT                   QAQGEKRFAGLLALNPVVNTTATIPYSQVNALQNPMATYGGRKSFKGVFFHPPLAPSFA
FT                   RSMLDDLTARLQAEPDLAASALLLEFYDMRAICAVPREATAFASRSWTQNGLINLRWTD
FT                   ARKDGEHRAWARERQARWKAELDARVQEGVPQYINYAERTSLHLLSSSLAIADKC"
FT   CDS_pept        join(complement(165416..165665),complement(164580..165343))
FT                   /codon_start=1
FT                   /gene_family="HOG000185688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265164"
FT                   /orf_name="AFUA_2G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87173.1"
FT                   /db_xref="HOGENOM:HBG052833"
FT                   /db_xref="UniParc:UPI000051EA8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT2"
FT                   /transl_table=1
FT                   /translation="MAKVAALGLLLWAIPSVAVIATVKSPCLSVCGGTQKTIGDELICN
FT                   DGDYNATTKGLTMKNCLLCESTSTTYSSQFDSDVYWFIFNQKYTIQVCVYENSASTSLS
FT                   PCESQCLPLKPVFETLWWNRNVSLYNYCTQNNNAFPTYASGCSECLRAKAGSKVLGNFM
FT                   DNMASACKTQPNATKGETVTLARPLFDLSVDSNATATSTAGPTATGTETETETGTTTSS
FT                   PTPTSSSSSSSSGLSAGAAAGIGVGAGAGVILVGALVWVLFRRRRRHRAASHQPQSVYS
FT                   PAGLGGQAYAPPMQQEAPYAAGYAVERNPSKLVEAPGTSEQKPGGTWAAELPSNHS"
FT   CDS_pept        join(complement(167163..167300),complement(166883..167116),
FT                   complement(166216..166833),complement(166063..166167))
FT                   /codon_start=1
FT                   /gene_family="HOG000276738" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056608"
FT                   /orf_name="AFUA_2G00750"
FT                   /product="Oxidoreductase, 2OG-Fe(II) oxygenase family,
FT                   putative"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL87174.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG387265"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000051E84D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIT1"
FT                   /transl_table=1
FT                   /translation="MADFSSIPIIDFGRLQDPSTKEETLVQLREAIFLVGFLYLTNHGM
FT                   EEIIKKAHATLPDLFALPTEVKEKCNMINSPSFVGYTRLGAETTAKQTDWREQFDFGTP
FT                   GMKQWTPEDPIWQRLEGNSQYPDYPGVRELVEEYIAESAQLSKKFMRHVAECLSLPPTT
FT                   FEAFRGNMDRLKFIKYPQSPPGSQGVGPHKDSSGLFTFLSQDDTGGLQVLNKKGEWIDA
FT                   PPIEGSLVVNIQQGFEAITGGVCTATTHRVIVSLCFTLYLGHRSDVEKAPTSKTRYSIP
FT                   YFSAVRMDLTLAQLKESAAHIVQRIPASDDRKKRAVDVPSEFLSPLYSCFGEAYMRNRI
FT                   LSHPDVGQKWYPELYEKYSKQVLT"
FT   CDS_pept        join(complement(169345..169446),complement(169056..169282),
FT                   complement(168921..169006),complement(168789..168874),
FT                   complement(168273..168737))
FT                   /codon_start=1
FT                   /gene_family="HOG000216909" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265165"
FT                   /gene_name="plyA"
FT                   /orf_name="AFUA_2G00760"
FT                   /product="Probable pectate lyase A "
FT                   /EC_number="4.2.2.2"
FT                   /function="metal ion binding"
FT                   /function="pectate lyase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87175.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0030570"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG000917"
FT                   /db_xref="HOGENOM:HBG465545"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000052023A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIT0"
FT                   /transl_table=1
FT                   /translation="MKFVATLIACGLSGLALAAPTATVNSLGKRAADDAAFGYASLNGG
FT                   TTGGAGGTTTTVSSYAAFTAAVSSDAKKVVYVSGPIKQSAKQVKVGSNTSIIGKDSTAV
FT                   LEGFGLLVKEKSNVIIRNLGVKKVLAENGDAIGIQYSNNVWVDHVDVSSDRDHDKDYYD
FT                   GLIDVTHAADYVTISNSYIHDHWKASLVGHSDNNGDEDKGHLRVTYANNYWSNINSRAP
FT                   SLRFGTGHIYNSYFENVSDGINTRDGAQVLVESNQFVGSSKALYSTDDGYAVERDNDFG
FT                   GAKNTALQGTLTTVPYSYSLLGSSKVKSAVVGVAGQTLKF"
FT   mat_peptide     join(complement(169345..169392),complement(169056..169282),
FT                   complement(168921..169006),complement(168789..168874),
FT                   complement(168276..168737))
FT                   /product="Probable pectate lyase A "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIT0 "
FT   sig_peptide     complement(169393..169446)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIT0 "
FT   CDS_pept        join(complement(171258..172232),complement(170852..171205))
FT                   /codon_start=1
FT                   /gene_family="HOG000185699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056609"
FT                   /orf_name="AFUA_2G00770"
FT                   /product="Salicylate hydroxylase"
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87176.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051428"
FT                   /db_xref="HOGENOM:HBG327530"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000051F1B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS9"
FT                   /transl_table=1
FT                   /translation="MPPRRILIVGAGIAGIASALAISKELTPYVPDLKITVFERHDVLS
FT                   TSGGAINLTPVAQRHLDQLGVLAELDRLGDEGGADVDAIQFFSCRSGKSLGSIDFTRDQ
FT                   GQGFSGYKARRVMRIILSVAMLAVVERTRNIEIVFGKKLARGEETADEAILYFQDGTTA
FT                   VGDLVLGCDGVHSATRTRWIAPDYPSEYTGISFLQGVVDAKTLKSRIHFRSTSMNISRH
FT                   GTLLASYCDRDQEQIFLAAIVQFAEELLPRYRIEAGQDWRKQHAIRKALQEEMQDRFGK
FT                   SGIPCIREMINSPTDWMLYPVYQVRPGGRWHTQRAILLGDAAHAMPPRDESAAYALDDA
FT                   IVFARILARYRGEPLTDAFRAYEDIRREIVNEAFKSARRMWEKHKDMGLLESRLREWTL
FT                   PFYIRNSKEAREAMWEFDATKISIPTPLEEQESLYSFEKDYHL"
FT   CDS_pept        join(complement(175305..175575),complement(174647..174931),
FT                   complement(174036..174587),complement(173825..173985))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751283"
FT                   /orf_name="AFUA_2G00780"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87177.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG052866"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00005206E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS8"
FT                   /transl_table=1
FT                   /translation="MQWSLVRTSSGAQPQQFAIIIRSRGGIPVICYSSKFLSSSDNVSF
FT                   HCLSNRSSLTRFMMNLASVREAKWGQEWRSSSWFIVTAMAMALFTVVHIFIGRFIQAIA
FT                   SSFMWVVGYATIADSVDSTRLGVIYGIISVAAAVGLSAGPMVSGVLFKIGGYWTAWTSA
FT                   FAILLVDIVLRFLMLENPRRKREKQSDPSPADDGPHEEENSPLLRPDNDTSTASRPVAA
FT                   PETVEEKTGLEYYVYMFRHRRFVTGVLGYFVFAILISSFDTTLPLHVRDAFDWDSMPAG
FT                   LMFLALQGPGIALSPLVGWLKDRVGTQIPTTIGFLGLAPLMWLLGVPGDERFPWANQGQ
FT                   RGPIIYAMDVTAVGIVSVLLNGVGVLEATATIDEIEHRHPGIFGPHGGYSRAMSICSQS
FT                   WTIGAFFGPILSGYMAEHIGITR"
FT   CDS_pept        complement(176499..176885)
FT                   /codon_start=1
FT                   /gene_family="HOG000185721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265166"
FT                   /orf_name="AFUA_2G00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87178.1"
FT                   /db_xref="HOGENOM:HBG052873"
FT                   /db_xref="UniParc:UPI000051E5ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS7"
FT                   /transl_table=1
FT                   /translation="MPSMHDRIREDLIIKERALWTALTSADPGPAIEKLSHQEVNMIFP
FT                   QTPILTLEGENKIQDAVKPPFHRFDTYSLDEVRVIIIDLMAGTVTYRVTATRGNKTYRA
FT                   NGSTTWQQASDGEWRIICHQETLV"
FT   CDS_pept        join(complement(179263..179459),complement(179066..179209),
FT                   complement(178893..179018),complement(178747..178843),
FT                   complement(178464..178697),complement(178081..178419))
FT                   /codon_start=1
FT                   /gene_family="HOG000175137" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265167"
FT                   /gene_name="pelB"
FT                   /orf_name="AFUA_2G00800"
FT                   /product="Probable pectin lyase B "
FT                   /EC_number="4.2.2.10"
FT                   /function="pectin lyase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87179.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="GO:0047490"
FT                   /db_xref="HOGENOM:HBG052879"
FT                   /db_xref="HOGENOM:HBG437419"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051FDDA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIS6"
FT                   /transl_table=1
FT                   /translation="MKYQDLLAIAGCIANAGAVSVSGAAEGFAKGVTGGGSATAVYPST
FT                   TAELVSYLGDSEARVIVLTKTFDFTGTEGTTTATGCAPWGTASACQLAINQNNWCTNYE
FT                   PNAPSVSVTYDNAGILGITVKSNKSLIGSGSSGVIKGKGLRIVSGASNIIIQNIAITDI
FT                   NPKYVWGGDAITIDNADMVWIDHVTTARIGRQHLVLGTSASNRVTISNNYFNGVSSYSA
FT                   TCDGYHYWGIYLDGSNDLVTMKGNYIYHFSGRSPKVQGNTLLHAVNNYWYDSSGHAFEI
FT                   GSGGYVLAEGNVFQNIDTIVQSPVDGQLFTSPDSNTNKVCSTYLGHVCQVNGFGSSGTF
FT                   SQADTGFLSNFAGKNIASASAYTAVQSTVPSSAGQGKI"
FT   mat_peptide     join(complement(179263..179405),complement(179066..179209),
FT                   complement(178893..179018),complement(178747..178843),
FT                   complement(178464..178697),complement(178084..178419))
FT                   /product="Probable pectin lyase B "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIS6 "
FT   sig_peptide     complement(179406..179459)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIS6 "
FT   CDS_pept        join(181516..181656,181703..182773)
FT                   /codon_start=1
FT                   /gene_family="HOG000219288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265168"
FT                   /orf_name="AFUA_2G00810"
FT                   /product="Purine nucleoside permease, putative "
FT                   /protein_id="EAL87180.1"
FT                   /db_xref="HOGENOM:HBG094887"
FT                   /db_xref="HOGENOM:HBG583105"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="UniParc:UPI000052023E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS5"
FT                   /transl_table=1
FT                   /translation="MHLVKSIAAGLLLPGCVLASAVPKPAPAPVGQHHPHRITPKVFIV
FT                   SMFKPEAAVWWNIPEFDLLAHNVTVPGASPVYPDVYCTADYSICQLITGEGEINAAVTV
FT                   SSIAFSPLFDLTHTYFLIAGIAGINPKVATIGSVTFARYAVQVALQYEIDIRDLGPNYT
FT                   SPYIPQGAYAPDQYPGSIYGTEVFEVNAELRSLAASFARAAQLADSDTAKAYRAKYVTN
FT                   NGTYAAGTQTPSVVECDVSTSDVYFSGTILDDVFDNTIRVLTNGTGVYCSTAQEDNATL
FT                   EALLRAASHNRVDFSRIIIMRTASDFDRPYPGQSAIENLLYADQGAFGPAIQNIYLAGI
FT                   KVVQGIMDGWNKTFTAGVKPSSYIGDEFGTLGGRPDFGPGRTIARKEANALRKRGVAKR
FT                   GRRL"
FT   CDS_pept        join(complement(184830..185018),complement(184349..184785),
FT                   complement(184189..184299),complement(183547..184135))
FT                   /codon_start=1
FT                   /gene_family="HOG000254970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265169"
FT                   /orf_name="AFUA_2G00820"
FT                   /product="Extracellular GDSL-like lipase/acylhydrolase,
FT                   putative"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL87181.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG450812"
FT                   /db_xref="HOGENOM:HBG695479"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI0000520230"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS4"
FT                   /transl_table=1
FT                   /translation="MASILCRAVAALLLLLQFSTVWSLPLDISLAGDAGSSRKSHWVDI
FT                   WTTMPQLVEPYNLPPAPYNSSTSIFNNSTIRQTIHVTLDADSIRLRLSNAFGLSDLAIT
FT                   SVAIGLPVDQKTGTSALEPGSSKKVLFSGNEEITIPNGALAVSDPIDFPVTAQSTLLID
FT                   IYLAQGQQGNAITGHPGSRTTSWLSFGNYVGANNLTDPSVMSVDHWYFISTVEAPLPPN
FT                   ARSFAIIGDSITDGRGSDTNGNNRWPDLLLARMQKYRPTSSIALLNQAAGGNRILADGL
FT                   GPNVLSRLDRDVLAHSGVRYAMIFEGVNDIGVASADPAAQQRIGDELLVAFRQIATRVQ
FT                   AAGIPIFGATITPFGTPVGSNYTQPYSSDEREKTRQRVNDFIRSSGVFDAVLDFDKVLR
FT                   DPRAPGVLAEEFDSGDHLHPNVRGYQALADHFPLEVFDRFHW"
FT   CDS_pept        join(185577..185936,185983..186511,186910..187100,
FT                   187512..187814)
FT                   /codon_start=1
FT                   /gene_family="HOG000048340" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056610"
FT                   /orf_name="AFUA_2G00830"
FT                   /product="Short chain dehydrogenase/reductase "
FT                   /EC_number="1.1.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87182.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052901"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FFFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS3"
FT                   /transl_table=1
FT                   /translation="MAAIFQSQKSALITGAASGIGFAIARVCRTKGMHLALLDVDTANL
FT                   ENARNELSALDPSLKTEIYTIDVGNRDAWKDIAKQIRSTFHDLDLIVLNAGKSYKAQSG
FT                   LAGRLKPWADAEYWKKTFDTNVFGPLNGLETLLPLMTASSPTPKSIVITGSKQGITNPP
FT                   GAANPAYNASKAAIKNLTEHLAHDLRSDPATAHISVHLLIPGWTWTGLMGNVGPTDESS
FT                   LKKMEGAWFPSQVAEELVKGMEKGSSYIVCPDNETDRALDQARMQWASDDVVEDRPALS
FT                   RWEDTWKGRAEEWIQNLKPSASDADMIRGCYGCGCALSLPDAARHYAGGFICAGSLLAH
FT                   GECPNTRARITGTLCTAVATTGDLLASFDDDLLQIFVPCHVKRFTGLPFGFKIGPGETL
FT                   IIITFGQHDVCLDTIVQLVGGTLASSASLRVSAMLDKSAISTPAAPGHFALASAARSWL
FT                   RA"
FT   CDS_pept        join(190682..190892,190939..191001,191048..192306)
FT                   /codon_start=1
FT                   /gene_family="HOG000185732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056611"
FT                   /orf_name="AFUA_2G00840"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87183.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG324521"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051ECC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS2"
FT                   /transl_table=1
FT                   /translation="MASKIMSDTNRDDTKASTANESIHENGDNLKNYGSAPGVVEDVVR
FT                   VVDHKAERALCRRFDLRLLPVLAVMYLFNALDKGNLGNAETDGMSKDLNFKPNEYNLLL
FT                   SIFFIPYVIFAPPGAMLGKRYSPARVLPILMFCFGSFTLLSASTKNFGGIFALRWFLGM
FT                   CEAPFFPLVIYYLTTFYRRGELARRLAIFYAASNIANAFSGLIAFGVFQIEGSSIPNWR
FT                   YLFIIEGGATVLFSIFAFWYLPRSVAEAKFLSEDEKALALHRIQVDSSAIVNDKFHLRD
FT                   ALVIFKHPTTYVFLCIEICLGVPIQGVALFLPQIVQRLGYSTVKTNLYTVAPNVTGAVM
FT                   LLVLAFSSDAVRLRSPFIVLGFLLTFTGFIIYASIDDVHAQIRLAYFATFMMTWGTSAP
FT                   SVLLSTWYNNNVADESRRVLLTSTGVPLANLMGLVSSNVFRARDKPKYMPALVTVAAFG
FT                   ATGACLAALLGCYMWFDNKRRNRRDGVRLRAQEVPTERLRDGPKAREFRWFL"
FT   CDS_pept        193805..194467
FT                   /codon_start=1
FT                   /gene_family="HOG000234580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265170"
FT                   /orf_name="AFUA_2G00850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87184.1"
FT                   /db_xref="HOGENOM:HBG052913"
FT                   /db_xref="HOGENOM:HBG331519"
FT                   /db_xref="UniParc:UPI000052048D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS1"
FT                   /transl_table=1
FT                   /translation="MASTDKPQILLLCLSFRDFLDETYSPLFNSLVEVAHVKRAKTASG
FT                   AIRALASTSFKAVIIADEGLTERNTANQEVLGRVKTYIENGGLAIVGLHFPNFTPMDRF
FT                   TAFFRAFGLPWKDGDYHRTTFQLNPSATLPESTKPASLPGPYSMKALHVTNARPLEKIF
FT                   VPTEGAMTQSHVFAPGYVDQAQAAVVGARLGSGHLVYCGDVNGEDGSNQLMLALCGF"
FT   CDS_pept        join(complement(195863..195940),complement(195511..195630),
FT                   complement(195353..195436))
FT                   /codon_start=1
FT                   /gene_family="HOG000048341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265171"
FT                   /orf_name="AFUA_2G00860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87185.1"
FT                   /db_xref="HOGENOM:HBG052920"
FT                   /db_xref="UniParc:UPI000052023F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIS0"
FT                   /transl_table=1
FT                   /translation="MAKASAASASGCFEIHGINLIGGGKGERWNHDASGDSQEQGVPED
FT                   KVLDDPARYNFDDGSEDSRRQYRSGQNNEYLVRPAEESEEDWRDVIRA"
FT   CDS_pept        join(196834..197027,197075..197876,197932..198228)
FT                   /codon_start=1
FT                   /gene_family="HOG000162200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751284"
FT                   /orf_name="AFUA_2G00870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87186.2"
FT                   /db_xref="HOGENOM:HBG052925"
FT                   /db_xref="InterPro:IPR021276"
FT                   /db_xref="UniParc:UPI0000F51838"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR9"
FT                   /transl_table=1
FT                   /translation="MGAPATNSETIHVVNKADNRQHAVVNLDSSLDEELPVSALRARPI
FT                   LLGLTSNNLSYARGGDLLHWWETYPVPHTAPPPYNDQASWGIVPAWGYATVTESSVPGI
FT                   APDSVIWGYWPTSTSPTLLRLEPSDLQGHWVEVSSHRQQLMPIYNRYEQILPENEEPDE
FT                   MEWGALLRGVWIAGYLLSEYVFSPDPRARVPVHPLGAASKLPWSAGDADLSSAVVVVLA
FT                   ASTKTARSILWCLFNRPRESGPLGLVQVTSSPAALQKVASKKGWGDVSKSLAYTEIHQA
FT                   TRWIEGRQPSKVVIIDCGARDHVLSQLYKSLQVSALQPCKTVIIQLGSQQKVYTTGEIQ
FT                   TARADMQSMGKIQFNASGVQDTLIDRDGAATYFGKISRSWKVWLADRDSAIPDMHLVRG
FT                   QGIAGENGIYGGWERLTHGAVRPEEGLVYAL"
FT   CDS_pept        join(198608..198828,198880..200494)
FT                   /codon_start=1
FT                   /gene_family="HOG000177094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903348"
FT                   /orf_name="AFUA_2G00880"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87187.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG050942"
FT                   /db_xref="HOGENOM:HBG324054"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51826"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR8"
FT                   /transl_table=1
FT                   /translation="MMLNINEHRRIKIDKTSPICSSFSLSSDSRATHSLSMTTHGLILL
FT                   HRTMNDRKIRSAKISYVPIRSRNGCTTCKIRKVKCGEERPSCIRCSSTGRKCEYSSPAP
FT                   PRHALTSESSMVPVLDRPLSLVPSGVARERRAFAHYFQRAASSIAGGLDIDFWGGVVTH
FT                   VCRSEPAVWDAVNAISALFENSEPCFDPVWLRRNDNNGETLRPEHCDALRWYARSLATM
FT                   RRQLDRGSVDINIALISCVLFICIETLQGRVEEALRLYEQGVSLIIELRAGGTRLGSRL
FT                   DSGLLDDTIIPIFLRLGTIALSISGVPVSGLLDEMRGLIGNTFPSLRSARLAMAGLAAE
FT                   GMIFQRTVEGYLASKGHGCPIPAGFKDTQEDILKRLAEWHQAYTGLVNSSEPSQLPSSV
FT                   TSLLLSFHAAASIITAVCTEQLETAYDAYLPQFRLIVEQCTIHLEASAGPDGRQPPFTF
FT                   EMGAGLPLFLTAIKCRDPWVRRTALELLRKAPPVQALWKCPPGATLAEAFMKLEESGHE
FT                   STMYDESTRAHTVSEGQYAGSKRPTPPTALIPEESRIHAYCVFRPRDDPFPLGDLDISK
FT                   WNRSPDQIYLKFSRNRMDEKTKTWQMVHDIVPIDY"
FT   CDS_pept        join(complement(201172..201176),complement(200933..201060),
FT                   complement(200647..200879))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265172"
FT                   /orf_name="AFUA_2G00890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87188.1"
FT                   /db_xref="HOGENOM:HBG052937"
FT                   /db_xref="UniParc:UPI000051F44F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR7"
FT                   /transl_table=1
FT                   /translation="MTADTCDGCCGRYDGRRGERYKGIPPASLAVLTPLEQGEAAIDLV
FT                   KMAELSKEVVILIVIVGCVVCVLIGYSIHYIFTNGFQDDPREKEMTYEQKEYMRDLRLK
FT                   NMEALARQAGVTIPRDP"
FT   CDS_pept        join(202266..202358,202422..202813,202863..202927,
FT                   202980..202993,203044..203436)
FT                   /codon_start=1
FT                   /gene_family="HOG000161999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265173"
FT                   /orf_name="AFUA_2G00900"
FT                   /product="PTH11-like integral membrane protein, putative "
FT                   /protein_id="EAL87189.1"
FT                   /db_xref="HOGENOM:HBG052262"
FT                   /db_xref="HOGENOM:HBG326373"
FT                   /db_xref="UniParc:UPI000051EF30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR6"
FT                   /transl_table=1
FT                   /translation="MFSGCMIGGSLWGTGKHLVDLTPEHRARAMEYWFLCDIGYAIASI
FT                   LCKISVAIFLLRVMVHPFHRRIMYAVTALTVIVGIIFFVYMMIQCSPVSYFWTRMLGNT
FT                   SGKCGYVDAIIILLYLFSASSALFDLTVGLLPILLVRNLQMNQRTKIAVAGLLGMACIA
FT                   SVAIIIRFPFVQTIRDPDFLYATVQIAIWSNIETGLGITAGSLATARPLFRILHSRNGS
FT                   SYRIFASSGFQSRRRQHQFPLGDLESNTWRSPYDPTKSNSQDDRHGTTISAERSGASEF
FT                   MTESTEQLDGKLPSVPMPSLSKIGVRRTFEISTSQAG"
FT   CDS_pept        join(complement(205888..206902),complement(205199..205831),
FT                   complement(204205..205172))
FT                   /codon_start=1
FT                   /gene_family="HOG000201838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265174"
FT                   /orf_name="AFUA_2G00910"
FT                   /product="Pfs, NB-ARC and TPR domain protein "
FT                   /EC_number="2.4.2.-"
FT                   /function="ATP binding"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="apoptosis"
FT                   /biological_process="defense response"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="EAL87190.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="GO:0006952"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG052951"
FT                   /db_xref="InterPro:IPR000767"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000F51845"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR5"
FT                   /transl_table=1
FT                   /translation="MRPSSRDEFSIAIICSLTLKVEVVEELLDEVYDRLGGYYRKQPGD
FT                   DNAYINGRIGNHNVVVCCMPGMGKGNAASVASSLKISYPRISLALVVGICGGAPYPLSG
FT                   EEIFLGDVIISDSVIQYDFGRQYSGGFEKKTGVKDSLGRPNKEIRAFLAALQTRRSRRD
FT                   LQAKMLRHLQAIQRSNPEWHRPRSADDILFEASYQHKHFSPTSPICCCLGGKSRDVCKS
FT                   ALDTACIQLGCDKNRISRLRCNAENCIPSIHIGTVASADTVMKSGEHRDRLVKSDNVIG
FT                   FEMEGAGVWDNTSCIIIKGVCDYADSHQNKAWQAYATATGAATAKAFLEYWVPTVREEA
FT                   NEFQVPLELSAFPAIEEFIGREDDLSRLWDYLQPTIPPTRKVAVLHGLGGIGKTQLAIN
FT                   FARKHKDDFTAVFWMSGKDRSALILSLSSCFPRILGHRRNDEAKNEEEAEQRASQVLQW
FT                   LALPGNTKWLIIFDNVDQYAPFPDCNTCGYDICEFFPTADHGSIIITTRLQRLTEVGRS
FT                   FSIKKLTQEDAIQLLLQSSGFSAQGAAQVEAKGPRLTAADIMAIVDQLDGLSLAIALAG
FT                   AFMRETGTSFKEYLQLYKDQWSELQSQAKPTRHYQQGNILETWTTTYQGIQKQDPTAAT
FT                   LLLLLAYFDNRDIWYELIRGGLNCSHTPPWFKAAVSNKLAFKARIKVLVDCSLVEPRQQ
FT                   EGSFTIHPVVQDWCFHIAASEERTVQLYELALVSVGYTVPRKDDREYAQLQQRLLPHAD
FT                   YVIQREKYSWLEDKVAVWRALSRLGNLYTNQGRLQEAEEMYQRALAGYEKALGPDHAKS
FT                   CKLADDLASRASLSATQEMPDSMPSNPTAGQPRAVSTLQPSLPESLQKRHVFSRIFCRR
FT                   "
FT   CDS_pept        join(complement(209103..209175),complement(207930..209047))
FT                   /codon_start=1
FT                   /gene_family="HOG000164911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751285"
FT                   /orf_name="AFUA_2G00920"
FT                   /product="Extracellular glycosyl hydrolase/cellulase,
FT                   putative"
FT                   /EC_number="3.-.-.-"
FT                   /function="alpha-N-arabinofuranosidase activity "
FT                   /function="cellulose binding"
FT                   /biological_process="L-arabinose metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87191.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="GO:0046373"
FT                   /db_xref="GO:0046556"
FT                   /db_xref="HOGENOM:HBG052051"
FT                   /db_xref="HOGENOM:HBG688679"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005193"
FT                   /db_xref="UniParc:UPI000051F434"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR4"
FT                   /transl_table=1
FT                   /translation="MKAIGATLLGLALIVQAQQPLYAQCGGNGWTGSTQCIAGACCSSI
FT                   NDWYYQCLSGNCMPSTTMTTTTATHTTSTSTSGATGSLPTSFRWGSTNALVGPKNDGRN
FT                   LAGIKDPSIIEVDGTYHVFASTAQASGYNLVYFNFTDFNQAGNAPFFYLDQSGIGTGYR
FT                   AAPQVFYFQPHQLWYLIFQNGNAAYSTNKDISNPAGWSAPKNFFSSVPSIITENIGKGY
FT                   WVDMWVICDSSNCYLFSSDDNGHLYRSQTTLSNFPNGMGNTVIALSDSNPNNLFEASNV
FT                   YRVGNEYLLLVEAIGSDGNRYFRSWTAPSLTGTWTGLANTEANPFARSNNVVFSGTAWT
FT                   KSISHGEMVRSQVDQTMTISPCKLRYLYQGLSPTATGDYNSLPWRLALLTQTNSAC"
FT   CDS_pept        join(210407..211105,211152..211991)
FT                   /codon_start=1
FT                   /gene_family="HOG000112693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265175"
FT                   /orf_name="AFUA_2G00930"
FT                   /product="Xylosidase/glycosyl hydrolase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87192.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG052966"
FT                   /db_xref="HOGENOM:HBG346842"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000051EF50"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR3"
FT                   /transl_table=1
FT                   /translation="MGAALGSNFNQPVLWEDLADLDIFRVDDTFYYSASTMHYSPGAPI
FT                   LQSYDLVNWEFVGHSVPTLDWGSIYNLDGGQAYVKGIWASTLRYRKSNGLWYWIGCIQF
FT                   RTTYIYTAPSVTGPWTKSGVINTCLYDCSLLIDDDDTMYVAYGATTISVAQLSSNGLSQ
FT                   VKTQEVFKSTIGPIEGSRFYKINGEYYIFTTLPANAEYVLKASSPWGPYTEKLLLKDIA
FT                   TPIAGGGVPHQGGIVDTPAGDWYYMAFVDSYPGGRVPVLAPITWGSDGFPVITTVNGGW
FT                   GAQYPYPLTPRPLSSPTGKDTFQGTTLGPQWEWNHNPDPTYYSVNNGLTLKTATVTTDL
FT                   YAARNTLTHRILGPDSTATIELTISNMKPGDRSGIAMLRDSSAYVAVINNNGAFRVSMV
FT                   AGLTMDANWNTLSTGSEVAGVNLSGSPSKIWLRAYANIQPGSGRTASFYYSTDGSSFHS
FT                   IGAPYTLNNTWQFFMGYRYGIFNYATVSLGGSVLVSSFEMERGAPSSGATTTAS"
FT   CDS_pept        join(214431..214535,214611..214705,214768..216310)
FT                   /codon_start=1
FT                   /gene_family="HOG000168997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265176"
FT                   /orf_name="AFUA_2G00940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87193.2"
FT                   /db_xref="HOGENOM:HBG052972"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000F51847"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR2"
FT                   /transl_table=1
FT                   /translation="MALAQLLSYPLETSNLATDGTWQKPQDPDLRAERMGPPLSFHHSD
FT                   LIGGCVWAESGEGGGYVREEKRLEGREFEPLKLAREYWKGIWGVLSVKASVVPEVSMSR
FT                   QVADVNQLPILAAPRVLYYVHSLLLSRLAQLLLISIIAVIYQDTEYRMASENGGVLHWG
FT                   TSDRKEKRKPSRRDPEKRRQQNAQAQRKYRKALLSDSGTDTHHLLGEKLRKRLDQLEAI
FT                   AASGAPAFSTQGTPATATRPPEGATGDSSSCALLDSSIIKFPAYGILDIPVSSSSAVIP
FT                   EECQFPQELENSLSALSPWDLATDPQSNDDHSWLRVWDSTKFVHPSLLICDIKKDSHCP
FT                   YWTATVSCGCSTPHVQIRTQGPDPSCYGDIKILSIEPGAPAADPCASQLRIETVCTISA
FT                   LHAIGTHVGITEELICADDSLSPFFRFTVDSADDTAKNDMICAVQRIFTTLKPDLRPTK
FT                   EQITIRHHPFIDILPSPTLRKNLIKHQDELDEDEFFHDMLIGLVCWGGAGVGRRDRNLS
FT                   TSYASTGTPWDVRSWEARDWFIKKYWRLLGGEDGELVRQSEWWRSIRGEDSLDVEARQV
FT                   TEAT"
FT   CDS_pept        join(217718..218213,218284..218658,218713..219273,
FT                   219372..219429,219478..219748)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056612"
FT                   /orf_name="AFUA_2G00960"
FT                   /product="NACHT domain protein"
FT                   /protein_id="EBA27303.1"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="UniParc:UPI0000F5183E"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V6"
FT                   /transl_table=1
FT                   /translation="MAAPQPLIQNAFQAAMHEFKTNLNTDELYTKLLAVSSIDEVYDLT
FT                   DKLQADQGRKGRLRHLAKIEPFLNRLREYTGTIDTFVQAYPEIMGLIWGPIKLLLQWSS
FT                   ALTQSFDAIVNTTADIGLLLPEFQEVVVLFSDNNRIYDVLVLFFKDILDFYLIGLKFFT
FT                   MPRWKYFFEALWPRKKEHISLVKTHIERHALLMRNEVRLEHIREEHDTRLKAFEHFKNA
FT                   EKSHRLQQFYAIKADMSPRMYDDKLNWYHSRVCEGTITWLFRDDVIKDWFDVSNGTSKV
FT                   VWLQGIPGAGKTFLAGAMVDKAHAIGHTAFVFLSHAFSSTTSALGVLHSLLFQLASQHE
FT                   DLQDVLCHLTNEQIKSNITVAVDTLKTVLECAGPAFLIIDGLDEIEEIERGVLLKQLLR
FT                   LSHECHETRIFVSSRREEDITAILEARSEMIRVDGRNEESIQVFVDYQLKQIFQSSRFP
FT                   PQIQDEIQRSLAPLASKAKDDVAEICEDLSVLPEDLDDAYSRVLVRINKLRPPSARDKA
FT                   RRILAWVGCSPTPLTVQEIEQALMIKPGSLELERKVIASPNLNRLCGPIIEIIDGYIQF
FT                   VHFTVKEYVS"
FT   CDS_pept        220566..221531
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265177"
FT                   /orf_name="AFUA_2G00963"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27304.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000F51834"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V7"
FT                   /transl_table=1
FT                   /translation="MSDQHMEKAHKEKTPPRDLSEGAIEQDEMQALLLDLVRVDEVEMV
FT                   ERLLPRVDDLYRFSSLIGKTVGELGSLPMAQMITRVCKEGAKHRAVDQFYHGAIKAGNV
FT                   EFIDWLISSNQIPEYRDEAASITAAFVKSDSEDLWRLCEQFMAALSRADDIDRRMSDVC
FT                   FEEPAINATCRIAKRENMLISLWESVGAIKKPKAAKLSYALGVVARTTCSIPLGRALLQ
FT                   HGANINGQKGKLAVSPLHFAARKSSVENAEFMRFLLFAGADPERVSRSRRPSDEIGAKE
FT                   IVRWLGMTWNELVEQTRDCRRSTPTTPPDPSVKPGPWRPA"
FT   CDS_pept        221956..222546
FT                   /codon_start=1
FT                   /gene_family="HOG000178752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265178"
FT                   /orf_name="AFUA_2G00967"
FT                   /product="Cupin domain protein"
FT                   /protein_id="EBA27305.1"
FT                   /db_xref="HOGENOM:HBG659007"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0000F51819"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V8"
FT                   /transl_table=1
FT                   /translation="MSTNPGQISPLAGITRYITTHNPSGQAIIHSEQPVIWGSYEGGAL
FT                   GMGVAYTTSEFPANLNNEVDIKTHEKLMEKNTLGLVNPGGTVCRFVDFKPGGEPFMHRT
FT                   QSLDYGIVLQGEIEMILDSGEKRTLKAGDIAVQRGTKHAWRNPGEVEWSRMVFILQDIQ
FT                   PIVIGGLCWRRMSVGRTRSSLARVIDRCVMSFF"
FT   CDS_pept        join(complement(223618..223762),complement(223115..223564),
FT                   complement(222589..223061))
FT                   /codon_start=1
FT                   /gene_family="HOG000294692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207913"
FT                   /orf_name="AFUA_2G00970"
FT                   /product="Alcohol dehydrogenase, zinc-containing, putative "
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87195.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000052000D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIR0"
FT                   /transl_table=1
FT                   /translation="MAPSVKQWKSNLKGLDSLQQAEAPMPAPGQGEVLVEIHAVSLNYR
FT                   DTEVVMGEYTHHKATQGVETIVVPCSDMSGVVIQVGEGVTAWKAGDRVLSTFLPDHQTG
FT                   QVTEKELARGLGLPLDGVLATHRVFPEYALVRAPSYMTHEEASTLPIASVTAWMSINGM
FT                   RPMGQNGGEGQYVLLLGTGGVSIAGLQIAKASGAKVIITSSSDEKLEQAKKLGADYTIN
FT                   YRTNPNWNEEVMRVTNNHGADIILETGGSETLSKTFDCVAFGGLIDCIGYTSGKQQNPN
FT                   DTLNMNVLTLRKNLTIKGIINGPKDRFEEMVQFYEKHQIHPVVNRIFPFEESKEAFKFL
FT                   ASGAHFGKVVIKVKD"
FT   CDS_pept        complement(225052..225651)
FT                   /codon_start=1
FT                   /gene_family="HOG000161632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265179"
FT                   /orf_name="AFUA_2G00980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87196.1"
FT                   /db_xref="HOGENOM:HBG024073"
FT                   /db_xref="HOGENOM:HBG471097"
FT                   /db_xref="UniParc:UPI000052000E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ9"
FT                   /transl_table=1
FT                   /translation="MARHPYRQIRAKYTSTTITVYQAYSPSIADAAVDAQKFVPPFSRT
FT                   RMTWIKPSFLWMAYRSGWARKPKQERVLAIDITREGFEWALQHSCLSHYPGHDVEEKAK
FT                   WQKRLQNSPVRVQWDPERDLQFTPLDYRSIQIGLSADAVDKYVDDWIVGITDVTEVMRQ
FT                   IEKCLAEDRMEDATRLVPAEEVYPLSEELKGILEAT"
FT   CDS_pept        join(227329..227703,227808..228365)
FT                   /codon_start=1
FT                   /gene_family="HOG000185754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265180"
FT                   /orf_name="AFUA_2G00990"
FT                   /product="Glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /EC_number="3.1.4.46"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL87197.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG052998"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000051FB7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ8"
FT                   /transl_table=1
FT                   /translation="MNPSKSKPQTIAHRGRIKHPTATNPRSCQYPENTLESFRAAAAAG
FT                   CDAIETDLRVSRDGVIVLCHDRSLERVYGVKRLVDECTWAELQSLKTTQAPHVRMPRLV
FT                   DFLAVLCEPGWEEMWAVLDIKLGNLPERIIPLLAEALESVPSATPWSKRLVLGCWSAAF
FT                   FPLCESYLPGFETALIGFDLWYAARVLRGSPAAVNVNQKVLMGMGRGFLEEARAAGRRV
FT                   FVWTVNEPSLMRWSIEQGVDGIITDDPGRCRSMVLDAVKGASPGTRHDERVTVSQRAQA
FT                   WAVSLLVVMFGWLFRRKFLYPLEKRDKSE"
FT   CDS_pept        join(complement(231126..231234),complement(230933..231067),
FT                   complement(228699..230860))
FT                   /codon_start=1
FT                   /gene_family="HOG000185765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056613"
FT                   /orf_name="AFUA_2G01000"
FT                   /product="LIM domain protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL87198.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053004"
FT                   /db_xref="HOGENOM:HBG325761"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniParc:UPI000051E5E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ7"
FT                   /transl_table=1
FT                   /translation="MAGLMDGALLPTIKCSNCGMSVEISEMGDHVCKRVPASPSPPPPS
FT                   PPPKPDSATASTHLRNPSGPRLGRPGPPPRIDPSLANRPYLHPNEDLSKSEKDSLTPSP
FT                   LSVSTGQRTPHLQQGSRISPLLDEPDSPDVIKPVGDLPAFPLPRSMSKKRNASLSRLQL
FT                   AQTAPPVPSPQFGHAMDGEAPLPPQSARMSGYERGHSPPPLTKQHDAAGAQTISHRHGD
FT                   SIDSRSSYGTSAGSTRYGENSSKRSTAMSSRRPSFASIAQESHQFTEEASSGGAIHLEP
FT                   LMEHPPSAEQSAGTESQKHGGKGGSFSGFDFGVATTEKPFPDPLRVSSHTNSDRLSSTR
FT                   GSAELFFRSPSQSSFGLPADWLDPDETRSSSASSANVSYKAFRPLVSDIEPPSASQSEP
FT                   KDVPRKGTDSSSESNTSVSKFARALGLDFPHHATENSTSSSSESSPSEARSGTSISSLP
FT                   SEASLSRRKPSETSRLGVVKEQPANGNQQPVLPETEQTESPADLEPPRIPASFLSPDSP
FT                   TDPAINKGSLSLVVDKATTTPPQPSEPSEPRVPLVRQESHDPQTEPPERPTITRSATEP
FT                   PVRPPPRPKGRCRGCGEAILGKSVSSKDGRLTGRYHRECFVCCHCRSPFETADFYVLND
FT                   RPYCAQHYHELNGSLCSACNKGIEGQYLETNERSGPGPADHKKFHPDCLTCRTCGIPVK
FT                   GEYYEWNGQVYCERDARRAAASMSPNRMRRPTLPSSPLAARPPNYPPMPPGYPRRPGPG
FT                   PGPGGPGFGPGPGPGSRRPSGMLDIPRGPPPAGARRFPERRTTRLMMT"
FT   CDS_pept        join(234729..235435,235486..236248,236298..236432)
FT                   /codon_start=1
FT                   /gene_family="HOG000013469" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751286"
FT                   /orf_name="AFUA_2G01010"
FT                   /product="Myo-inositol-phosphate synthase, putative "
FT                   /EC_number="5.5.1.-"
FT                   /function="binding"
FT                   /function="inositol-3-phosphate synthase activity "
FT                   /biological_process="inositol biosynthetic process "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="EAL87199.1"
FT                   /db_xref="GO:0004512"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006021"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG023602"
FT                   /db_xref="HOGENOM:HBG316335"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051ECCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ6"
FT                   /transl_table=1
FT                   /translation="MAPHATSDAVANGAVNGSARTTTAPLFTVNSPNVEYTDNEIKSRY
FT                   AYHTTDITRTAEGKMVATPKVTNYQFKVDRKVGKVGMMLVGWGGNNGSTVTAGILANRR
FT                   RLVWETREGERAANYYGSLVMSSTVKLGTDSKTGEEINIPFHDMLPMIHPNDLVIGGWD
FT                   ISSMNLADAMDRAQVLEPTLKQLVRKEMAEMKPLPSIYYPDFIAANQEDRADNVIEGNK
FT                   ASWAHVERIQQDIRDFKAQNGLDKVIVMWTANTERYADIIPGVNDTADNLLNAIKAGHQ
FT                   EVAPSTVFAVACILENVPFINGSPQNTFVPGAIQLAEKHGAFIGGDDFKSGQTKMKSAL
FT                   VDFLINAGIKLTSIASYNHLGNNDGKNLSSQKQFRSKEISKSNVVDDMVAANHLLYKEG
FT                   EHPDHTVVIKYMPAVGDNKRALDEYYAEIFMGGHQTISLFNICEDSLLASPLIIDLVVI
FT                   AEMMTRITWKSADDEEYKGFHSVLSVLSYMLKAPLTPPGTPVVNALAKQRSALTNIFRA
FT                   CVGLQPDSEMTLEHKLF"
FT   CDS_pept        complement(236687..237739)
FT                   /codon_start=1
FT                   /gene_family="HOG000022460" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265181"
FT                   /orf_name="AFUA_2G01030"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase,
FT                   putative"
FT                   /EC_number="3.5.99.7"
FT                   /function="1-aminocyclopropane-1-carboxylate deaminase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="amine catabolic process"
FT                   /protein_id="EAL87201.1"
FT                   /db_xref="GO:0008660"
FT                   /db_xref="GO:0009310"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG402495"
FT                   /db_xref="HOGENOM:HBG689308"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="UniParc:UPI0000520016"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ4"
FT                   /transl_table=1
FT                   /translation="MTLEIPLPEPFASIPRYTLTLGPSPIHLLPNTSADLHTTIYAKRE
FT                   DLNSALAYGGNKTRKLEYLLADALAQNATTLLSIGGVQSNHTRQVAAAAAHAGLTARLV
FT                   QEHWVDWNDAHYDQVGNIQLSRLMGADVRLHPAGFGIEHKESLRQLLGECEARGERAYY
FT                   IPAGASDHPLGGLGFARWAFEVAMQEREMGVFFDVVVVCAVTGSTFAGMIAGFKLLERV
FT                   QPGSRKRRVIGIDASARPAETRAQVMRIARSTAAKIGLKDEDISEEDVVLNENYHEGVY
FT                   GVPGEGTIKAMEYAASKDAFITDPVYEGKSFAGLIDLAKKGEFAGKTVLYAHLGGQPAL
FT                   NAYSEIGRAK"
FT   CDS_pept        join(complement(239805..239825),complement(239714..239728),
FT                   complement(239489..239603),complement(239291..239426),
FT                   complement(238599..239236),complement(238336..238550))
FT                   /codon_start=1
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903349"
FT                   /orf_name="AFUA_2G01040"
FT                   /product="Formaldehyde dehydrogenase "
FT                   /EC_number="1.1.1.1"
FT                   /function="S-(hydroxymethyl)glutathione dehydrogenase
FT                   activity"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="ethanol oxidation"
FT                   /protein_id="EAL87202.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0006069"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0051903"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E5EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ3"
FT                   /transl_table=1
FT                   /translation="MADTVGKTITCKAAVAWGAGEPLSIEDVEVAPPKAHEVRIQVLHT
FT                   GVCHTDAYTLSGKDPEGAFPVILGHEGAGIVESVGEGVTSVKPGDYVIALYTPECRECK
FT                   FCKSGKTNLCGKIRATQGKGVMPDGTSRFKARGKDLLHFMGTSTFSQYTVVADISVVAV
FT                   TPKIPTDRSCLLGCGITTGYGAAVVTAKVEEGSNVAVFGAGCVGLSVIQGAVKNKAGKI
FT                   IAVDVNDSKEAWARKFGATDFVNPTKLNGKTIQEQLIEMTDGGCDYTFDCTGNVGVMRA
FT                   ALEACHKGWGESIIIGVAAAGQEISTRPFQLVTGRVWKGCAFGGIKGRTQLPGLVDDYL
FT                   NGKLKVDEFITHREPLSRINTAFEQMKQGDCIRCVVDMS"
FT   CDS_pept        join(complement(241565..241572),complement(241414..241483),
FT                   complement(241108..241302))
FT                   /codon_start=1
FT                   /gene_family="HOG000185786" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265182"
FT                   /gene_name="tim9"
FT                   /orf_name="AFUA_2G01050"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit tim9"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="EAL87203.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="HOGENOM:HBG628226"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI000051E859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIQ2"
FT                   /transl_table=1
FT                   /translation="MDGLTAAEQRELASRMERKQLKEFMTMYSKLVQRCFDNCVNDFTT
FT                   KSLISREEGCIMRCVDKYMKASSRLNERFQEQNAAMMQGGQLPGR"
FT   CDS_pept        join(243818..243974,244180..244407,244471..246725)
FT                   /codon_start=1
FT                   /gene_family="HOG000185788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903350"
FT                   /orf_name="AFUA_2G01060"
FT                   /product="Rho GTPase activator (Sac7), putative "
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87204.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053045"
FT                   /db_xref="HOGENOM:HBG325760"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI000051EF3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIQ1"
FT                   /transl_table=1
FT                   /translation="MVTGKSQPGTEPIHPLRPSANHDGIATSPPSKRDLASWWRQFKRN
FT                   TRKEDVKAALLDAWILSETCSLREANPPCLTTEKPQGIFGVPLNVSIKYANVAISLTND
FT                   NGESFIYGYVPIVVAKCGVFLKEKATDVEGIFRLNGSAKRIKDLQEIFDSPERYGKGLD
FT                   WTGYTVHDAANVLRRYLNQLPEPIVPLDFYERFREPLRAYQRQVQENGSTADSDAFDHA
FT                   KAVAAYQQLIRELPPLNKQLLLYILDLLAVFASKSDQNRMTSANLSAIFQPGLLSHPQH
FT                   DMSPDEYKLSQDVLIFLIENQDHFLFGMNGTAADEQTLKEVEGGTTRRTTTNSNIRRSV
FT                   SSASGGADSFRKYENLRRNVSVSSKHSRHSNNSPGPVTPTSLSGVGVHRSNTLPSKMSP
FT                   ISSARYGRVQESTSVQPSGLNPSVQNSRSSSRAPTPREETSQTTPAPPSGSNAESGTAY
FT                   IHSSTHGPMPKVAEDRAPVAEKPIAEKPVIQDPLPTLVSSPPPPVETPTKERKLSSFFT
FT                   KSPPQNGEPKEPRQPNRLKKKRISGSASESAHSSSLSLQAAPGESVVSVVPSATRANEA
FT                   DGEAGGATPRPPNTTNSGDDATIIVAEEKTAVQNDLHNADNSLRPHGSRTPSMNSRSSF
FT                   TDHSDLDQTDEKADRREHRRSWRFHRSSKRSNEQIGLGLASPPLSASNPSAERSTTSVA
FT                   SWHQSSKSSPSDLQQFASESSQQPLSLDAEISNSAAPKESIEPEKRSLFGKFKAKVAQV
FT                   RDGVRDPERDRTRSPAQPDSERPHSNHTMSPAGKDRISSGPAPIEVPKESREEQTRSPV
FT                   SPIMSSSGLPPAIPEEPRTPESPIMSRTDPDLDKEASAAVPADPSNPSHTEALPAAQPE
FT                   QNKEPLLN"
FT   CDS_pept        join(247613..248065,248141..248427,248509..248662)
FT                   /codon_start=1
FT                   /gene_family="HOG000185799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265183"
FT                   /gene_name="gpi11"
FT                   /orf_name="AFUA_2G01070"
FT                   /product="Glycosylphosphatidylinositol anchor biosynthesis
FT                   protein 11"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87205.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053052"
FT                   /db_xref="HOGENOM:HBG325759"
FT                   /db_xref="InterPro:IPR009580"
FT                   /db_xref="UniParc:UPI00005206F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIQ0"
FT                   /transl_table=1
FT                   /translation="MTSASPSPLRAANAASSAPVPPPAMKPSAPPVNILPTQLARTYSF
FT                   VHPAALLAILATRFQALVADPVAEMLNTLPFLALLQVTYVMVCLPPAGSVLPSPPASPV
FT                   SDGDEKEKEKEKEKEKEKEKRKLPLRAGKLPRKKNQTHAAGLSAKLTPALLSLILTFLL
FT                   ATPVLSLLLVLFGAPLTTHNAETVLCAAHMALLASTALIYVHGVDGAVWREVWAFARPA
FT                   DAVWGGALGTALGAWFGAVPIPLDWDRPWQAFPITILTGAYFGFAVGSVVCRSSWLFGK
FT                   WLEFTPEQDDRDKKTE"
FT   CDS_pept        complement(249207..250871)
FT                   /codon_start=1
FT                   /gene_family="HOG000185810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751287"
FT                   /orf_name="AFUA_2G01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87206.1"
FT                   /db_xref="HOGENOM:HBG051938"
FT                   /db_xref="HOGENOM:HBG325758"
FT                   /db_xref="UniParc:UPI000051F689"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP9"
FT                   /transl_table=1
FT                   /translation="MAGSSFSTERSSMQLRRHSTLAQDSYEGTALPQVTSQQMVVSPHG
FT                   PLRGSRSPILASALRGNSQGAAPLHAQDALTRGPITHRRTGSTLKTVMRKIFTRKRRSD
FT                   TDDLDGVVSDSPTPYSQTPRSNKDMTEVSFLELQSPKSQTPKSSSPLRREEGGSRMPQA
FT                   SSHSLAPAFSCRRRATLPSLIMSEDGRNAMETVFNTDNARWSRDRSSHANSDQTDLLRR
FT                   EDLRVKRRSRSADALRAMARDHKMSPIQWRRRSTETTYVNSSAFDMTSDSETSDRPPTR
FT                   TTVASTSKTPSERPAEGPQKQEELDSIVPNIGDLVNCMQHSEDISLEQRLTTLEVKLID
FT                   LEFAIARMQNVRAETLPAEAPRENKVSTPTKSRGHVRNKSSAHLQPAGTGELRSDEFTP
FT                   DGRPISTATIRPSSLQRSRPLQTPSSTSLSDFGGISVEQYSALVMLLRREQTARRNLET
FT                   QVTSLKEDIEKLQRLANNSISVGTMYPIRSRESQELDRMRKALARCPTDSATCSEKISS
FT                   PYESESDVESPGGSSRDDVFGRPKWQCNRRIEVARMI"
FT   CDS_pept        join(complement(255137..255699),complement(254995..255027),
FT                   complement(253473..254923),complement(253316..253376),
FT                   complement(253123..253207))
FT                   /codon_start=1
FT                   /gene_family="HOG000185831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056614"
FT                   /orf_name="AFUA_2G01090"
FT                   /product="DNA helicase, putative"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="EAL87207.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG083520"
FT                   /db_xref="HOGENOM:HBG713547"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniParc:UPI000051E843"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP8"
FT                   /transl_table=1
FT                   /translation="MSPEPISIPRFAQAQLQLLLQEHEAEISSSSLANTAASVSPSTRR
FT                   TLQATGYALTGIVLSQCRTGLGGRVVGEFTADAAVSSSKSTTNKIDDDRAGADGEPRLG
FT                   AHGIRVGDIVRVNDTSGSGSRKLSKDRGKAGGKDAVEASKGPEGVVTRVGERSIWIAFG
FT                   QRGGSGRSKEDDEAIEELWGKKLWLIKLANDVTFRRMNQTMEKMAKMTDSEYSHFMRVA
FT                   FGHTAPMQPDYGAIGPLEFVDPTLNDSQKEAIRFALAARDVALIHGPPGTGKTHTLIEL
FT                   ILQMVKRKLRVLVCGPSNISVDNIVERLAPNGVPVVRIGHPARLLPSVLEHSLEVLTHT
FT                   SEAAAIIKDVRKEIDEKQASIRKTRTGRERRAIYDDLKELRREFRERESRCVDNLVRES
FT                   NVVLATLHGAGGHQLKNQKFDVVVIDEASQALEAQCWIPLLSASKVVLAGDHLQLPPTV
FT                   KSSVDKLKNTKKKEKSDTKDASANSAEIIGDFSLETTLFDRLLSLHGPGIKRMLTTQYR
FT                   MHEKIMQFPSDELYESKLVAAETVKSRLLKDLPYEVEETDDTREPIVFWDTQGGDFPEK
FT                   TEDDDVGKKEALLGESKSNEMEALVVAKHVQNLIQAGVKPEDIACITPYNGQLSLLSSM
FT                   LREKYPGLELGSVDGFQGREKEAVVVSLVRSNSEHEVGFLGEKRRLNVAMTRPKRHLCI
FT                   CGDSETISKGSAFLKRWMAFLEEHADLRYPDAGELL"
FT   CDS_pept        join(258038..258386,258449..258963)
FT                   /codon_start=1
FT                   /gene_family="HOG000114205" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056615"
FT                   /orf_name="AFUA_2G01100"
FT                   /product="Pirin domain protein, putative "
FT                   /protein_id="EAL87208.1"
FT                   /db_xref="HOGENOM:HBG091023"
FT                   /db_xref="HOGENOM:HBG370454"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051FB8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP7"
FT                   /transl_table=1
FT                   /translation="MSKPLSHIKIALRRSSERGYAEHGGWLKTYHTFSFADYFDHRFLN
FT                   FGCLRVLNEDRVAARNGFPLHTHRDAEIFSYILSGELTHRDSMIKKGAEGAQGKQFYRM
FT                   RRGDVQFTTGGTGIAHSEQNESSKPVHFLQIWVLPWKHGLKPQYHTMSFSEEAKRKAFV
FT                   PILSPLAAGPEATPTEEEAARPKIPDTIPIHADFLMGAGIIAPNTTFKWNVGAGDVVSS
FT                   RKKRNVYIHLPMTKQGKAKIKLDGREDAVLEEGDGAFVTGVNAGDMLAVESIGEAEAEV
FT                   IVLDSN"
FT   CDS_pept        complement(259375..260850)
FT                   /codon_start=1
FT                   /gene_family="HOG000185832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265184"
FT                   /orf_name="AFUA_2G01110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87209.1"
FT                   /db_xref="HOGENOM:HBG051957"
FT                   /db_xref="HOGENOM:HBG325757"
FT                   /db_xref="UniParc:UPI000051ECDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP6"
FT                   /transl_table=1
FT                   /translation="MSGSKKGGKSLCQLPENAKLRILEYLGLVRPCLIDITGEAHRVKQ
FT                   AADHTCDTRNLFHTRGNWSTRAGQVCDHPRLPTEVLMVSRKFREDLGALFWSHNRFSFI
FT                   LTNLNDWDCFFNAVDWAAEDVRYLYIEMRTWDNRFIKPGGQRNLLRLWSRFCRYAALEM
FT                   VNLRYFSLKCRVKDMAVAVKIMSAMDPFPVLSECAFHFSHTPEEAIRPVVKSNALRLTG
FT                   NLSEDCTIPFPYFDLPKEVQLIILEFLLGNQLDPYLPPEGRLPGVISFMDRKSLRINES
FT                   RPLTCCGTCSSLKAACFCRARQTAYSTTCSCFSSPVSYFLVCRAFYEDARRIFFTINRF
FT                   AFVEEDPDFMMGFMNSIPTSSFMLICHLVFKFPAMHRHPAKPSHKPHEDSAMVSWSVLR
FT                   RFIREHFELSRLSLTIVDLGTKESSWQNAATHRNKYVRKLLEAFQDLRGLREFRVFLED
FT                   DQSYELTAEQLVMGRAVASRPLDFQFPFVENGH"
FT   CDS_pept        complement(261380..262678)
FT                   /codon_start=1
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265185"
FT                   /orf_name="AFUA_2G01120"
FT                   /product="DNA repair protein Ntg1, putative "
FT                   /EC_number="4.2.99.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="lyase activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="EAL87210.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG459731"
FT                   /db_xref="HOGENOM:HBG464473"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000051F68D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP5"
FT                   /transl_table=1
FT                   /translation="MRTSRTSKETASFLQALSPPTRRQTRSSSRTNVLQRFAFNASANG
FT                   QAETAPTTTGAQFQQSDGDDTSSLSSVDTVDIEDILEPPLKKRKSSPGSPSTKRTTRAP
FT                   GRTITKREAVKVESAKPKSRRVPARNIKGENGSIKIEPPSNWETIYSMVKKMRENNPTA
FT                   PVDTMGCAELYWRSSSPRDKRFQTLIALMLSSQTKDTVTAVAMQRLHTELGNGRALAED
FT                   PIVKKEEQEDIDLKSSQPLKDSTLNLENILAVSPEKLNELIRTVGFHNNKTKYIKAAAE
FT                   ILRDQYNSDIPSTAEELMKLPGVGPKMAYLCMSAAWGKDEGIGVDVHVHRITNLWGWHK
FT                   TKTPEETRMALESWLPRDKWHEINKLLVGLGQTVCLPVGRRCGECDLAGTKLCKSEVRG
FT                   LLSKKNAGVKPKDEVLKDDGLASGGAKVKVEGR"
FT   CDS_pept        join(263087..263243,263387..263724)
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207914"
FT                   /orf_name="AFUA_2G01130"
FT                   /product="Ubiquitin conjugating enzyme (UbcJ), putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="EAL87211.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000051EF31"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP4"
FT                   /transl_table=1
FT                   /translation="MASNSTTQRLLRELKDYTKSPNEALLHLGPVEEDDLLHWEAVLKG
FT                   VKGTPYEGGLWGLKITIPPNYPLAPPNIRFTTRISHPNISFTTGEICLTLLTTEHWSPV
FT                   YTLSTTLTAIHQLLTDPRPDSPLNVDVAALLRDGDIPAWESIVRYWTEEERWQGQGTAS
FT                   R"
FT   CDS_pept        complement(264333..265169)
FT                   /codon_start=1
FT                   /gene_family="HOG000185843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265186"
FT                   /orf_name="AFUA_2G01140"
FT                   /product="GPI anchored cell wall protein (Dan4), putative "
FT                   /protein_id="EAL87212.1"
FT                   /db_xref="HOGENOM:HBG051974"
FT                   /db_xref="UniParc:UPI000051FFFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP3"
FT                   /transl_table=1
FT                   /translation="MNRLIRLLFVSLAASSAIAAPAPEQSEPVPLPREDTFSENLNNIN
FT                   ENSIHRALHLIDRFRHGVFPTDRDAIDAIQREDRSLAAHLNLARDISNATTSSPNPPAT
FT                   TTQPPTTSTQPTTSETTTTSESQTTTSTPSNPPPTTTEQQPTTTTTSETTTSTTENTPQ
FT                   PTTAPTTTSTTTSEAPTTLTTASSTTEGPTTNHKHTTTRTPYTSTYKSTTTLPNGERST
FT                   VTAVTVVYPTADSSSPAATTTGPAPGLQTGGAASITGLQKELLVMLGGAAAVAMAL"
FT   CDS_pept        complement(267182..267817)
FT                   /codon_start=1
FT                   /gene_family="HOG000167026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265187"
FT                   /orf_name="AFUA_2G01150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87213.1"
FT                   /db_xref="HOGENOM:HBG051983"
FT                   /db_xref="HOGENOM:HBG333960"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI000051F6A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP2"
FT                   /transl_table=1
FT                   /translation="MHLIAFTLRCLMLVVSVKAQYEKLFTSGPAFVNFPYPTIPLNCSE
FT                   IGPSGSPLGVDHMEEGAGFFPALEWPSPAKIIREYLLVAEDPDGPLPHSVIHGVYYGIP
FT                   RVFTGLQHGDFQVSRTHNDSYMLEGGFKYGKNRRNTVYLPPKSIPEDGPHRYFFELIAL
FT                   SAPIDRSRLSDRATLREIADAIYGRVVGWGAWVGIVNNNRISIVRNNS"
FT   CDS_pept        268557..269294
FT                   /codon_start=1
FT                   /gene_family="HOG000038020" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265188"
FT                   /orf_name="AFUA_2G01160"
FT                   /product="C-4 methylsterol oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="EAL87214.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG013039"
FT                   /db_xref="HOGENOM:HBG314943"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000052047E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIP1"
FT                   /transl_table=1
FT                   /translation="MESKWKDIVASYPPQAIEFVGTVLVQVISFWLPSLCYLSLDALFP
FT                   SFSQRHKLQPALRQPGRRDIWQCFVVVVQNSVLSMGLHLFQIFVLQRGTSAFRIQASLP
FT                   PLAEFLRDFILCILLREALFYYSHRFLHSPFFYARIHKRHHKFTAPIALAAQYAHPIEH
FT                   IVANSLPISLPPQILGSHILTFWAFLAYELANTATVHSGYDFFKNKAKMHDLHHEKFNL
FT                   NYGSIGLLDWLHGTDKLEKKRKE"
FT   CDS_pept        join(272509..273105,273167..273928)
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265189"
FT                   /gene_name="gel1"
FT                   /gene_synonym="bgt2"
FT                   /orf_name="AFUA_2G01170"
FT                   /product="1,3-beta-glucanosyltransferase gel1 "
FT                   /EC_number="2.4.1.-"
FT                   /function="cation binding"
FT                   /function="transferase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL87215.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00005206E7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C7S9"
FT                   /transl_table=1
FT                   /translation="MKASAVTAALAVGASTVLAAPSIKARDDVTPITVKGNAFFKGAER
FT                   FYIRGVDYQPGGSSDLADPIADADGCKRDIAKFKELGLNTIRVYSVDNSKNHDECMNAL
FT                   ADAGIYLVLDVNTPKYSINRAKPKESYNDVYLQYIFATVDAFAGYKNTLAFFSGNEVIN
FT                   DGPSSSAAPYVKAVTRDLRQYIRSRKYREIPVGYSAADIDTNRLQMAQYMNCGSDDERS
FT                   DFFAFNDYSWCDPSSFKTSGWDQKVKNFTGYGLPLFLSEYGCNTNKRQFQEVSSLYSTD
FT                   MTGVYSGGLVYEYSQEASNYGLVEISGNNVKELPDFDALKTAFEKTSNPSGDGNYNKTG
FT                   GANPCPAKDAPNWDVDNDALPAIPEPAKKYMTEGAGKGPGFAGPGSQDRGTQSTATAEP
FT                   GSGSATGSSSSGTSTSSKGAAAGLTVPSLTMAPVVVGAVTLLSTVFGAGLVLL"
FT   sig_peptide     272509..272565
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C7S9 "
FT   mat_peptide     join(272566..273105,273167..273826)
FT                   /product="1,3-beta-glucanosyltransferase gel1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C7S9 "
FT   pro_peptide     273827..273925
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C7S9 "
FT   CDS_pept        join(275159..277342,277418..277696)
FT                   /codon_start=1
FT                   /gene_family="HOG000168798" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207915"
FT                   /orf_name="AFUA_2G01180"
FT                   /product="Cellobiose dehydrogenase, putative "
FT                   /EC_number="1.1.-.-"
FT                   /function="carbohydrate binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="carbohydrate catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87216.1"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052007"
FT                   /db_xref="HOGENOM:HBG331171"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR008960"
FT                   /db_xref="InterPro:IPR015920"
FT                   /db_xref="UniParc:UPI000051EA8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN9"
FT                   /transl_table=1
FT                   /translation="MRSFLFGGLVALSSTLGAFAANYNSSAYSDSASGIDFQRWCDANT
FT                   GFCFGLALPETVGTDFVGQLVVPLDSSKGWGGVSLGGSMTSTLLIAAWPNGNSVVSSLR
FT                   KTTNYANPDVYSGGASLTEIPDGTSVNRTHLTYTFLCSGCILGQPATFDATDETYFLGW
FT                   ALSKTSPTTPASASSALTYHAAGFGSFEMLLGQAKSSKYSTWAAMAKSTGGSPSSTPSA
FT                   SASVTPSPSRSPVPSVTPTVSNSTYDYIVVGGGAAGIVAAERLAEANKRVLLIERGVAP
FT                   TVEMGATDALAWNKTLTPVDIPALNQALTSLGVVGDYLCEDTPGMAGCVLGGGTTVNAM
FT                   ALIYPQEADFDDKWPAGWKWQDVKSAAARFYERNPGSLLPSADGRRYDQGMYTVLSSFL
FT                   SGLGWKSVDQHKQPNEKHKAFSYPSWSVANGIRAGPVRSYLPLVQNKDNFTLRLQTTVR
FT                   RLIRTGGHVTGVEVQNASGGIELIGIRPGGKVILAAGALSTPRILFNSGIGPAKQIKTV
FT                   QSGSTGITLPAQKDWINLPVGHNLKDHPMFTVKVNTGANFTAFNTSSVIPATNSLAQRL
FT                   YASGSGILTQGGHRLQFWTSNVASDGVTRFFQASCSPGGDGIITMKLYLTHGATSSGVL
FT                   GINAAGSTTIESDPLLQTPEDKEALTSFLQELLDDLKKASYTVQGSSSPADILAKVTSG
FT                   DHFVGTAKMGPDDGRRNGTSVVDTNTKVYGTDNLYIVDASIHPDLPTGNTQAIVMIAAE
FT                   AAVARILAQGSGPSSSSSIAVSAPSQNTAIAAVSSTPSATAVPVPVPIPTGGQETPGGD
FT                   SRCSAYRN"
FT   CDS_pept        join(complement(278982..279094),complement(278831..278926),
FT                   complement(278074..278641))
FT                   /codon_start=1
FT                   /gene_family="HOG000185854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265190"
FT                   /orf_name="AFUA_2G01190"
FT                   /product="Cu-dependent DNA-binding protein, putative "
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87217.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG052012"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI0000F5182C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN8"
FT                   /transl_table=1
FT                   /translation="MLIDGEKWACEACVRGHRVTTCKHNGTYSSILSLSFSKKGRPFST
FT                   CSVCNCTPCQAPEEHTKLRREAESNAFQPIAPRPSLDSATPTNPAASHAAISPPLGSRP
FT                   SAAGAVPARPGLSPRPRSSTETDPQLGMSQSPGYTSGDSYAQRPPQAHPGARSTTPALP
FT                   VPLPVFTTTAPTSHFPLTCGSFATPALASVADTPASMTLMHGDAHGAEFLFADGNGYAG
FT                   DGVFSLDDLDVGVGVGEGAMMPPEWGDHFWLGDDSV"
FT   CDS_pept        join(complement(283552..283596),complement(283467..283493),
FT                   complement(282867..283394),complement(282731..282811),
FT                   complement(281522..282677),complement(281077..281471))
FT                   /codon_start=1
FT                   /gene_family="HOG000185865" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207916"
FT                   /orf_name="AFUA_2G01200"
FT                   /product="Actin polymerization protein Bzz1, putative "
FT                   /function="metal ion binding"
FT                   /protein_id="EAL87218.2"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058493"
FT                   /db_xref="HOGENOM:HBG396561"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="UniParc:UPI0000F51817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN7"
FT                   /transl_table=1
FT                   /translation="MATADVAPHFGAELKDAFKPVNNWVSNGIQWLDEIQQFYRERSAI
FT                   EKEYAAKLTTLCRKYSDRKAKKISSLSVGDNPAMTPGSLESASLTTWTTQLTAVESHAA
FT                   ERDKFASELVAQVAEPLKQAAAQYEELRKCHVDFHAKLEKERDSSYSELKKAKGKYDGA
FT                   CQEVEARRKKMESSFDHGKSKAQAAYQQQILEMNNIKNMYLISINVTNKMKEKYFHEYV
FT                   PELLDGLQDLNETRVTKLNSVWSLAAQLEKASLSKSMDHMSHLLNEIPRNVPHLDSLMF
FT                   LRHNVTQVQEPPNMVFEPSPIWHDDESMITDETAKVFLRNLLSKGKTQVRDLRVESDQK
FT                   RREVDNAKRVRENVRQGKDNRNEVEVVRSIFFLQEALHEVERKRLAAEVETSTIISVVG
FT                   DLSLGAKNHNFKSQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHSKCQMKVPAECP
FT                   GEQTKEEKKKLKAERQEQAGAMPALDITPSNGTSAAPSLTRQNTMNSLSSGYAASANRS
FT                   LSNVTSQPASATEPAAPATPAAPAETKPAVAAPKRNRILAPPPAQYVTAPAPSESPSAP
FT                   AKSGEPRGKMLYPYQAGGADEITVQEGDDVGIIEPDDGSGWMRVRAGSRQGLVPASYVE
FT                   VLPTASPAPTASPGITDRPGSTYSNSSASLSGSMAAKRVGPAVAPRRGAKKLQYVEALY
FT                   DYEARSDMEWSMVEGDRFVLVNRDSGDGWADVERGGVTKSVPANYIQEV"
FT   CDS_pept        join(284424..284511,284578..284740,284807..285304,
FT                   285361..285598,285655..285855,285927..286208)
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265191"
FT                   /gene_name="dbp5"
FT                   /orf_name="AFUA_2G01210"
FT                   /product="ATP-dependent RNA helicase dbp5 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="EAL87219.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000F51841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIN6"
FT                   /transl_table=1
FT                   /translation="MASEQPVEAAPTGGSLADRITKPDESNTSETPAPIGDQTDGAPAQ
FT                   LGGSDLHEPEYNVEVKLSDLQADPNNPLYSVKNFEDLGLDPRILKGLSSMNFRKPSKIQ
FT                   ERALPLLLNNPPKNLVGQSQSGTGKTAAFVLNALSRVDLSTEQMQKTPQALILAPTREL
FT                   ARQILGVVQVMGQFVDGLIIGAAVPTDRDSRPKRLECSIVVGTPGTVGDMIKRRTFIPN
FT                   KLKVLVLDEADNMLDQQGLGDQCIRVKALLPRDIQVVLFSATFPEHVHQYASKFAPNAN
FT                   EITLQHEELTVEGIKQLYLDCADGEDKYRTLVQLYGLLTVGSSIIFVQTRAAAQEIERR
FT                   MTAEGHTVVSLTGERDPSVRDAIIDQFRRGEAKVLIATNVLARGIDVSTVSMVINYDIP
FT                   ELHQPNVPGRQADFQTYLHRIGRTGRFGRVGVSISFVSNREEWEMLNQIQTYFNCEIQR
FT                   VDTKDWDEVEDIIKKTIKNSRANPKFAGGKD"
FT   CDS_pept        join(286825..286923,286985..287941,287993..288274,
FT                   288322..288327)
FT                   /codon_start=1
FT                   /gene_family="HOG000077582" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265192"
FT                   /orf_name="AFUA_2G01220"
FT                   /product="GTP cyclohydrolase II, putative "
FT                   /EC_number="3.5.4.25"
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="EAL87220.2"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG052034"
FT                   /db_xref="HOGENOM:HBG323958"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="UniParc:UPI0000F51840"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN5"
FT                   /transl_table=1
FT                   /translation="MGDTTTATMPDAPSTQSSTSPTTPSTGYSKHIVLTTYPGQSGIDP
FT                   VPLVWGAPDAKSRGPVIVTRSAGMLKRRNAIGAHGGSYSIYNALAIAAGDLDVNFRPDF
FT                   RNSEPTFNFPWQPSWADKTKIVSMDPYGHDIVNQFREELEAGWDIRPTMAVTRANMKLA
FT                   EIGEAVKNGQLGVDGSIVVDSSGEVRVTKVAVEPVWYLPGVAERFGVDEGTLRRTLFEH
FT                   TGGSYPELITRPDLKVFLPPIGGLTVYIFGPPERVSDENVKLALRIHDECNGSDVFQSD
FT                   ICTCRPYLAFGIREAIREAQNGGSGVVIYFRKEGRALGEVVKYLVYNARKRGGDTADKY
FT                   FTRTENIAGVRDMRFQALMPDILHWLGIKKIDRMLSMSNMKHDAIVQSGIKILKRVPIP
FT                   EELIPSDSRVEIDAKINAGYFTTGKQYTMEELASVRGRGWEKWEDVTH"
FT   CDS_pept        288906..289901
FT                   /codon_start=1
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751288"
FT                   /orf_name="AFUA_2G01230"
FT                   /product="Dihydrodipicolinate synthetase family protein "
FT                   /EC_number="4.2.1.-"
FT                   /function="lyase activity"
FT                   /protein_id="EAL87221.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG358848"
FT                   /db_xref="HOGENOM:HBG370502"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051FFFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN4"
FT                   /transl_table=1
FT                   /translation="MGSSQPPTVSPQPHVPKPGVWCPAVTFFDHTTDTLDLDSQKKYYA
FT                   YLSKTGLAGLVILGTNSEAFLLTREERAQLIAAAREAVGPDYPLMAGVGAHSTKQTLEL
FT                   AADAAAAGANYLLVLPPAYFGKATTMSVVKRFFADVAARAPLPVIIYNFPGVCNGVDID
FT                   SETMTAIVRESAAASPSGVSNVVGVKLTCASVGKITRLAATFSQDEFAVYGGQSDFLLA
FT                   GLSVGSAGCIAAFANVFPRTASRVYELYRAGKVDEAMALQQKAALAESPCKSGIAATKY
FT                   ATAVFSASQAGIEAAGEKLRPRTPYEEPGEGVKQLVREVMAEVAEIERSI"
FT   CDS_pept        join(290755..290926,290977..292349)
FT                   /codon_start=1
FT                   /gene_family="HOG000181424" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903351"
FT                   /orf_name="AFUA_2G01240"
FT                   /product="Beta-fructofuranosidase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87222.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG086617"
FT                   /db_xref="HOGENOM:HBG693902"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="UniParc:UPI000051E3B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN3"
FT                   /transl_table=1
FT                   /translation="MRASFILFSAAVAAAQTANYSGPLRPQVHFSPPSQFMNDPNGLFY
FT                   DHKREVYHLYYQYNPSEIVAGNQHWGHATSKDLYHWTNHPIAIAPSQPGEWIYSGSAVM
FT                   DSNNTSGFFPDQDDGVVAIYTLATETLQTQQIAYSRDGGYTFTKYENNPVLDIDSSQFR
FT                   DPQVTWHPETQKWVMTIAYADDRVIGFYTSPNLKEWTHASNFTQSGLPGTQFECPNLVK
FT                   FSVDDCDDSEDPTKWVLFISVNPGAPLGGSGTYYVVGSFNGTHFTSESPRETLYDFAKD
FT                   NYASQWYSGIPEDEPPVSIGWASNWNYTQQVPTGPLEGWRSSMSLPKVHTLTKVDGSWV
FT                   VTKEPFDGLDSVRGKQLKGKRSRNGDVTFDFKNVKSNAVAFDVKINGIPSSGATGQVYF
FT                   NFTSSTSGEYVDGGLRLDNGFFWINRAGTHLFTQANSTGYWPVFNTTVKSYDHHKFTFS
FT                   GVIDRSLLEVTLAEGVQTGTMSFYPTHPLDTLTVSGSDLSKKTSFRAKAWGLESGW"
FT   CDS_pept        join(293643..293874,293953..294066,294126..294280,
FT                   294343..294465,294517..294689,294749..294836,
FT                   294898..295003,295064..295223,295277..295474,2
FT                   95531..295759)
FT                   /codon_start=1
FT                   /gene_family="HOG000185876" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207917"
FT                   /orf_name="AFUA_2G01250"
FT                   /product="Serine peptidase, putative "
FT                   /EC_number="3.4.-.-"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL87223.2"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="HOGENOM:HBG052060"
FT                   /db_xref="HOGENOM:HBG323961"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="UniParc:UPI0000F51807"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN2"
FT                   /transl_table=1
FT                   /translation="MRTAAASLTLAATCLFELASALMPRAPLIPAMKAKVALPSGNATF
FT                   EQYIDHNNPGLGTFPQRYWYNPEFWAGPGSPVLLFTPGESDAADYDGFLTNKTIVGRFA
FT                   EEIGGAVILLEHRYWGASSPYPELTTETLQYLTLEQSIADLVHFAKTVNLPFDEIHSSN
FT                   ADNAPWVMTGGSYSGALAAWTASIAPGTFWAYHASSAPVQAIYDFWQYFVPVVEGMPKN
FT                   CSKDLNRVVEYIDHVYESGDIERQQEIKEMFGLGALKHFDDFAAAITNGPWLWQDMNFV
FT                   SGYSRFYKFCDAVENVTPGAKSVPGPEGVGLEKALQGYASWFNSTYLPGSCAEYKYWTD
FT                   KDAVDCYDSYETNSPIYTDKAVNNTSNKQWTWFLCNEPLFYWQDGAPKDESTIVSRIVS
FT                   AEYWQRQCHAYFPEVNGYTFGSANGKTAEDVNKWTKGWDLTNTTRLIWANGQFDPWRDA
FT                   SVSSKTRPGGPLQSTEQAPVHVIPGGFHCSDQWLVYGEANAGVQKVIDEEVAQIKAWVA
FT                   EYPKYRKP"
FT   CDS_pept        296897..299863
FT                   /codon_start=1
FT                   /gene_family="HOG000185887" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056616"
FT                   /orf_name="AFUA_2G01260"
FT                   /product="HLH transcription factor, putative "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87224.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG052069"
FT                   /db_xref="HOGENOM:HBG331487"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR019006"
FT                   /db_xref="UniParc:UPI000051EA8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN1"
FT                   /transl_table=1
FT                   /translation="MSTPGIGGDFQLFSPLESTRRISQGNSLSVDQSSTDVASQDWTQW
FT                   MRWDDEQAFPETANASPSSPFDLAFISPSASSGREASDAMHKDFSPDISLDFKSPSLGF
FT                   FPGGDLNTNVSPQPDHVGAGSLSVHSNSPLSSIGASRKRKTGSDDDGSTMTSMFKAKQA
FT                   PSKKRAHNVIEKRYRANLNEKIAELRDSVPSLRASYKQANGNSGDDDDDGVTSASKLNK
FT                   ASILSKATEYIRHLEIRNKRLEEENTALKIRLRQLDKAADQIVTSAASVSSPSDCTVST
FT                   ESGASSSPSVFSHAEDVPSDHSPTSSHPPEGLIKVPDAWKRMRAAGSNESPYSQSYIQY
FT                   KKTDSHSSQSGGGRMRSHLPNKYMLGALAGLMVLEGLGTEKKTESTAKGLLAVPLNLLN
FT                   RVQLPSEVYSSAAFQYFWSSWHARAISHFLMLAILVVGSAFIVFVYLFNSDPRRQYSAS
FT                   KVAPDVTLSSCNFRRQAWLTSIQRVGVPRHRFFHEWYVVTSRCFEYVLRCLLGWKLYSL
FT                   VTGVTEEDEKGRVKTWDIAIDAQLAGGDAEISKSRLVLTIFAAGTLPRSPMRMMLKALH
FT                   CRILMWRVGEPGSWTFNVSNDVARSLARYQWDLARKMNAALPKDHPDSLPSHLATLLKI
FT                   DCDDVMIDTIIQRAANLTWNRPTQEGTDDDEALLDVVEEDPAIQSSLDALAAWWSSHLL
FT                   QGALLRYFEASSGGPDAKKSRNVFKSKIKLALDVAPQPSAAHTRALVMMAVFFERDRVA
FT                   NIGSVLAALPKEKGKNKQNQASNFLDSSLPISVREEISTAVRCAMIAAIFNARATGDTS
FT                   LPATFTVEKAIHWFNRLPLDPVELTLLEFAAVYHLLHILASDIDYLASSDSSAPPSPMS
FT                   KASDMLSSSSDDGEDGASQRNNNIIPHPMPNLGRVASELIYWARNAYNPAFYGFTSNLV
FT                   KVIETECTSLCQTAGVHVADYSCVQEEKSKAKQAIDSKRRFAGGNEEASDNLLLSDES"
FT   CDS_pept        join(302148..302387,302447..302885,302947..303110,
FT                   303201..303600,303671..303832,303883..304277)
FT                   /codon_start=1
FT                   /gene_family="HOG000048342" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265193"
FT                   /orf_name="AFUA_2G01270"
FT                   /product="Ferric-chelate reductase, putative "
FT                   /EC_number="1.16.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87225.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052075"
FT                   /db_xref="HOGENOM:HBG325750"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051FB71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIN0"
FT                   /transl_table=1
FT                   /translation="MGVELGGPGVDHSHPGYPHRPMNPVLATPLFVLSGVFTVLFLCRV
FT                   VIRFQHRRRLREILQTEDQCKFSRTSVIFAWIKKHASYGKHTLTTGSYVSSGIYHDQFA
FT                   FLVRPSRLVDGLSRKDVPTKICRWTSGSDEFTCARLERGSEQSPHPTSGHSFRHIQFPA
FT                   PLGRTSHDSWGPDSYGLCHWGPGNAGWVVQPSQMMAAADKGNSIHGRNHEGTLESAFLC
FT                   IWDDCPYCICSYFLSISITNSACILRSLSSFSYIPRNHGICWAVVSSAWLGPAAGSFGH
FT                   RIARLVSILWRNCGKQRTSATVELLPGDVARVEVAVSRPWKFKAGQYMYLYIPSLGLWT
FT                   SHPFSVAWTSSDRMTTNKKRDSSDSFNVLLGGRQRTTMSFLIKRRDGFTNKLLTKVHRS
FT                   EAGRFNATALAEGPFGGLHSLASYGTVLLIAGGIGITPPLSYLHEFADGFSDRSMAVRR
FT                   VTLVWVVRHLEHLDWIQPWMASLFDHPAVEAPNERKQTSYFQLSKFSLTIQVYVTAKGY
FT                   TTDEHLSNKSPWTKSPPSTVSISIKHGKPSFAEVVEAEMEQQVGAMAVSVCGPGGMGDD
FT                   VRQAVRERQNGRLVDLYEDTFSW"
FT   CDS_pept        join(complement(305544..305859),complement(304748..305484))
FT                   /codon_start=1
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207918"
FT                   /orf_name="AFUA_2G01280"
FT                   /product="D-mandelate dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87226.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052086"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM9"
FT                   /transl_table=1
FT                   /translation="MTSKYRVLHIGDNIKYNHDVYERFASEFEIIQPTAAERERGEFMR
FT                   ALKERRWGDFHAIFRPFWNTGGEMGRWDAELIPLLPPSVRIMASAGAGYDWADVDIFAQ
FT                   HGIVYCNGAAASSESVADMTLFLILAVFRNLAWSHQAAHSCNPQRFLDAHKNSPLTALN
FT                   PRGRILGIIGLGQIGYTIAKKAHAAFGMQIAYHDLVRKSAEAENAVGARFMGELDELLG
FT                   LADCVVVATPFAGRTLIDAERLGKFKRGARFINIARGSLVDEEALLRALDEGQISAAGL
FT                   DVHAEEPYVHPRLARHGRVMMMSHNAGGTVDTHVGFERLAMENIEEFLLRGKALTPVNL
FT                   HLIKTPKSML"
FT   CDS_pept        join(complement(314095..314706),complement(313692..314040),
FT                   complement(313555..313639),complement(313345..313504),
FT                   complement(312730..313290),complement(312563..312683),
FT                   complement(312344..312503),complement(309936..312285),
FT                   complement(309542..309877),complement(309417..309478),
FT                   complement(309264..309352),complement(307440..309202),
FT                   complement(307061..307381),complement(306145..307005))
FT                   /codon_start=1
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265194"
FT                   /orf_name="AFUA_2G01290"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="phosphopantetheine binding"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87227.2"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052093"
FT                   /db_xref="HOGENOM:HBG323967"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI0000F5181F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM8"
FT                   /transl_table=1
FT                   /translation="MAGITSTDGLPPLAVVGFSFKFPEDATSSDSFWQMLLDGRCVSSE
FT                   FPADRLNIDAHYYPDRNRLDSISMRGGHFLKDNIATFDAPFFAMSAAEAEAMDPQQRMV
FT                   LETVYRALENAGLPMEKVAGSKTSVIAGSFSDDYFLLQTKDPLDMPKYTAVGTSRNMLA
FT                   NRVSWFFDLLGPSAAVDTACSSSLIALDMTCQSIWSRDADMGLAIGSNVILTPELTMSL
FT                   DNLGLLSPDSHSYSFDSRANGYARGEGIGVIVIKRFDNAIRDGDTIRAVIRSSSSNQDG
FT                   KTPGITQPSKEAQVRLIRDTYKKAGLDMSLTRYFEAHGTGTPIGDPIEIRAIGTAFRRY
FT                   RSPEQPLYVGSVKSNIGHLEGASGVAGVIKVILALEKGIIPPNSRNLQFLNPQIDEEFL
FT                   NLKVLQKAIPWPENDLRRASVSSFGFGGSNCHVVLDDAYNSLRLMGIEGSRHQTVVVPP
FT                   SLEVTALVAHGKCGYTTNAGSDQPNDDHPNGLHDEEETHQLLVWSTADEEGIERLVETW
FT                   KPFLSDKREFSRSQRRQYLLDLAYTLGQRRSHLQWRSYAIGDALEDLGSLADRFTPAIR
FT                   STDESHIAFLFTGQGAQWHAMGRELLYRYPIFADSLAESAKYLKTLGCTWDLLNELQKS
FT                   KSDTNVNNPAYGQPMSTALQVALVDLLDSWGVVPSAVVGHSSGEIAAAYCAGGLSKRSA
FT                   LKASYYRGFLAAKLEKLSSMKGSMLAVGLSKKDTEEYINRIQDSTLVVACINSPKSVTV
FT                   SGEAEQIDTLHDLLQQDEVFSRKLMVNVAYHSSQMQKLADEYQSAMGTLEKPSCEKKKI
FT                   PVMLSSVTGDWVSSLELMDPAYWVRNMVSPVLFSDAVSRICSSSRKQTRKIDRSHRYHM
FT                   AINHLLEIGPHAALQGPCRDILKSINKQADIPYLSVLVRNKSAVKTALDCAGRLHCYGY
FT                   PINLALVNKTAYSGTNQRHVLSNLPEYPFNHSASYWRESRKSKGYRCRRFGRLDLVGIP
FT                   DPDGNPMEATWRNIIRVSEMPWVHDHKINNTILYPAAGMLVMAVEAIKQLVEPDKVIVG
FT                   FNIKDAVFSSALHIPTHADGIETNLHMKRVREGKADSSGWYEFRICSYDNNTWIENSTG
FT                   SIQAAFESGEMGLNTNGRVEHEWQKGLVQSYQNAAYKCSEPIDASQFYEDIFACGYHYG
FT                   PNFKAITALRCDGKPNGQFVSDVRTYRWVEDASSAVAQPHTIHPTTLDAVIHMMAGIVT
FT                   YGSQKKPVAVPTRIDQAWISNSGLSHPTADSIKVHASSHRSATGDARYSMTAVDCEMTR
FT                   ALLTIRNLRVTALESSEGVSEDDQLQTENLCHHIEWKPDLDLLENEEIRAFCGSGESIS
FT                   EDPVQYFTELDFLVTTYVDKVLKSIPDVKIDHPPHMQRYMEWMVDQQRALELGYSPFSS
FT                   ATWRNRMKDESFVNDIHAKLESTNKRGLLVSTVCRNLFKFVKGEIDPMVLLFQENLLDD
FT                   SYYEMVHSLPRIRQFARYLDAQAHKNPHMKILEVGAGSGAMTQFCLKVLSTNSENDATV
FT                   PRYGQWNFTDISGSFFPKAQDLFASQGTRMRFKMLDIEQDPGLEGFECGTYDMVVAFLV
FT                   LHATKDLSASLKNVRKLLKPGGKLILIEITRPGAIRTTFVFGLFEGWWRGLEPYRQKNP
FT                   CADPAQWDRHLKEAGFSGCDVVMDDYSHGDCQEASLILSTAVDDTPAVEKSLKISIILD
FT                   PANYAQVELAGELEAQLVRAGLANVTQRPVGHSLIQEDPTNSLDITVLEGYSPHLYEIN
FT                   EQEFKRLQSLLSSTRNLIWVNGGGGQEPCPKYRLVDGLFRVLREENHRTRLTILSLDQK
FT                   ASIKHQAQQIAKLAISAVTHDTSIDTDYTELDGMLHVGRLVHATGVNQEISAKKLPQQK
FT                   ALRQFGAGPRLRLEIGSPGLLNTLHFVEDTSHRKPLKPTEFEVQVKSVGLNFRDVLIAL
FT                   GRLDSEALGAEFAGIVTKVGPSCRKFQPGDRVLACYPSRHANYVRLKENMAVIKIPDTM
FT                   LSFSEAAALPVAYATAWIALNQIARLQQGETILIHSGAGGTGQAAIQIAQLLGASVFTT
FT                   VSNENKKRFLVEKYNVPENHIFSSRSTLFAKGIKLLTNNKGVDVVLNSLSSEGLIASWE
FT                   SIAPYGRFIEIGKNDILSNAKLPMLQFEQNITFAAVDLAAMTMDRPHVVTAALETILSL
FT                   LREGKISLPDPLQVYGISDIEVAFRQMQSGKNSGKAVLEMRDTDEVMTVLETRPEYLFS
FT                   PNETYLIAGGLGGLGRNIARWFVERGARNLILLSRSGSQNPHAPDLIRELEAKGARVAT
FT                   PACDITDRECLKAVLYEFGQTMPPIKGCVQASMVVSDAHFEGISFESWKASTTPKAQGS
FT                   WNLHELLPRRMNFFVLMSSVAGIYGARGASGYAAGNTFEDGLARYRVAMGEKAVSFDLG
FT                   MFLNVGVLKDNLALRERTLASTVFQQITESDLHALLDIYCNPSLDEIPLLKSQVVVGMT
FT                   PKLREKGMTTTEWIRRPFYQHMTLAEGTDAGILGKAEHTNFAALFASAGSVADITAAVT
FT                   EQLKIKLSKMLSLPLTEIDVDKPIHQYGVDSLAAVELRNWFSRELRADIAIFDILGGAN
FT                   IASAVGLAVRKSDYRRAEWDLDRAQLK"
FT   CDS_pept        join(315439..315448,315497..316044)
FT                   /codon_start=1
FT                   /gene_family="HOG000179054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056874"
FT                   /orf_name="AFUA_2G01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87228.2"
FT                   /db_xref="HOGENOM:HBG052102"
FT                   /db_xref="HOGENOM:HBG323969"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI0000F51814"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM7"
FT                   /transl_table=1
FT                   /translation="MYPGVETIALDNEPVFAYFDDKDPQSGLVVYQHFEQHLRNEGPYD
FT                   GVIAFSQAATMILTYLIYVFSRRNRGDEVDCPFRFAVLFSIVRPPIDYEELQRGRFVEV
FT                   DLGDVKDIVEIPTVHVWGALEESASQAAMASDACRSDMKWTYVHDRGHEIPGSGSKDAV
FT                   TKTANAIRRAIETASDHLAIKQ"
FT   CDS_pept        join(complement(316911..316971),complement(316120..316841))
FT                   /codon_start=1
FT                   /gene_family="HOG000179054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266176"
FT                   /orf_name="AFUA_2G01310"
FT                   /product="EF-hand calcium-binding domain protein, putative "
FT                   /protein_id="EAL87229.2"
FT                   /db_xref="HOGENOM:HBG052109"
FT                   /db_xref="HOGENOM:HBG323971"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI0000F51810"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM6"
FT                   /transl_table=1
FT                   /translation="MKVLCLHGKGTSGAIFKSQTASFRSHLNDLDIDFDFIDGCYPSTA
FT                   AAGIDLFYPAPYYSFWEDDSPEAITKTCTWLKGLIAERGPYDAVMMFSQGCALGTAMLL
FT                   LHQAQDPTQPPPFKAAIFICGGPPLKLLESIGFEVSDAVKERDRAGREALATQAHSASI
FT                   LARGSARWMGDASRGGAVDEEELRGAIRGPFTVGVPTVHVYGSKDPRYAAGVQLSGICE
FT                   PGKRRVFDHGGGHEIPRTDRVSRTIAELVRWVLLEASA"
FT   CDS_pept        join(complement(320718..320995),complement(320531..320657),
FT                   complement(320377..320471),complement(318420..320322),
FT                   complement(317537..318373))
FT                   /codon_start=1
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208178"
FT                   /orf_name="AFUA_2G01320"
FT                   /product="Potassium/sodium P-type ATPase, putative "
FT                   /EC_number="3.6.3.7"
FT                   /function="ATP binding"
FT                   /function="sodium-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87230.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008554"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000052048E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM5"
FT                   /transl_table=1
FT                   /translation="MGIETSPPDVEESTEPPICPCTDKHTSVPSNHICEVKAELGVEKL
FT                   EYPATLEFSTPNLIESANAAFGDDESSAHCAHTLPPERLASLLQVDIQNGLSSGEAATR
FT                   LERDGPNRVQEIEGVSTWKILLRQVSNSLTMVLLITMAISFGIHDYIEGGVITAVIVLN
FT                   IVVGFVQDYRAEKTIMSLHRLSAPVCKVLRDGRVVSVPAESVVLGDVVHLTVGDIVPAD
FT                   LRLIDGTNVSMDEALLTGESLPVNKTPHIVLSSHNMPIGDRTNMAYSGCSMTQGRATGI
FT                   VTATGMKTEVGRIAKLLQETSDDADSSRLVQAVRRVKSTAENVLGLAGTPLQVKLSKFA
FT                   LLLFALAVLLAIIVFSVNKWDIEGEVLIYGIAIGVAVIPESLIAVLTITMAVGTKAMAK
FT                   GNVIVRKLQCLEAVGGVTNICSDKTGTLTQGRMIARTAWIPGAGVLTVQDTTDPYDPTS
FT                   GLVQLNGSGWAPEKHCDNPALSTFLTTISLCNMSVVQNEEPSGPSSGRWTAVGEPTEVA
FT                   LNVLALRVGYEKSTILQRAGMQLHTEYPFDSSIKRMTIVYKNSGESMNEVYTKGAPEAV
FT                   LPGLAISEKEKEEIQYEADRMAGEGLRVLCIAHKRAPLEDESQVSSRAMAEVNLEFCGL
FT                   VGLYDPPRAETAAAVRKCQMAGITVHMLTGDHIKTATAIASEVGILGPMLDSRSCRVVM
FT                   AAAEFDELSDADIDAIEQLPLVIARCSPATKVRMVEAMHRRGAFCVMTGDGVNDSPALK
FT                   RADVGIAMGKNGSDVAKEAADMVLADDNFSSIVKAVEEGRRLFDNIQKFLMHLLISNIA
FT                   QVILLLIALAFKDEQGDSIFPLSPLEILWANLVTSSFLALGLGLEEGQPDLMYRPPHDL
FT                   KVGVFTKELITDKMIYGTFMGSLCLVAFVCVIYGAGAGISDLGEDCNNGWNETCNVVFR
FT                   ARATTYASLTFLLLITAWEVKHFSRSLFNLDPDKYPGKLSVVQSIWRNRFLFWAVIAGF
FT                   VVAFPVIYLPAVNRLVFKHQGIGWEWGIVFGCVAVYLALVESWKAIKRAYGIGSGKNAT
FT                   LTMGDTEMRAGLTLTPCTLLSMSANASVEMK"
FT   CDS_pept        join(322550..322885,322967..323380)
FT                   /codon_start=1
FT                   /gene_family="HOG000185343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266177"
FT                   /orf_name="AFUA_2G01330"
FT                   /product="Exosome complex subunit Rrp46, putative "
FT                   /EC_number="3.1.13.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87231.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052124"
FT                   /db_xref="HOGENOM:HBG323973"
FT                   /db_xref="UniParc:UPI0000F5181E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM4"
FT                   /transl_table=1
FT                   /translation="MVGPTASLTPLKRADGSASYKCPSSGFDILGSVNAPVELPGRRDA
FT                   LKPEEATIEVFVKPGTTPGGVGERYVEGILKTMLGRLILGREKGYPRRGVVLTLAIVGG
FT                   ESVCRGDSYLTLLPALLHASLLALISASVPLSMTFAASILAVTSSGDIIRQPSVSQAAA
FT                   AKSLHVLAFSSKGHLLLNESQGTFDFATWEKVHQHASAICRGTLAGNADDDVSMGEEGG
FT                   EQGLEKFMRETIEDKVYQDYAWKIDAA"
FT   CDS_pept        join(complement(324106..324294),complement(323929..323949))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266178"
FT                   /orf_name="AFUA_2G01340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87232.1"
FT                   /db_xref="HOGENOM:HBG052129"
FT                   /db_xref="UniParc:UPI000052023B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM3"
FT                   /transl_table=1
FT                   /translation="MANIDGGKGPTVLRSVHILENVEQPRQPGSDVTGFGLFLSQGTRV
FT                   KNVRQIMAAQSAFRSASMDWLSLT"
FT   CDS_pept        join(324469..325936,325993..326498)
FT                   /codon_start=1
FT                   /gene_family="HOG000176769" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266179"
FT                   /orf_name="AFUA_2G01350"
FT                   /product="NAD+ kinase Utr1, putative "
FT                   /EC_number="2.7.1.23"
FT                   /function="NAD+ kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87233.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG052137"
FT                   /db_xref="HOGENOM:HBG713904"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI000051E3A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM2"
FT                   /transl_table=1
FT                   /translation="MASSSSSHGPLKPQSDTLPSECSALLSSSSPPLSSATPLSDPTSP
FT                   DSCPLTSTTVGVSLLRDYASHIDPSQSTNDLHVNQSTSGLSNSRANVPQKLELHQQEAP
FT                   PVASLPTSPFLSFRTAGPLGSQHRKNASSSDLIPRQTIMKALASRPSLCTNPNSNAPLA
FT                   ASLGLLATSPTSSSSAETEQQRSSNSSSQKLSAALSNLQLGKYLERSPSTAQLVLQSPC
FT                   FFHRRFDDAVNIQKVLEEISDDEWLSHSRLVQTATGVREVSKQLQRRPIKRAVKNVMIV
FT                   TKARDNRLVYLTRELAEWLLSTPRYGSDLGVNVWVDSKLRNSKRFDAAGLLQSEPRFEQ
FT                   MLHYWTPDLCWAAPEKFDLVLTLGGDGTVLFTSWLFQRIVPPVLCFSLGSLGFLTNFEF
FT                   ENYKSHLNDVMGDVGMRVNLRMRFTCTVFRKDRSKGAEAGAVEEGEQFEVLNELVIDRG
FT                   PSPYVSNLELYADNDLLTVVQADGCIFSTPTGSTAYSLSAGGSLIHPSIPGILLTPICP
FT                   HTLSFRPMVLSDSLLLRIAVPTGSRSSAYCSFDGKGRVELRQGDYVTVEASQYPFPTVV
FT                   SGSGEWFESVQRALRWNTRGAVQKSWNRDGTDDISADEEEEEWDIDTDAGLVGTDSGLG
FT                   PSEDGDSGTTSPMKRQMSLLNM"
FT   CDS_pept        join(complement(327702..327830),complement(327645..327658),
FT                   complement(327173..327593),complement(327005..327115))
FT                   /codon_start=1
FT                   /gene_family="HOG000022909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208179"
FT                   /orf_name="AFUA_2G01360"
FT                   /product="GAF domain nucleotide-binding protein "
FT                   /protein_id="EAL87234.2"
FT                   /db_xref="HOGENOM:HBG052147"
FT                   /db_xref="HOGENOM:HBG704019"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="UniParc:UPI0000F5180D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM1"
FT                   /transl_table=1
FT                   /translation="MVRIALPVDTLPTTHSGCADHTTNQPHADSSYFSTSQEPTKAEAS
FT                   AIGSGNHPPPCRRNQAHKDLDPLLTAQPSNFSNIASLLWHAYAALPSPSSSVNWAGFYI
FT                   RQDKFPALGSQNTRSNSTNNLLLLGPFQGRPACQEIRFGRGVCGTAAEKRETVIVPDVL
FT                   SFPGHIACDASSRSEIVVPILVGGETVAIIDVDCTEPAGFDEEDKKWLEELASLLAECC
FT                   DW"
FT   CDS_pept        join(complement(330875..330962),complement(330768..330828),
FT                   complement(330475..330707),complement(329578..330420),
FT                   complement(329174..329523))
FT                   /codon_start=1
FT                   /gene_family="HOG000185331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751523"
FT                   /orf_name="AFUA_2G01370"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87235.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F5180F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIM0"
FT                   /transl_table=1
FT                   /translation="MAIIEEDNKQVFQPTAAEDMRLENLGYEQELKRTFGLLGMIGFSF
FT                   SIVTSWTALSGVFIVGVTSGGPPVMVFSFVGVSLLTLAVAIPMAEMCSMYPVAGGQYSW
FT                   VAALAPPKIARGLSYISGWFMLIGVLAMGATNNSIAANFVLGMANLVFPEYTIERWQTV
FT                   LVAYLVAFIATALNIWGPHLLNRISRFILIWNVGSFIITMIVLLATNDHKQPAAFVFSE
FT                   FQNFTGWGPAMAAIVGILQSCFGMCCYDAPAHMTEEMKSASKEAPKSIILSVVLGAVTG
FT                   FAFLLTLCFCIGDINETASTSTGVPVIQIFYDSTGSKVGACFLSSMIAVIVIVAGNNLL
FT                   AEGSRSVYAFARDHGLPFSKVFAKVESKRQVPVNAVLLTLAVQLALDAIDFGTTTGFET
FT                   VIAIATEGFYLSYAMALFSRLLGYVTGYQREMKGPFSLPPWISITLNVLGLLFLLFASI
FT                   TFNLPTQYPVNRDSMNYTSAAIGVVALISLVTWFTTGQKHFTGPGGMSVLHGREEVAQS
FT                   EAEVEKK"
FT   CDS_pept        complement(332887..333432)
FT                   /codon_start=1
FT                   /gene_family="HOG000076684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266180"
FT                   /orf_name="AFUA_2G01380"
FT                   /product="GNAT family N-acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL87236.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG081983"
FT                   /db_xref="HOGENOM:HBG377323"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051E395"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL9"
FT                   /transl_table=1
FT                   /translation="MTRTASVPINHITIRTHQPADIEWIISRHGTLYAEEYNFNDKFVA
FT                   LVSKIASDFQQNHDPTSERCWIAERTGKTTNEPVGCIMLVKDVDSPDTARLRLLLVDPS
FT                   ARGTGVGRSLIKQCIEFAREVGYRRVVLWTQSILGSARRLYKAEGFRLVKEEEHEGFGM
FT                   ALVGELWELELENKSQGE"
FT   CDS_pept        complement(333820..334449)
FT                   /codon_start=1
FT                   /gene_family="HOG000216911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266181"
FT                   /orf_name="AFUA_2G01390"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL87237.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG052169"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051ECC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL8"
FT                   /transl_table=1
FT                   /translation="MTFYQARAEECPFAADAQVDLVTAAQSAHWFDYAKLWPEMRRTVR
FT                   SGGTLAFWGYKDHVLVSYPRATSIINEYAYGQDPWLLGSYWQQPGRSIVQQKLRAVQPP
FT                   VEDWEDVSRDEYEPGVEGGTRFMHARMTLGSMEEYVRTWSSFHAWQRKWPDRIRRAPGN
FT                   TDQRGDVIDEMMDKIQETEPSFQRDDWKDVEVDVEWGSALILARRR"
FT   CDS_pept        join(335414..335891,335939..336258)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266182"
FT                   /orf_name="AFUA_2G01400"
FT                   /product="Short chain dehydrogenase/oxidoreductase,
FT                   putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87238.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051FB72"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL7"
FT                   /transl_table=1
FT                   /translation="MLQPSSESSLAGKTCLVTGGAGGLGKAIASTFLAAGANVVVCDVN
FT                   EDRLQQTSSELGETDRLKTVRADITSASAVQTLFDEIIADFGKLDILVNNAGIMDRFDP
FT                   VGDLDEALWDKVIGVNLTAPFLLSKLAVRNMLAQPTPDGCIINIVSVAGKAGWAAGAAY
FT                   TASKHGLVGLTKNTAAFYGNKGIRCNGLLLGGMDTNITDAFQAGFNKEGQEKALDIATA
FT                   VKARLCEIADVADMCLFLACGKGSKLINGALIPADNGWTGVLG"
FT   CDS_pept        join(complement(336618..336759),complement(336339..336532))
FT                   /codon_start=1
FT                   /gene_family="HOG000185320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266183"
FT                   /orf_name="AFUA_2G01405"
FT                   /product="Cyanovirin-N family protein "
FT                   /protein_id="EBA27306.1"
FT                   /db_xref="HOGENOM:HBG323981"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI0000F5182F"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V1"
FT                   /transl_table=1
FT                   /translation="MSLRGFHTTCDTIVLKDKHILSSRCKRPDGTYSFSEIDLNDCLGN
FT                   NNGKFVWGGESFVDSASQVNLALEGGEGRPMLHAQLNDWHGSVQSASVNLGECIQNEAG
FT                   GLEYMHC"
FT   CDS_pept        join(337491..337754,337785..338525)
FT                   /codon_start=1
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266184"
FT                   /orf_name="AFUA_2G01410"
FT                   /product="Aldo-keto reductase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87239.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000051F435"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL6"
FT                   /transl_table=1
FT                   /translation="MKYVQLGSSGLRVSPICVGCMSYGSPEKRFDWALGEEDALPVLDH
FT                   AYRSGLNFFDTANVYSNGDSEVILGKAIKKYNWRRENIVIATKYPLFLSNEERDNAGYV
FT                   NEYGLSRKHIFDSIEASLKRLDLPYVDLLQIHRFDPNTPVKETMEALHDVVKSGKVRYI
FT                   GASSMWAHQLLEYQYTARMNGWTEFISMQNFHNPIYREEEREMFPACAKFGMGAIPWSP
FT                   LAMGFLTRPWKAFEETTRGKSLNGKVMGQPFTETDKKISETIEEIANKRGVSMTIVSLA
FT                   WSLSKPFITAPIVGLSKKERVDEAIQAIDFKLTEEEIKSIDDLYQPKKVIGHH"
FT   mobile_element  339854..341395
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(343487..343658,343975..344969)
FT                   /codon_start=1
FT                   /gene_family="HOG000185309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751524"
FT                   /orf_name="AFUA_2G01430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87241.1"
FT                   /db_xref="HOGENOM:HBG052201"
FT                   /db_xref="UniParc:UPI0000520257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL4"
FT                   /transl_table=1
FT                   /translation="MWAPLSRVQGQNYPRLGRKRIKSMAASPPSSFSASLSSSSSLYPS
FT                   SCSSIHSPPLLSTNLSPSSWSPSHRPSAASARHQLESLIAKHGHPIRVSLSSLRDLTAT
FT                   SSTYSPPSPLSPRSPASEISELSDTVILSRSTSRPIPIPKPPSSPYDSDLPVTPLTGRF
FT                   EKDYFPQSGQSKSWRNRESLSRLDSDRYHRPSYHRPSTRMRSDSSSFYSPVMSPSMSPS
FT                   TRSASPQPTRSRPHNSAKSVPAFHLGSLPRFHPAVYQPSNNSQSLTAQPPSPRHSRQQS
FT                   YWTSSGSRDTLRQYGELVESATLSRAPSRPLSPSPSAPRLDPLRSPGPVTPLALEETGG
FT                   YLTIGATSSDFSSSDSQSSSAAPDLVEKLIAREVERDRQKSRKSSKNW"
FT   CDS_pept        join(345988..346162,346369..346471,346533..346806,
FT                   346866..347285)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266185"
FT                   /orf_name="AFUA_2G01440"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87242.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051ECC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL3"
FT                   /transl_table=1
FT                   /translation="MSSVEALLPPVDAKVPGDMGSRSQSAPGVVPGGTVSTGKRSDYKG
FT                   FVAGVFSGIAKLSGPLDCVLQTVRKEGVSGLYKGATPPLVGWMVMDSVMLGSLTLYRRL
FT                   LLENVFSRPAIRSLTPFASYQPDPKTLPSFGHGIAGILAGTTVSFVAAPVEHIKARLQI
FT                   QYAADKSKRMYSGPIDCLTKLLRAHGIAGVYRGLCATILFRSFFFFWWGSYDVLTRWMK
FT                   NNTAMSAPVINFWAGGISAQIFWLTSYPSDVVKQRLMTDPMGGSLGDGERKFYRWKDAA
FT                   RAVYLERGWRGYWRGFVPCFLRAFPANAMALVAFEGVMRSLP"
FT   CDS_pept        347989..349182
FT                   /codon_start=1
FT                   /gene_family="HOG000167461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751525"
FT                   /orf_name="AFUA_2G01450"
FT                   /product="Alpha-1,6 mannosyltransferase subunit (Mnn9),
FT                   putative"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL87243.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG396793"
FT                   /db_xref="HOGENOM:HBG435756"
FT                   /db_xref="InterPro:IPR005109"
FT                   /db_xref="UniParc:UPI0000520240"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL2"
FT                   /transl_table=1
FT                   /translation="MAVARRMRRTNPITLLLAAILAIGFFIFVLSPSTTSASPVNAGSA
FT                   SSSSTSQQRREDNAAENPLSPPTKPFFKSQPVRHDGQQAPPPVVQYNLNQLSSTSTSAA
FT                   NGERILILTPMARFVPEYWDNVVKLTYPHELISIGFIIPKNKEGNAALAALEAAIAKTQ
FT                   SGPIDKRFASISILRQDFEPPLQSQDEKERHKISNQKARRESMSRARNSLLFTTLGPAT
FT                   AWVLWLDADIVETPPTLIQDLTAHDHPVLVPNCYQRYYNSEKKKMDVRPYDYNSWIDSS
FT                   TAQSMAAEMGPDEILLEGYAEMPTYRTLMAHLADTANPNPKKVIELDGVGGTALMVKAE
FT                   VHRDGAMFPAFPFYHLVETEGFAKMAKRLGYSVYGLPDYFVSRTFFFFFFFFFFFFG"
FT   CDS_pept        complement(349673..350635)
FT                   /codon_start=1
FT                   /gene_family="HOG000185308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266186"
FT                   /orf_name="AFUA_2G01460"
FT                   /product="ZIP Zinc transporter, putaitve "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87244.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG048450"
FT                   /db_xref="HOGENOM:HBG715717"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000051EF33"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL1"
FT                   /transl_table=1
FT                   /translation="MSLPCQDLIGADFLLALCPPNIDPSSLSVMVAFAVGGLLGDTLFH
FT                   LLPEIFLGEDSPEHVRFVMVEPNRNLLLGLGIMVGFFTFVAMDKALRIATGGEGHAHSH
FT                   SHTDTDSSSHGTTTSSTTSTANTELRKRKSTPATKKEPEDEKDINPSVKLGGYLNLIAD
FT                   FTHNITDGLAMSSSFYASPTIGATTTLAVFFHEIPHEVGDFALLIQSGFSKRKAMGAQF
FT                   VTAIGAFLGTFIGIAIQELGGGHSTAAGGVTGSSAGLLGTSLTWGDMLLPFTAGTFLYV
FT                   GTVSVIPELLETGKDKAVEIKKTIVQFLAVAVGAGIMLA"
FT   CDS_pept        join(350671..350751,350974..351138)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266187"
FT                   /orf_name="AFUA_2G01470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87245.1"
FT                   /db_xref="HOGENOM:HBG052232"
FT                   /db_xref="UniParc:UPI000051ECCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIL0"
FT                   /transl_table=1
FT                   /translation="MYTVARIALTAGLPGKRIANSLAIILAKTGDKREAGPARRRDEIE
FT                   YHRCREILTAAMSNWARTNDELEDNLTIDNYRTDCL"
FT   CDS_pept        join(351296..351426,351493..352087)
FT                   /codon_start=1
FT                   /gene_family="HOG000048344" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903588"
FT                   /gene_name="nop16"
FT                   /orf_name="AFUA_2G01480"
FT                   /product="Nucleolar protein 16 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL87246.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG175985"
FT                   /db_xref="HOGENOM:HBG396451"
FT                   /db_xref="InterPro:IPR019002"
FT                   /db_xref="UniParc:UPI000051F8EE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIK9"
FT                   /transl_table=1
FT                   /translation="MGRVLQKKKNRSSTPKQRPKRTGQLKSGKKKINVLGNAIIAQNWD
FT                   RKLTLTQNYRRLGLVHKLNAPTGGSEKKPTKDGRIEELPEDPLHIRSSAKASAKQAAMG
FT                   ETRVERDPETGKIIRVIRDEEEIEIAGRKVKPSNPLNDPLNELSEDEAARQPASQRTNA
FT                   KSAVVQQLERQADQEGKAVKAKKPRHQSKREEEWIMRLIERHGENYSAMARDRKLNPMQ
FT                   QSEGDLKRRIRKWKANHSS"
FT   CDS_pept        join(352466..352595,353559..354208)
FT                   /codon_start=1
FT                   /gene_family="HOG000216912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056875"
FT                   /orf_name="AFUA_2G01490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87247.1"
FT                   /db_xref="HOGENOM:HBG052247"
FT                   /db_xref="UniParc:UPI000051EAA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK8"
FT                   /transl_table=1
FT                   /translation="MARSRMLSILGQHLNTLFSSNITIQGTGVGGAGVNASQSSTDSCH
FT                   ESSKHAGDAVCAFNGTGYSIDGKISHIPDTTLCGSWELPLFVFGRNCDEGDTPFQTRAG
FT                   IDRVHVSEPPRVREGANALLPSPASFNGRVCSLPYNPWKLGECVDGTAMTAVPVLQVII
FT                   SDGAWRQGLSASASASARSGYGPSPSRTSSITPVSSAVSGVSPASGWPVSSSGATATGA
FT                   ANVGYGRGLLRDGAWWSMLLLISLQVVAHVLLVLGWA"
FT   CDS_pept        join(complement(358707..358995),complement(358067..358552),
FT                   complement(354415..358016))
FT                   /codon_start=1
FT                   /gene_family="HOG000185287" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266188"
FT                   /orf_name="AFUA_2G01500"
FT                   /product="ABC bile acid transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87248.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000052049B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK7"
FT                   /transl_table=1
FT                   /translation="MGIAHRNSFYILSPRSDIMMLGLGQCSTVEMCHALFLHDTDHHNH
FT                   RGCCVLLAQPVSAPLASGMDETLHLRTLPGMARLTSGAKGGMGYQPFPPRTPRPRTCPA
FT                   WMLVFFITELAVELSFILDHDAYTVTRLPAYYVAAGAAMAGCVTILLMPLREPSVPIYD
FT                   IAAVGQPSSSDFRSPEDNLRLWQFLSVSWMAPLISIGKNKRLDEDDVWFLGFEFQHRRL
FT                   HENFRRLKGSVVGRLLRANGIDLVIVSTIALVMMICDFATPILLQQLLQAMQDMSSGKR
FT                   PAMTYALATLVVRVVAAQSQVLNLWFGRRCYERSRGEMIMMVYEKALSRKNVFDTQSEQ
FT                   KDEGPANRELAEEDADEEAEIPTRRKFCGIFSGSRQTTKKPAKTAASMGKIFNLLRGDV
FT                   YEVAQRFWEVDSLIDKPLGLIIAIVLVWKLFGPSCFLGILAIIVAQALNAVITRTLLRW
FT                   ERVRRLATDARLQITSQFVEALRHLRWYGWQDHWYRQVMDARQSELNLRIITNLWSILI
FT                   RFVNTFASGVFPVVALYAYTLLAGHPLRIDIIFPALQLFTMLETRLRDIPGLITVLINA
FT                   SIAVERIEDFMAEPNKETPATKPADSASIQLQHCSYAWPGQVVPVLSDINLTISKGLTV
FT                   VSGKVGAGKTALLQALLGELDRIGGSAEIPNEMVGYCAQTPWLQSMSIRDNILFSSPYD
FT                   EQRYQRVLDACALLPDLKNFEHGDLSFVGENGIGLSGGQKARVALARALYSTARVLFLD
FT                   DPISALDHNTAEAVVEKCFTGPLMQDRLVVLVTHRTALVNHLADQKVLIEDGRATIHSK
FT                   QAVSITSAADKDIQSLGKTAEAQSEIQGALREAAASVPTKFMEEEHRAEWGVKARVYWN
FT                   YIRAGRYRWWISLVLVLAVYRLTSVGQSWFLKEWGEAYNQILLAFSNSTPDGRYSARQL
FT                   VIPYGWSQVSRWKPTDPLEKLPAPFDDVRPWLLAFFVITAFQSVMLLFAQLLMLVIVYC
FT                   AGKKLFHQVMVRVSHATFRFFDVTPVGRLMNRLTSDIGVVDGNISEQFQAIAFQAITWV
FT                   SSIVVIASVTPAFLGFSFALTAAFIFIFLQFLPTSQSLRRLEMVSLSPLISNFGELLHG
FT                   LTTVRAFHAEERFQNRVIAVVDKFQGMDHFYWSLQSWLMYRFETLSAASTLCLTVLALY
FT                   TNVTPGLAAFVLIAANNFVTSTHALCKQYGQLQMDFVSVERIDELLRIEQENPGTIEPP
FT                   ACWPRFGQDITFDDVTIRYAPHLEPSLRSISLTIPGGSTTAVIGRTGSGKSTLAVSLLS
FT                   VIRPESGRIIVDGIDIAQVDTQALRTRVTFVAQDPVLFPGSIRLNLDPTGEYSDEECAD
FT                   VLKRVCSRHGWNLQTHVEAGGRNLSQGERQLIGLTRAVLRHSPIVILDEATASIDHESS
FT                   LEIQQVIREELRESTVITIAHRLEAIKDADYYVVLDKGRVSKHGYVNDKGTSQIQT"
FT   CDS_pept        complement(359626..360984)
FT                   /codon_start=1
FT                   /gene_family="HOG000185276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903589"
FT                   /orf_name="AFUA_2G01510"
FT                   /product="Integral peroxisomal membrane peroxin, putative "
FT                   /protein_id="EAL87249.1"
FT                   /db_xref="HOGENOM:HBG052264"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI000051F8F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK6"
FT                   /transl_table=1
FT                   /translation="MLKLHVANSLDRIGIVFHFQNQVERLLSWRKSSHTFSFLFIYSFI
FT                   CLDPNLLVALPITVILLFIMVPAFAARHPPPPSMSTSSTTPYYSYQGPALAPAKTIKPA
FT                   SETSKDFFRNMRDLQNVMADFSDVHDATVSLFAPITNFSNEKLSSIVFLVLTITAALLF
FT                   LTAHLLPWRFILLLGGNAAVLSNHPGLQEFLQNLLGDSSGAVKADLQAERAEKKKTLDM
FT                   YGLSMQSNPSAAVSLLDSLADISLDSYPEEREVEIFEIQNRSLAPYSESEWDHFIFSPV
FT                   PYDPLSPSRIAGDRPRGCRFFEDVQPPPGWAWKTKKWKLDLDCREWVVERMITGVGFEI
FT                   PGAGPEGSMANEEIGGWVWDLPSQSASRDEDAVATALGYQDYGSSSKPASIQEKKKTQK
FT                   GKQKSSSRDWEEQGHSGFNGMGEWRRRRWVRVVQRASVSSETDKEKPSNQGKT"
FT   CDS_pept        363044..366988
FT                   /codon_start=1
FT                   /gene_family="HOG000185265" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266189"
FT                   /orf_name="AFUA_2G01520"
FT                   /product="Protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87250.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG052270"
FT                   /db_xref="HOGENOM:HBG331481"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051FDDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK5"
FT                   /transl_table=1
FT                   /translation="MGNLAKSDYNHTPPDQTDFLAPVSFDDFHNSIMAEPSLNHFPMPG
FT                   TAVSNHTGSPLSGPFTRNPWADNDEPSFASRSRSNSVRKSEVSHLSSQNSSAESVASRL
FT                   PASNTAARSRRQSLVQNSAAKAPAPRAPRKSIGPGSIAAATSARRQSVSARKASVDTSP
FT                   ADHASLRPHAQNPDSSGLDKTRLPSNVRNMKAKSLQPPSREPGDHLLTASGLTDHSRSC
FT                   STNAVRTPIKNPAGSATTPASSAKRVSVMAPHATGLGARTISPTDARRMKRISTAPQAP
FT                   PLPYTPPTKQDTLPVRPRSCAQSPSSLPRKSVTPSSTRTTPDPSRKSYSSGLSLSSNTS
FT                   YSSTRNSGSSLQTRFAQNQSSSRLPTPKPRAEHMGGNNEEVPPVPAIPKAYESPKGDGD
FT                   FHTYFASRKSSLPLDIGLPKPKADHDAEPKQAIRGNDKKTTDHPAERAMKTPDAKTPAS
FT                   NFGKKNLQPLKLPPLNLLPLSTPVASKIEALKDREDDGQSYTPSGQAVTKTPSTPMTAS
FT                   KANFSFRDEDDTMGFTHARSSTSHFVLSTSTVAPLRTASSSSALASFDNNTTGGARTIS
FT                   PYVSYTLPKSSSDFSNLQQKANTSGDYSPRISQAYKLTGPRPQTQSSAFSSNAETISQL
FT                   STPSDPDNNSVPGSSIFNKVTLTGKRSDSKSQRSTGADLDPAKQMPPPRLPASATWNNL
FT                   STVKGSSPTLKPAYVQARRQSSISGTSVSTMRNQSVSSEQSLALEPSVSNESGESNTAS
FT                   LRPGSSVFSPMHKMINSAKSSTAATPRQQHESNPDSDILAADEEMRRLASKRKDFETAA
FT                   RNLDELRRKAGPKERVSPAQALKMANLNIFERGEIIDFKDIYFCGTQNAKKHVGDLNAQ
FT                   AANFGYDDDRGDYNIVIGDHLAYRYEVLDVLGKGSFGQVVRCIDHKTGALVAVKIIRNK
FT                   KRFHQQALIEVNLLQKLKEWDPHRRHSVVNFTQSFYFRGHLCISTELLGMNLYEFIKAH
FT                   DFKGFSLKLIRRFTKQILGTLTLLHTKKVIHCDLKPENILLVHPMSSEIRVIDFGSSCF
FT                   ENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYSGYPIFPGENEQEQLAC
FT                   IMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTVSSKGRRRRPSSKDLKQVLKCDDDAFL
FT                   DFISRCLRWDPARRLTPHDALRHEFITGIKPASRSRSYGMASLSNKRATTLSNPTARPL
FT                   PEPPGTSLKNGTFIRSRDISGSSPVKATTVGKRHSTVSGLQPSTPAKRGTTVPSMPGSA
FT                   LPRVAARSISGKPDLATAAAATSLVSNLAE"
FT   CDS_pept        join(368231..368858,368911..369422)
FT                   /codon_start=1
FT                   /gene_family="HOG000185254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266190"
FT                   /orf_name="AFUA_2G01530"
FT                   /product="COPII-coated vesicle protein (Erv41), putative "
FT                   /protein_id="EAL87251.1"
FT                   /db_xref="HOGENOM:HBG059099"
FT                   /db_xref="HOGENOM:HBG331480"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniParc:UPI000052000F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK4"
FT                   /transl_table=1
FT                   /translation="MVQMLTIVVVILAKTKPSYTAPSPRGGQWTVLVLLVCTFLSISEF
FT                   RTWLKGTEKQHFSVEKGISHDLQLNLDIVVHMSCDMLDVNIQDASGDRILAGQLLKREP
FT                   TSWQLWMDKRNYETYGGAHEYQTLSQEHADRLSEQEADAHVHHVLGEVRRNPRKKFAKG
FT                   PKLRRGDAVDSCRIYGSLEGNKVQGDFHITARGHGYHNNAPHLEHKTFNFSHMITELSF
FT                   GPHYPTLLNPLDKTIATTEDHYYKYQYFLSIVPTIYSKGNLALDTYANAPPSNRRGKNL
FT                   VFTNQYAVTSQSSVIPESPYFIPGLFFKYNIEPILLLISEERTSFLSLLVRLVNTVSGV
FT                   MVTGGWLYQMSGWLGELLGRRRRRGKSEGVLTGRHEADD"
FT   CDS_pept        join(complement(371830..371886),complement(371032..371757),
FT                   complement(369745..370971))
FT                   /codon_start=1
FT                   /gene_family="HOG000185243" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208180"
FT                   /orf_name="AFUA_2G01540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87252.1"
FT                   /db_xref="HOGENOM:HBG052284"
FT                   /db_xref="HOGENOM:HBG331479"
FT                   /db_xref="UniParc:UPI000051E84E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK3"
FT                   /transl_table=1
FT                   /translation="MADEEERIKAEKLAAAKKRVAQLQKQKKKASKKAASTEAPKEADT
FT                   PKETAAPTEGAPAEVPAEVKQDETESIEKEAQKEEEQQAELETESKPEPGVETAAEPEK
FT                   RPESPVEPMPEAPTSPSPAPDAEPQTLDVKLDTPRAGHTRQPSLSIQSKMRSSSFRKGS
FT                   VSQGSASTSPSNALKSPSLPPLTGNGDSVHEVYRKQSMRIEELEKENKRLEKQLEESTS
FT                   RWRKTEEQLEDLREASVDAAELRDKLEKSEQKAAEIDELKAEIAALQRQNSHLQNRSHR
FT                   NNASISVPVPSESPPADLVQQLESKSATIEAMELEISNLRAQLSEQSSSSSAHEAQIAA
FT                   LEERLSHSESALEKSQRELTDTKIALTRASEKAVKEGVDKTSTETLIKNLRREIEELKQ
FT                   EKSEAEKKIDTLDKKLQAMGNLHKESETRHQARLRESEKTEREAAVLRKRLASVENENI
FT                   RLKEDLERLRKRESGGTDDDALDELEDEERSRLERRIRDLEGEVFDLRRGIWKERRDEL
FT                   STADQGGYTAPDTSNPAANAFDDVDLVGGSFADHARRRSIAQQHSSFSTVLSSGLAAFT
FT                   GSYGNRSRESSTQQHPPAARGSLELLSEENFDDEFDEAEFARAQAEEEARKRVEWVREI
FT                   KGKLKDWKGWRLDLVDSRAGAEGAGVGMGEIFEI"
FT   CDS_pept        join(complement(374645..374650),complement(373565..374566))
FT                   /codon_start=1
FT                   /gene_family="HOG000185242" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266191"
FT                   /orf_name="AFUA_2G01550"
FT                   /product="Mitogen-activated protein kinase MAF1 "
FT                   /function="kinase activity"
FT                   /function="transcription regulator activity"
FT                   /biological_process="negative regulation of transcription
FT                   from RNA polymerase III promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87253.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016480"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG052290"
FT                   /db_xref="HOGENOM:HBG331478"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR017152"
FT                   /db_xref="UniParc:UPI000051F900"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK2"
FT                   /transl_table=1
FT                   /translation="MKYLPIPDLEDVANSLNFDTDDCHIVGGCDLYTTKAARADRKLYK
FT                   NIEQSLEAQYESVLRLSASLSPPNASDAAASLNLSRSSPFGPLSDHSSRRTFAYLIATL
FT                   NASHPDYDFSHVLRPSDFRRERSLKKVMNTVDSTLFNLRPRESIDMSPPSPATISGSYN
FT                   SAASHIWGPRMWRTIDEHMSLKECSYYSYSPDEDPSDADDGAIWSLHYFFFNRLRKRVC
FT                   YLYIRAIPILSHTPEEGDGLPTTPTGKRTFEDVDVSRYMTPDLVGSSKRARYWLGNRAK
FT                   LEIESEEEGSSPPTRPVVDEYDNYVLSDEEFRSRSGSKGTVRAMSEEIADQMEV"
FT   CDS_pept        join(complement(376334..376344),complement(376237..376270),
FT                   complement(376043..376160),complement(375681..375964))
FT                   /codon_start=1
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903590"
FT                   /orf_name="AFUA_2G01570"
FT                   /product="AP-1 adaptor complex subunit sigma, putative "
FT                   /function="protein transporter activity"
FT                   /protein_id="EAL87254.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR015604"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000051FB73"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK1"
FT                   /transl_table=1
FT                   /translation="MAIHYLILLSRQGKVRLAKWFTTLSPKEKAKIIKDVTQLVLSRRT
FT                   RMCNFLEYKDTKVVYRRYASLFFIAGCASTDNELITLEIVHRYVEQMDKYYGNVCELDI
FT                   IFNFQKAYFILDELLLAGEMQESSKKNVLRCISQQDSLEDIEVS"
FT   CDS_pept        join(377852..377986,378035..379028,379087..379323,
FT                   379385..380088)
FT                   /codon_start=1
FT                   /gene_family="HOG000251017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751526"
FT                   /orf_name="AFUA_2G01580"
FT                   /product="FAD monooxygenase, putative "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87255.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051032"
FT                   /db_xref="HOGENOM:HBG327146"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI000051F68A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIK0"
FT                   /transl_table=1
FT                   /translation="MTNLNQPEDHVDVLIVGAGPAGLMLANWMSRLGIKTRIVDKRSTK
FT                   VFSGQADGLQCRTLEIFDSFDFADRAWRESNHMLEICLWNPDKDGVIRRSDRIPDTIPG
FT                   ISRFQQVVLHQGRIERFFLDSIKEHSNITVERGVMPTSFEFDASKAADVDDYPITVTLR
FT                   TLTEEEATPKQQQATNGAAVSDGLFRSNLSPDDTDDLLRAAELNSRANQTQVVKAKFMV
FT                   GCDGAHSWVRRQLGFKLEGDSTDYIWGVLDIIPITDFPDIRMRCAIHSASAGSVMVIPR
FT                   ENKLVRLYIQLQSIVTGGGKADRSKITPDMILKSAQRILHPYKLDYSYCDWWTAYQIGQ
FT                   RVGDKFSLEERVFLAGDAVHTHSPKAGQGMNVSMQDTYNLGWKLAHVIKGYSDRAILKT
FT                   YQSERRRIAQDLINFDYRFSRLFSGRPAKDVMDEEGISMEEFKMAFQKGNMFASGIAVD
FT                   YGSSLLVAKAGDSGEQGDGTDVASKDKSLRVVSKQHLSTGISVGMRMPSFKVLNQSDAR
FT                   PWHLQELLKSNGRWRVIVFAGDLTNPENFDRYSQLGEKLSSPTSFLRRYTPPGQPIDSV
FT                   IEVLTVHAGPRTSIELLDLPEIFHPYREKQGWDYWKVFVDDQSYHEGHGKAYENYGIDP
FT                   RRGASVIVRPDQYVSWLGEVDDYEDMERFFSAFMKPQSQLVQKENPVAAVASTL"
FT   CDS_pept        join(381164..381205,381284..381550,381601..381819)
FT                   /codon_start=1
FT                   /gene_family="HOG000185206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903591"
FT                   /orf_name="AFUA_2G01590"
FT                   /product="Non-classical export protein Nce102, putative "
FT                   /protein_id="EAL87256.1"
FT                   /db_xref="HOGENOM:HBG059508"
FT                   /db_xref="HOGENOM:HBG331474"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000051F8F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ9"
FT                   /transl_table=1
FT                   /translation="MALKGIQLGLRAWEFVFSLLVMALIGNIIAMAFAGNPATINYSMF
FT                   TATFSIISLFYLVPASINLNWAIHPIIMIVLDVLNNIFFLTCAIALAARLECHSCSNDE
FT                   YTLHNEITNGAHNRQKRCREAQASVAFLWFAWAGYMASTIISILMARSATVDLRSRTGR
FT                   APRVARPSMAQV"
FT   CDS_pept        join(complement(388873..389252),complement(387000..388177),
FT                   complement(386224..386953),complement(386147..386177))
FT                   /codon_start=1
FT                   /gene_family="HOG000185184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903592"
FT                   /orf_name="AFUA_2G01600"
FT                   /product="Sphingomyelin phosphodiesterase, putative "
FT                   /EC_number="3.1.4.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87257.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052322"
FT                   /db_xref="HOGENOM:HBG737882"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000051EA98"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ8"
FT                   /transl_table=1
FT                   /translation="MLRHLSAAAYSVGHSVSIGSKFPGPRTSSTISRLLTYELPIRLKP
FT                   NLRQTPPPCQVLRIPCVAMRSLGILPVSFGESHHPVMRFLGIAYASERMIPVSSAQLHR
FT                   QSSPGRMHWHVAVWKLLRPAMGGSYYYLPAEPTQQPQPVIQDPVLHTTFPYNLTNPNTI
FT                   PTENNDPVVFQTPSKKLSDSQQHELIQAVVANVTSIVNGNATHGSCNKCKAALAATKPA
FT                   ALYAPTLVPDTIISLCKEFNFRSNATCEEDYAASVFGAVWTQVLAYADVEGLDGDYICH
FT                   ALNKSFCGPPATSPLDTAGLFPKPKPANPRVPKASGKRVKVLHLSDFHLDPRYSVSSEG
FT                   NCSSGLCCRNNNFNSAAKDQVLISAPAYGTFKCDTPYDLGLAALQAIGPLTGTGKGKDQ
FT                   DSLAWSLYTGDLVSHDPVQAMSREYVEYTETSIYGMFKEYLTGPVFAALGNHDTSPENI
FT                   NAPHNLPGPLGEQQSWNYEHVAGLWKHEGWIDEKAAQEARTHYGGYSVKTHYGLRIIAF
FT                   NTDFWYAKNYFNNINSTNPDNSGVFSWIIDELQKAEDAGERVWIIGHVLSGWYGSNSLP
FT                   DPTNLFYQIVDRYSPHVIANIFFGHTHEDQFMIYYANNGTLQRADTALTTGWIMPSITP
FT                   LTNLNSGFRMYEVDTGDFNIYEAYTFFSNVSDYPSLKGVGPTFQFEYSTRDTYSPAAGW
FT                   EKDDPLNATFWHRVTEAMEKDIDLVSLHNTYQGKMSVKSPNCTNVDCQEAKICYMRSGS
FT                   VALGSQCPQGYGSVQSSFA"
FT   CDS_pept        join(complement(390259..390745),complement(389864..390117))
FT                   /codon_start=1
FT                   /gene_family="HOG000185162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266192"
FT                   /orf_name="AFUA_2G01610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87258.1"
FT                   /db_xref="HOGENOM:HBG052328"
FT                   /db_xref="HOGENOM:HBG331472"
FT                   /db_xref="UniParc:UPI000051E84F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ7"
FT                   /transl_table=1
FT                   /translation="MSLQLGSASVFRPGWALSILVVLAALPSAIAQFCTFWDGGCVDPL
FT                   AQTAINFDFPPLFLDDLTLYYGFDANPSGKGQEPMVKASFWLAYDPHRIDSTVITANRT
FT                   SEIAFRVGNLTGTPSGPSNGCDGVWGPQCTHDLKELLKGAMYELTIKGDYTYPLQTVIT
FT                   FAQESEPDKTAMIQTPGFGGSPWKTWFIDNMTSSQQAEQVAVAILSRAPSSNTYSMHGK
FT                   DDIMVELVCIQAPSSGGASSSQDG"
FT   CDS_pept        complement(393566..394447)
FT                   /codon_start=1
FT                   /gene_family="HOG000185151" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266193"
FT                   /orf_name="AFUA_2G01620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87259.1"
FT                   /db_xref="HOGENOM:HBG052336"
FT                   /db_xref="HOGENOM:HBG331470"
FT                   /db_xref="UniParc:UPI000051EA8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ6"
FT                   /transl_table=1
FT                   /translation="MSHSPPEPSASSLPTMSTQSLPLRNQATGSCSDEQSNNDATQNTE
FT                   AAIDPTNLQHLGEKLKILPVPSVNDDLETTAKKMKALARVVSDGNSLALFTGLQVASQH
FT                   LSDPESIAVSQMTPDERVQYEAWQRSRKNGPMKNPGDQDSEETSSRGEKVPGVGFDWVK
FT                   NVAPVPNGAQSLKKFTERAAAMDIIWNHQGATPENAAWLTFNQPAILPLIKAVCRVRTA
FT                   ERHRKNNREPSLRGLTDMEAAEVETVRKIVSLAERNRTRELEKIRKLTRSITESVAVIK
FT                   ARVKALEDKRNS"
FT   CDS_pept        complement(395231..396049)
FT                   /codon_start=1
FT                   /gene_family="HOG000185150" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903593"
FT                   /orf_name="AFUA_2G01630"
FT                   /product="MSF1 domain protein"
FT                   /protein_id="EAL87260.1"
FT                   /db_xref="HOGENOM:HBG052345"
FT                   /db_xref="HOGENOM:HBG331469"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI000051E85F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ5"
FT                   /transl_table=1
FT                   /translation="MKFFENVFTYDYSFPAVSLAYFLRYPNPYSRHVLTTDVIDRYVDP
FT                   KTERLHTVRLHLKKSKVPSGILKLLPKGIGGSDNSGQSYILETTVVDIKEGWMETESRN
FT                   MEWTGILSVVEKQLYTRQPIEGSLESLQGLSLDAQRNEQTQVKTTVTFRSRLGQGKFLG
FT                   KKKTIPTADQTIEFDEETPKKGFFSSLSTAGIQRTIELIGVSRTRDAVLKSKEGMNVVL
FT                   ERLRNGGIVGVLEGMRQDREAAFGPDGPWKRVWLRGNGLKDRAFTDDDDN"
FT   CDS_pept        join(396481..396876,397042..397896)
FT                   /codon_start=1
FT                   /gene_family="HOG000224742" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056876"
FT                   /orf_name="AFUA_2G01640"
FT                   /product="Tryptophanyl-tRNA synthetase "
FT                   /EC_number="6.1.1.2"
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87261.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG020889"
FT                   /db_xref="HOGENOM:HBG435805"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000520017"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ4"
FT                   /transl_table=1
FT                   /translation="MADEPGQPPALTTLSLAEKAPASKAVAQVVTPFDVSGGVDESGKL
FT                   LPVDYDKLVREFGATRISKELLERFERVTGRRPHRFMRRGIVFSHRDLNLILDRYEKGQ
FT                   PFYLYTGRGPSSDSMHVGHTIPFEFTKCKYMHSQKIEVDDAKKYAKANAKDIIAVGFDM
FT                   KKTFIFSDFDFVGGAFYENICRMAKRITINSVRGTFGFNDSNNVGEFHFCATQSATAFA
FT                   TSFPHIFGTDRKKVSSIPCLIPCAIDQDPYFRQCREHAEKMKYKKPSLIHAIFLPALQG
FT                   PGSKMSASVETSAIFMNDAPNRIKNKINKYAFSGGQDTAELQRQLGANTKDDVPFQYLT
FT                   FFMEDDEELERIRVAYEKGEMLTGEVKQKCIAELQAYVQAFQERRAQVTDEIVAEFMRP
FT                   RSLEWKGNPNPIVVEKK"
FT   CDS_pept        complement(398187..399032)
FT                   /codon_start=1
FT                   /gene_family="HOG000185129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903594"
FT                   /orf_name="AFUA_2G01650"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL87262.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG052361"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniParc:UPI000051ECC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ3"
FT                   /transl_table=1
FT                   /translation="MTDAMATITQSQASESFQIISSLRYEPALPELLKAQCTDAYPDPL
FT                   RSPYYLLPYHQERLRKAADCFGWRKAATFLQQDVESFVEHLNSFIPDRTKPWRLRIVID
FT                   RDGTCTVEVNAALQMDALNLLLPSKMNQTDTPWRVTVDSQRTVPSPFTTHKTTSRDVYT
FT                   AARLRAKITSPQDPAEVLIVNPQGEIMEGSITTPYFRRRTSASTQAKIDQEDSGPAWIT
FT                   PPLSSGGNAGTTRRYALSQGFCSEQAITIAELIDGEECWLSNGVRGFFRGRILLNESKP
FT                   "
FT   CDS_pept        join(399595..399910,399976..400058,400131..400902,
FT                   400961..401434,401492..401739)
FT                   /codon_start=1
FT                   /gene_family="HOG000185118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266194"
FT                   /orf_name="AFUA_2G01660"
FT                   /product="Mitochondrial outer membrane translocase receptor
FT                   (TOM70), putative"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /function="binding"
FT                   /function="receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EAL87263.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG058232"
FT                   /db_xref="HOGENOM:HBG331467"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR005687"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000052023C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ2"
FT                   /transl_table=1
FT                   /translation="MSSELPLSQPVKNVVVDTASLPASSSASVWDRISKWVSENKALVY
FT                   TIAGVAVVVTSAGVVYYLSDSGRTPPAPAPTEKKKSKNQRRKEKKKAEEEKKAKNATVQ
FT                   EEQVPKKAEEVSEELPEVDEATVDQLSDETRKAYAAKLKAAGNKAYGSKDYNRAIDLYG
FT                   KAIICKPDPVFYSNRAACYNVLSEWEKVVEDTTAALAMDSEYVKALNRRAIAYEHLEKY
FT                   SEALLDFTASCIIDGFSNDVSRNALERLLKKVAERKAKAILEAKGRKLPSPTFVSNYLQ
FT                   SFRPQSLPEGLEESADLSEESGKGQLRKGLVAMSKKTGDGYEEAAAAFEKALELGDLGE
FT                   YEALALNMRATFTYLEGNAQSALADLNKSIELQPSLVQSYIKRASLHLELGNKDAAADD
FT                   FELAITHNKDDPDIYYHRAQLHFILGEFAEAAKDYQKSIDLDRTFIFSHIQLGVTQYKM
FT                   GSVASAMATFRRSVKNFEDVPDVYNYYGELLLDQQNFSEAIEKFDKAVEMEKQSKPMGI
FT                   NVLPLINKALALFQWKHDFQEAENLCQKALIIDPECDIAVGTMAQLLLQQGKVSQALKY
FT                   FERAAELARTEAEIVNAISYAEATRTQLEVQERYPQLAARLQSMGAGLGGPPGL"
FT   CDS_pept        join(403199..403214,403281..403486,403571..403703,
FT                   403768..403819,403882..405649)
FT                   /codon_start=1
FT                   /gene_family="HOG000185106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266195"
FT                   /orf_name="AFUA_2G01670"
FT                   /product="FHA domain protein"
FT                   /protein_id="EAL87264.2"
FT                   /db_xref="HOGENOM:HBG052374"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI0000F51849"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ1"
FT                   /transl_table=1
FT                   /translation="MPDKQAVVTLYPLFQPDVLPFRSLTFAPDTESVKIGRASKREAKG
FT                   LVPAHHNALFESRVMSRDHAQLRVSFEKKEVYIRDNGSMHGTWVNCKKISADKDVPIHS
FT                   GDVVIFGTEVIRGEDTYPPMRVRCECQWFDLDEGAAKPKKAQDNLKTNTFCVPDDDDEV
FT                   IEIVDEAPINPESTGSYVPEDPDTSSDSEHHQSAGNSTPVTSPLNKDVSVESVENKSSA
FT                   PFSELQSHVARSQQSPVDLEEENNEHRLVTPRMTPPSVEDTYEGSYTGIADDMGDIDYA
FT                   PDHEPAPTGYSRGDSTTGSDGWEESEEQDESDDDLMPHSSLSVDTDEFGREADAMASNN
FT                   PSTSVIYESLVAVDNGARSEEEERSQPTQNDAPCSKAVTSGERVCLQTAAPNLNNWKST
FT                   ARENSTESSPLKFGWSSIPRPVRVSNLVSRSSGRSLDHSLACFHNTTSSTSGDKCWPNF
FT                   GHHRINPLPQRESNGNAISQNHRTPDAPYSDGPFVNSHTHTAFDESDKGNTVHSAASTN
FT                   ISQSSREQHPNEESVETWDDSSRVELLSKNHSVSSMAGSGVTRDSNTRHSMADIGDTSE
FT                   WTATSGIKLSRKRKAPEMELDAEELDQGLTGHFPDVTSDDICDLLDNQFVSGSADSFSQ
FT                   DAQPQVAPVDLDASLSHLTRIHAVSKTQNPADVPKATKSAAKDERPSKRQRVSGSGSLG
FT                   SYVATALLGAMAGGLGTVALLASLPTDYFA"
FT   CDS_pept        join(complement(412750..412848),complement(412360..412488),
FT                   complement(411643..412304),complement(410857..411361))
FT                   /codon_start=1
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751527"
FT                   /orf_name="AFUA_2G01680"
FT                   /product="Monooxygenase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87265.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052382"
FT                   /db_xref="HOGENOM:HBG321923"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000051EF41"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIJ0"
FT                   /transl_table=1
FT                   /translation="MFAKVIAQILRSGRVQGDKHREIRLSLGISELFVSEQAHLHIIIA
FT                   GAGLGGLAAAVSCALAGHTVEVVEQAKELVEVGAGLQITPNASRLFEYWQLPNSIWQAA
FT                   AEPTALTVHRYTGPILANEPVFHKNIRAKYGAPFIDLHRVDLQQALFTRAKELGVTFHL
FT                   NERVDSIDFATTTVQTLAGNRYTGDLIIAADGLWSRCRECFLGKKDAPLPTGDLAYRIV
FT                   LTADQISDPELRAWVENPECHFWIGPGAHAVAYSLRNGRMFNIVLLVPDNLPPRVSRQS
FT                   GSVEEMRKLFEGWDPVGDACHPMLPYLAQGANSSLEDGAVLGQLLGHMKNKSHLPQILR
FT                   LYESLRKSRGEAIVKETFKQVSLPSHSVHCRALTFFSDMISTCQMARNRKREMRSSCLN
FT                   SERRLRARFPVDGECSTLCGTVSRSHDTRTCPEVQPWLYGYDAIKEVEKAVMQHPELFA
FT                   RTAASL"
FT   CDS_pept        join(complement(414598..414817),complement(413451..414541))
FT                   /codon_start=1
FT                   /gene_family="HOG000076750" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266196"
FT                   /orf_name="AFUA_2G01690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87266.1"
FT                   /db_xref="HOGENOM:HBG052392"
FT                   /db_xref="HOGENOM:HBG322899"
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniParc:UPI000052049C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII9"
FT                   /transl_table=1
FT                   /translation="MSSERLAQSQKPTGEYRQYLPDLSLKRFQVMRGQDAHEYAHDFKT
FT                   LRQPPWLHALYMHWLDLLQEPFKGVTTDGNVRPGLFTLQDEGVPIDKIVAATQSLLSIL
FT                   DDKQRQSLSYHIDSPEWRTWSNPEFLLSHKGLRLDEVTPPIRDAIMHILETTLSPEGYD
FT                   KAVKAMRINHFLGELVDSPRVMNEFSYNFVLFGRPSPDRPWGWSFYGHHLCLNIFLYKS
FT                   QIVASPWFTGAEPNEIDSGPYAGTRIMQVEERLGLQLMQSLAPELQAQARIFAQMHDPA
FT                   MPPGRWNKDDQRHLCGAYRDNRVVPYEGIPAISLTEPQKQLLYGILEQYLLYLPARARQ
FT                   LKLAQVRQYEPETYFCWIGGFGDQDPFYYRIQSPVILVEFDHHSGVFLNNEEPKKFHIH
FT                   TLLRTPNGGDYGMALRPLIPAVEGLNGKEITWEKSAL"
FT   CDS_pept        join(complement(417848..418254),complement(416943..417778),
FT                   complement(416293..416883),complement(415686..416233))
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266197"
FT                   /orf_name="AFUA_2G01700"
FT                   /product="Carbon catabolite derepressing protein kinase
FT                   Snf1, putative"
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87267.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG052403"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00005206F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII8"
FT                   /transl_table=1
FT                   /translation="MAAAFDDEDLSVSLPSYNSDRHRECPIGAGPPPNASNYPARPMPP
FT                   PTRPTGMAADPSKQSPATMRDMQRLDQYQTVKILGEGSFGKVKLAIHQPSGRQVALKII
FT                   SRRKLLSRDMVGRVEREIQYLQLLRHPHIIKLYTVIATKTDIIMVLEYAERELFDYLVK
FT                   RGRCNDAEARKFFQQIICAVEYCHRHKIVHRDLKPENLLIDKDKNVKIADFGLSNIMTD
FT                   GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVLLVGRLPFDDDYIPALFKK
FT                   IAAGNFHMPPYISSGAARLIRSMLQVHPVHRITIPEIRQDPWFLQDLPKYLQPPPEEFI
FT                   ATGVDPNKAIDLKKIAPGKPLSVQHKIHQIAISKLERSMGYAREDIEDALKSPEPSAIK
FT                   DAFFIIVENEMMQTNSPTEDNLMGGPVAPSPPPNRTPLTTPAVGRPAAPRPQGSPHYDS
FT                   HRAPSQAPQQADSDDFESSRISHVRILPTSLPYVHDQLMEQREREREQRARDADRLREE
FT                   RAQASLDDDLSGARSPEEQEATARALKPHSRSIIDLNKLRLEPPEGRSAPQQPKRTRKW
FT                   QFGIRSRNQPYEAMLYLYKAIASQGGVWEIQPSEAEGTTPIGVERRPGERPLQAKYPDL
FT                   PVDYYIPKDSWFIRARLLKQGVTAPGRSASVQSSKSDLDELRRRFNVSSLSQSAEEKNP
FT                   LTMENVTGSGPSSATPSHVPGRIFHGVWVFVDIQLYQLEENNYMVDFKCDGYQNVIRAE
FT                   GETDWHPISKRYFNKEKEITSPYPFLDVASDLVAQLAVAS"
FT   CDS_pept        join(419719..420176,420226..420570,420634..420900,
FT                   420945..420975)
FT                   /codon_start=1
FT                   /gene_family="HOG000048345" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266198"
FT                   /orf_name="AFUA_2G01710"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL87268.1"
FT                   /db_xref="HOGENOM:HBG052413"
FT                   /db_xref="UniParc:UPI000051F68B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII7"
FT                   /transl_table=1
FT                   /translation="MDVVVFFILALTVLENVSAATVRSLSREAQPFNFPKARRLSAAVS
FT                   RSKLESRAELASNLLRREASFDFLHGDQDPHSVFVATLDVKSKSPILALEELDDSVQDV
FT                   ICKESQVDILFGSIEQVRSVHRGLEQIDGFILVTSHSGCNPDGARSTYRVNKVVIDPTR
FT                   NVLSLGKSDCGWQDAFHTTRVSFSRRHPSEVRRRSNTPTKRQQQSQSEPPEQTKTMGGS
FT                   TETPTVTFPAPSATSGLASTSAKELNEHYVDRKIFPPDIPAADMLLPSGLTVSCKNCSL
FT                   EGNIVLDKGSFEISGSDGLIDAVNSTIAFFDHGSIEVIANGLFAQIELEFDLSASQDLG
FT                   SFTAQLPAIPLIPFEVLFPESLCLAP"
FT   CDS_pept        join(422590..423441,423491..424546)
FT                   /codon_start=1
FT                   /gene_family="HOG000185084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208181"
FT                   /orf_name="AFUA_2G01720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87269.1"
FT                   /db_xref="HOGENOM:HBG052419"
FT                   /db_xref="UniParc:UPI00005206FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII6"
FT                   /transl_table=1
FT                   /translation="MSANQSLFHLENPARADEWATFDNSFEFASGYLESNPPSLDSISP
FT                   KDLELVYSDADALNWDSEAAQWPQSAFSDLVAFEDPLIGSTEMPMDMAGFSENVPPLPS
FT                   FPEMECSSSTFDATWSSFNVSNMEEAFYSPSNYRQLIESQAAADPRCFSKKEKRLEASI
FT                   ALHLQRLQDAATTDFNLSSESCGSFSSPCWPGSAAGSASEPQSRGSPSSTSASEPSTKS
FT                   STPPSSRPSPANGGVELVLDLNMNTTTNLPKKQKPRSQAQKENYIKVRKHGACEKHRKQ
FT                   HKRCNCLDKSTSRVLNDSAVAALAQSTNARLEVRNTGQNVIVTKRLGPNTLPTPSPAIL
FT                   DRSRAVKAVPGFVQPSIAISPTIKANVQRVERTVHDSAGRVNTAISPTVPTNVRPSERS
FT                   AHNSAGRASMAISWTPAPNTQVMGRIVQNSGGHVVSLRSPANVQRSERSAQNLVGQQNT
FT                   AHGYTQVRQSPKEARPWRTDRHTSPVQGASVTQNVQVATAGFRGRQDGAVCAVQFTPGL
FT                   LRESSGVLRPFRYKPTSQHDVGKLVEAPSTQANKHAKGKATFWPSSWAWSLPGSQAEVV
FT                   QNSTVAEYAGVVIRKTALAFLAFWQSSTSLTSWAGVLLGQLVLSSSRQHMLARKGLGLA
FT                   "
FT   CDS_pept        425145..425780
FT                   /codon_start=1
FT                   /gene_family="HOG000185007" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266199"
FT                   /orf_name="AFUA_2G01730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87270.1"
FT                   /db_xref="HOGENOM:HBG052427"
FT                   /db_xref="UniParc:UPI000051F436"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII5"
FT                   /transl_table=1
FT                   /translation="MADSYTSSSYYYSSTTNTTNGSSTTGHRYTTTSHTDPDGNTVVRT
FT                   AHQDLGQPAVVEERRYDRTGQEQLMLASGTETLPGGVRRITDLDDETGATTYDAGTQYG
FT                   IPTGSANEREESSHGDEWWSSSVGRSSYDIGPPLPGARTYNAYTGAYEEQRADYDADGV
FT                   PRYRDRGRGRGQGQSGYSAEQRASREFETDQGTRLKRETDVDMSDVLM"
FT   CDS_pept        complement(425912..427225)
FT                   /codon_start=1
FT                   /gene_family="HOG000000822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266200"
FT                   /orf_name="AFUA_2G01740"
FT                   /product="Sulfate transporter, putative "
FT                   /protein_id="EAL87271.1"
FT                   /db_xref="HOGENOM:HBG237959"
FT                   /db_xref="HOGENOM:HBG561905"
FT                   /db_xref="UniParc:UPI0000520231"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII4"
FT                   /transl_table=1
FT                   /translation="MTIETLREISSHNLRTFQNHYVSEVSGSLGDLGTFLPIAIALAVN
FT                   GTVSLSSTLIFSGSFNILTGLFFGIPLPVQPMKAIAAVAIARSFSNGTIAAAGIFVGAC
FT                   ILFFSVTGLLHWFANAIPIPVIKGIQVGAGLSLVIAAAGKTLAPLGWLQPSWADNRLWA
FT                   IAAFVFLLFTNVYRTVPYALIVFALGLAFALVLSTVAADLPSLEIWRPFVVMPGVSEWK
FT                   VGALDAGVGQIPLTTLNSIVAVVHLAGDLLPRVKTPSITAIGLSVAGMNLVGCWFGAMP
FT                   VCHGSGGLAAQYRFGARSGSSVIVLGLLKLLIGVFFGETLVGLLKRFPSALLGVMVIAA
FT                   GLELVSVGESLNTTGARDIAGFGQGLTGDSEHEIGPMLSDIERKRRWAVMMVTVGLLVG
FT                   FKNDAIGFVAGMLCHWGFQLPWAFERARARWSEGRIRV"
FT   CDS_pept        join(complement(429481..429523),complement(428565..429412),
FT                   complement(428243..428506),complement(428019..428180),
FT                   complement(427825..427968))
FT                   /codon_start=1
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208182"
FT                   /orf_name="AFUA_2G01750"
FT                   /product="Methionine aminopeptidase, type II, putative "
FT                   /EC_number="3.4.11.18"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL87272.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG008278"
FT                   /db_xref="HOGENOM:HBG318153"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="UniParc:UPI000051E3A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII3"
FT                   /transl_table=1
FT                   /translation="MGSKSPEGHRQAPHASNCNELKPANPDPQISQNGSGSADLDRGVI
FT                   GDDDDDEDAEENGVNTETPNVGKLNQPPFPNLDQVHVTTTDGLCITEKKKKRKKSNKKK
FT                   KKTKSGALPATELKQTSPPRVLVSTLFPSEYPVGELVPYDCTARTTDEELRYNSRLWDD
FT                   DFLPDYRQAAEIHRQVRQYAQKELIKPGATLLSIAEGIEDGVRALSGHQGLEPGDFFKA
FT                   GMGFPTGLCLNHIAAHWTPNPREKDVILDKGDVLKVDFGVHVNGRIVDSAFTVAFDDKY
FT                   DNLLTAVREATNTGIKHAGVDARMSDIGAAIQEVMESYEVEIDGKVFPVKAIRNITGHD
FT                   ILRYHIHGGKQIPFIKNNNQDKMEEGEVYAIETFGSTGRGFLDDDVGVYGYGRNENMSG
FT                   ANLRLSSAKSLLKTIDASFGSIVFSRRYLERLGVKNYLLGMKNLIDNGIVECYSPLVDV
FT                   KGSYTAQFEHTILLHSGGKEVISRGDDY"
FT   CDS_pept        join(431656..432105,432158..432497,432545..432820,
FT                   432874..437948)
FT                   /codon_start=1
FT                   /gene_family="HOG000158781" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266201"
FT                   /orf_name="AFUA_2G01760"
FT                   /product="NACHT domain protein"
FT                   /function="binding"
FT                   /protein_id="EAL87273.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG052455"
FT                   /db_xref="HOGENOM:HBG331581"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051F68C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII2"
FT                   /transl_table=1
FT                   /translation="MAATVSSPLPPGLLASNRRISGLMDSDVLSNNGVARSVTSRRVSS
FT                   RKFKSVETTEVSSLVHSLKRRSGDELGAGASAKLLNHTHDSALDWIRSQRMSLVPPEGS
FT                   SYDKVLSWAQLFVERLHSFDEAIEEFAGDSYLAARLAYGYCALLLELGQENASALMISF
FT                   SFFYSTSMKLGNLLERTELFSVSQEIREQLVLALADLVTLVASVSMHFHKAILGLTTAS
FT                   ISIDLYKTFPGQIQTFRDRCEKISEAMWRHQLLRENLDLEKVSDPKAIKLWLSPEDRVL
FT                   GNVAEQSSHLAHDREEMTCLWMAPYLARFLKSPLKTLAIAGKPGAGRTVLASVIVDQLQ
FT                   HTIGGVSYATLFVPINARVPAEATPRAVARSILYQLFDKRIGNVQLLQILSVAHERSKK
FT                   ATSEQDYDSLLWNALEAALSVALPGAKELVIVVDGVDEASCSEIAMLNQLATATAKGSN
FT                   VKLITLGALKPPTAAGQAFVQITEELIFDDIAAVVRSQLQQSRVFLGMSELDQETIVGR
FT                   ITEASQGSFLWGKLAAKRVRYEGTEESLHKAVDALLSAKLTLTDFALQLLQGPNVTEDA
FT                   KNMLVWLITADRPLSFKELELLASIQIDKLTVADRKLDVLQVLKPLNGLVFVQDGQVFI
FT                   RHGLFRASLLEIFSKGKLVSTVKDHHADLVTRLLIYIRATVTQENELSLVSLDWHDTDR
FT                   LINRNPLLEFAVRYWVHHVRQTSAFTAKGEVAAAQEFAKVLPASITTLRLESTLWENVP
FT                   TPTLLLYLTTVTNIYRQMLSANHVVTLQSIIFLALLNQRLEYTSDAIPLFFEAATLSRT
FT                   LLTSRHIVTMQMARTFIELTQQMTTSTKTEIMVKREEVLLLLVECYKRHYGERSETVVT
FT                   LLRQLIDHYTLIKEEERVKEIAASITSITTHHGRHGSSSANGGLEIHLNKGIDRSVDIG
FT                   VGLSLDYEEGDEIIQESESYNVKEWIKKAEIYVAEGKVELAERTYVEIWQRVSREYRTH
FT                   YSAYWEERKMTTVLAYSKFLVSQKRAFEASSVLTSLWQEYEQASISISETSVSYFQEVA
FT                   KMMKVVGIYDVALLVYKRCSRYYESINSTHSSTYKEIQENIRTTSKEVVKSFSSSNSVI
FT                   SETTIEEIFIGGSSSTETVEESSFTALHRSLELYISQHRWQDATRLHKKILRFVWPSLF
FT                   APSVQDVTLPEKYVDHCVELAARLSLCYHSRRRLSKEEDIRLRVYRAVRAERKVEDKLR
FT                   ERATAELLRFFEHTSQTEMIINLRQEMLGDYIEAYGAEHERVIKILWVLAELTRPRPIF
FT                   IEYYQQIIRALNKDSQVCHPEAIEPMVIVATELWNQGRYVDALAYYKVIFNTFLTQPKL
FT                   DPKFQVQELVQELFERYTRCLRSVHAELTVLHKVTVEYRARCTAVFGVTASITIRATLT
FT                   LAKLCQESKRFLSEAITLYEELLKIESAELDRDEISVILDGLSEEQAESSSSSTHSERT
FT                   FKVMRKRITDVRETHGWAHEESLTRMKEMITIYTERKETETVVRELTEATVQILMSETS
FT                   STRLIAAASTIASCYIEAGQTQKAVELSHEIYRQIVMKDVVNVESVQFDLSSKERTSLT
FT                   FLAQLEYSLRRNTSVTVTEILASLTTEYVYFEEFRRLLTSKSSSIQTLTVSAARLYHFL
FT                   VANGRQVAAARVFNDFLSYFAATEGKRVDLPETSRVKILVITILDHFSTHLSHNFVRSI
FT                   GIASVHRVTELLKEQRYEAACDLALASFKYLSAHDSYRSPVLVKFAFILGMAIAGRDIV
FT                   LYPDDAIRKKLLGVSAVIIQDALRVIDGLKIDLSQIGLHQLNNLIGLLGEQQDYQTLAW
FT                   LLTKLWTSREAQRTWKPYITLALGRRLVLARYLIGDAKTALRLAEDIVYNCRRVHGACH
FT                   PATLDSSVLLSQLYIGVGLRYQSHKNGQEMANRYYKKSAALHELLLRNFSDPSFAELEC
FT                   GLDNSMSLDGSAYDFDLGEPIGHVPDGESVRRHLYLLKLAVQRLGDWPKDYSEYERLNA
FT                   DLFREFASDLKGVEGVEKWDLKAYGAGKAEGNADILDTEFKGWEFLEGPAPVEG"
FT   CDS_pept        join(438567..439714,439760..440196,440256..440470)
FT                   /codon_start=1
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751528"
FT                   /orf_name="AFUA_2G01770"
FT                   /product="GMC oxidoreductase"
FT                   /EC_number="1.1.99.1"
FT                   /function="choline dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87274.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0008812"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG298145"
FT                   /db_xref="HOGENOM:HBG734713"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000051EA99"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII1"
FT                   /transl_table=1
FT                   /translation="MKLQRLLSITLTFTITAPTATATASASAKADAEAEADYLVTGGGT
FT                   TGLLLANRLSSTPTTTVLILDPGNDIRTNPNVTDPTLWLRNAHTEIDWAYPSTPQSHAL
FT                   NRILSYTAGRILGGTSMINGMTYLRADKPEIDAWEALGAKGWNWGSLWPYYLRTEKFSP
FT                   PLGWQVGAGADYVPDLHGRTGSVDVCFSMELSRVGFWERVRDAWRVLGVNWNRDPNGGS
FT                   VAGVSVWPQTIDCQEDVRCSSAKAFYYPVEGRENLRVVKGTVRRILWADTRGGEHVAAG
FT                   VEYLDENGQMRTATARKEVILSAGALRTPPILEASGVGDADRLRGLGIETRIDLPGVGE
FT                   NLQDQANVPLLYTGNLNISGTSPYATFLMASQLFGENLEAVAAETLSSVPSWADSLASS
FT                   SSNNLNSSAIERLLTLQHALIFKSNVTIAEILTSASGTTLLSAFWLLLPFSRGSVHLSS
FT                   TRREDINAPSIDTNFFQVDFDLQTEMAIGRLAQSFWEQGPVKSLHPVPMPGRALDDNAT
FT                   DTEWTAFTKETFGPNYHPVGTASMMARELGGVVDSRLKVYGTENVRVVDASVIPLQVSG
FT                   HLTATLYAVAERAADIILDGRED"
FT   CDS_pept        complement(440618..442246)
FT                   /codon_start=1
FT                   /gene_family="HOG000185028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266202"
FT                   /orf_name="AFUA_2G01780"
FT                   /product="Small nucleolar ribonucleoprotein complex subunit
FT                   Utp15, putative"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL87275.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG012349"
FT                   /db_xref="HOGENOM:HBG396404"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051FDDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WII0"
FT                   /transl_table=1
FT                   /translation="MAAPVLPLQQVKLPALPSTRLTPEQQYWKTFKNPLLIPSPANGPV
FT                   NLITQPSAPSSASAFPSLTQPPDVFTVTTGARVQIYSIRTRKLLRTITRFDDTVRGTDV
FT                   RPDGRVVVTGDDTGTVQVFDVASRAILKTWKDHRQPVWVTKFSPSDPTSVLSASDDRTV
FT                   RLWDLPSQSAARTFLGHTDYVRSGAYMPGSLAASGLVVSGSYDRTVRLWDPRVENRAAM
FT                   TFKMAAPIESVLPMPTGTTLLASAENKIAVLDIVAGKPLHMIQSHQKTVTALALASNGE
FT                   RLLSGALDGHMKVFETTGWNVVSGSKYPSPILSLRVITSGVAREDKHIAVGMQSGLLSI
FT                   KTRLSGQQKIRERERRKEMQALLEGKLEEHDRKVAKQKKLRGSGWEKRLRGRDFIGEGV
FT                   EIVIEGQDKKKRKKEQTWEYDLRKARYSAALDQVLASSDKTAQLTLFTALRHRSALRAA
FT                   LQGRDEETLQPVLQWVHRNITEPRLVTLCVEVAMNVLDIYSGNLGQSAQIDKMVERLHR
FT                   RVREEVEMAHQACQTKGMLDMLQAV"
FT   CDS_pept        join(446245..446474,446527..448912)
FT                   /codon_start=1
FT                   /gene_family="HOG000185029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903595"
FT                   /orf_name="AFUA_2G01790"
FT                   /product="Conserved serine proline-rich protein "
FT                   /protein_id="EAL87276.2"
FT                   /db_xref="HOGENOM:HBG052477"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI0000F5180E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH9"
FT                   /transl_table=1
FT                   /translation="MASKLPRIANINHAAGIYADMSVDGPAIGTLVAVIDRAKNLPNRK
FT                   TMGKQNPYCAARLGKEAKKTETDLRGGQTPKWDQELRFTVHESPDYFRLKVSVFNDDKK
FT                   TDLIGETWIDLKDLIIPGGSQSDQWHPLQYRGKYAGEVRIEMTYYDTRPEDEAVIERRT
FT                   QAAEKAHAKSNSSRPAPAAPVTSSSSSSSSLSGPRQLEKVKRRPLPSDPTAATPARPGP
FT                   PEKTPAAPVPSHPAPGRPVHHEHAHSMPAMNSPDHMRYSQRQAPEAPYDAYASASQAPP
FT                   PAKVYDTPDDFHREWNYAAPAHPAPAPAPPRRSPQEESYPYRERPDAYDNRQHARPRSG
FT                   YGNGPAPDYRSMPPSRPEYQSPPVPDMHPRHAYESTSRPTSHHSNRQFPAPEQYGYEGD
FT                   VLRHSHGHEAAQYSPHSSTRSYNPPPVDYTHGAPPGPEPEHHYRLHSNSGASINSRHRN
FT                   SLAHETFHPEYAAMQPRVDDDEEEEGPPPPPPAHRSGLVQPSQQLVPSPTSSYKAYSPE
FT                   FAPSPRNTTDMTAPQPLRPSHGNRLQDHPHMKNPSVPRSLVAGFDPAIAEGEAARTARE
FT                   RPANRRRSFFEEDAMIRAAESNPASPPYPADTDPHRSLVLRKSVSSESRIVPRRKSVSP
FT                   RPPSLAERQVSQTPFSPDSYDALNPNAARSAVTRDTAPAYETVAQAMQTARLNEMKPDT
FT                   SRPIIGDDGREIDPSDHLPSETWAPEPERKNRKPEVVLRFKHPSAREVGGPRPRSRGTS
FT                   TGAENERGRQEYGGYGHGRNHSTTEVARPRSSHRKSVSPAPSARSSHSVSSLYANVGPP
FT                   IPAKVPIAPPAGPSYPVMGGHAGMDALSRELSSIDLGSVGCSVVRAPRKHVPKAITYAM
FT                   "
FT   CDS_pept        449168..450091
FT                   /codon_start=1
FT                   /gene_family="HOG000216914" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266203"
FT                   /orf_name="AFUA_2G01800"
FT                   /product="Hypothetical pathogenicity factor "
FT                   /protein_id="EAL87277.1"
FT                   /db_xref="HOGENOM:HBG052478"
FT                   /db_xref="UniParc:UPI000051E396"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH8"
FT                   /transl_table=1
FT                   /translation="MSPPSSSHSPNASTTMTPKPKATPSKQPLHPTPTRQEQTQEPPCE
FT                   FTHPCTTSTTSLSGSGSGSGSHPRKLISHIFGRNKTSTKLFPSTVWVHYCRKHYQRARY
FT                   RSRAWPFTQCELLLDSLGRMEAWGGVESFEVVLRRREMERLSSAEQRQGSGKKGTGRAL
FT                   RKGRRGGGGEASACTSTGASGEEYGDDEEESDDGGRRRRRKPRIKACPVPGWLRAETGP
FT                   GKSFAEIRAMVERIREDLTEQQHRLTQKTKGTGKSKEQVLFPDIEILPTFRSWVLEQAT
FT                   ADGENTSKKSRVSRKGAVQKGTKVIQ"
FT   CDS_pept        join(complement(450986..451085),complement(450869..450930),
FT                   complement(450470..450754),complement(450238..450411))
FT                   /codon_start=1
FT                   /gene_family="HOG000185040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266204"
FT                   /orf_name="AFUA_2G01810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87278.2"
FT                   /db_xref="HOGENOM:HBG052479"
FT                   /db_xref="UniParc:UPI0000F5181D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH7"
FT                   /transl_table=1
FT                   /translation="MDFHLVPRGTDRNYTGFLTKTIVYASTLLLFLAAFGLTISSIVVP
FT                   KWVSYHSEKFHYSYGLHRRCSSLTNVCESFPQREDCHGEDRYFCSMWRTVGFLMSFAVV
FT                   LEGMSVVAYLIVLSGGKRLRESGWKVLSLLIILSALVQAASMSIVAYLYDNEDRFFVGW
FT                   RLGESWIYCTVSWCVSLFCAVAMILAGNSLPSEGGYELIPDHS"
FT   CDS_pept        join(complement(453983..456550),complement(453699..453926),
FT                   complement(453292..453648),complement(452480..453238))
FT                   /codon_start=1
FT                   /gene_family="HOG000185051" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751529"
FT                   /orf_name="AFUA_2G01820"
FT                   /product="Pre-mRNA splicing factor (Prp24), putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87279.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG052480"
FT                   /db_xref="HOGENOM:HBG332704"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FB6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH6"
FT                   /transl_table=1
FT                   /translation="MDINSLLSPDSNPQSGRSTPGNGSMSANNAPAATSRPSNKPLRKG
FT                   RTTPARPTMTSSPLAHYVYAPSHLNDPSPPATSSPSVGPNIGGGNGTPPSVDLPPSRQA
FT                   STPGMDTLADLASMQHHQPQRSNTSILRGTESYESQLSPSTMYPHVNPISHNTPTPRTS
FT                   FDIAMSEGPREGAARRNYADTSLRPDAQRMATELFAQIQDNPHIYEAHVNFIRLLHEGF
FT                   VNHVYPPNNPDIHGDPRKYDLLRDMRTAREEMDKLFAMGEDLWAEWIQDESMLAQSVEE
FT                   RIAVMELCQRSIEEEYGSTKLWTIYGEWVLYLYNSANGDTGSNQWSEEDKLVGREVFTW
FT                   QSVLDVWQRGAEATRWRIHDSHLVWDRFLDLQVQDLSRRPSQERASQVKAFFDVRLQTP
FT                   HATWDQTFQAFSGFVSTYYNANYEEIMADTAGRLATPVKEKYNAREHLEIKLRNAVDAG
FT                   EFGLEWAAYSEYIDWEVSRHRRRRQSNFDLVNAIYQRAVLRFPTDSNLWEDYVMFLIDQ
FT                   NTHGNAGATTISTLERATRHCPCSGTLWSQYLLSSEREGQSFQRIADIKHKATSTGLLD
FT                   AGGMEEVLKVHTAWCSYLRRRAFLSDSTDEDLDVAEVGIRSAIESVQELGEKKYGRSYQ
FT                   GDPLFRLERIYIRYLSESGSWDSARETFKGLVGRRGNSYEFWLTYYHWELISWSKFVQG
FT                   EGTADAARRTPNPSFATAVLKQAIKRTDLDWPEKIMQVYIAHCEDYEDSDELQQAILET
FT                   RKAMKAITARREKEAAAALQQQQQAAANYASQAEKRKRQDDTGVNGYPSSKKARAEEPT
FT                   PAPAPAAPQPESVALRRDRENATVVVKNLPHHITEHRVRQFFRHCGTIKGLKMLPGDDG
FT                   NSETAIIEFETREEALVAQTRDQKLLDDNAIEVHLGSGSTLFVTNFPSTADESYIQNLF
FT                   REYGEIVDIRFPSLKYNTHRRFCYVQFKSSGDAHNATRLNGTRVGSDLSLVVKISDPTR
FT                   REDRHGPVYEGREIHISNIDWKANEDDLKEVFQKYGTIETVRIPRKVDGGSKGFGYIVF
FT                   STKEEAETALAMHEQEFRSRPLQVRISTPQGAKRTATTIVNRVQSPATEANGTKAPSVE
FT                   PEGTAKERSARTLGLMNVPDTVNDARIRAMVEPYGPLIKIVLRPDHQGAIVEFADVNHA
FT                   GKASLELEGQEIAPGRRLHVGTVSELLKQSAEKKGGPGQATKSKDKATFLQPTGPIKRP
FT                   VQPGQRGGRRGGLGVKRVTMSSTASQGASTKAEEGVQSATTMTTTNVTTESGAHPVGGE
FT                   KLRKSNDDFRAMIQRNRGE"
FT   CDS_pept        join(458516..458564,458638..459653)
FT                   /codon_start=1
FT                   /gene_family="HOG000185062" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266205"
FT                   /orf_name="AFUA_2G01830"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="EAL87280.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG052481"
FT                   /db_xref="HOGENOM:HBG332701"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="UniParc:UPI000051FB7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH5"
FT                   /transl_table=1
FT                   /translation="MATMGAVYPYGQLIRSARRGVTFVPRRTLTYSLPRRAQDDGNNGP
FT                   NEKPEEQSKPSALSSIKNFFFGGRSETAKPKITRRATAPPKREGSLSADSIFAEDEASP
FT                   KLIASGRTPAARKQAIEAAEGQEEANLEVENRNRITMAAVLDPRPKARMRWERKMIVRE
FT                   VRRRGRLTKTERIMRTERESLSKSHWFKTSVKKLGPLARQIAGKNIDEAMLQMRFSKKK
FT                   VAKDVLEHLEHAKNVAIVRSGMGLGNAADQKPITITLKNGERKTITNPSSIYIAQAWVN
FT                   RGPYGVDYDHRARGQINRLRPPYTSLSVLLKEEHTRIREWRDREAEALRKRKAQLWTQL
FT                   PDRKITAQNQYYSW"
FT   CDS_pept        join(460418..460522,460578..460796,460861..461103,
FT                   461153..461542)
FT                   /codon_start=1
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208183"
FT                   /orf_name="AFUA_2G01840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87281.1"
FT                   /db_xref="HOGENOM:HBG059067"
FT                   /db_xref="HOGENOM:HBG398267"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000052047F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH4"
FT                   /transl_table=1
FT                   /translation="MMAESITSESHLKLNSVTGYFMQDEPTTDPDTFDYVASNFGLIPR
FT                   SYDSDAGFDPDGRRTQWERFEYQINKLNEESGPDTSYRLLFLGRHGEGYHNVAERRYGR
FT                   EAWDCYWSLLDGDDNGTWVDARLTPVGIAQAETAHRAWETQIESKIPSPQSYYVSPLNR
FT                   CLATANITFRGLKMPHTEPFRPVVKELLRETIGLHTCDSRSSKAAIQAEYPEYIIEDGF
FT                   AEEDPLYDPKLRESDTARDARLRDLLQNIFTHDKNTFISLTAHSGAITSILQVTGHRKF
FT                   ALATGAVIPVLVKVERVAGPLPKMHIDPPTTAPVCKN"
FT   CDS_pept        462511..463473
FT                   /codon_start=1
FT                   /gene_family="HOG000185005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208184"
FT                   /orf_name="AFUA_2G01850"
FT                   /product="Phytanoyl-CoA dioxygenase family protein "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL87282.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG023990"
FT                   /db_xref="HOGENOM:HBG332706"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000051E850"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH3"
FT                   /transl_table=1
FT                   /translation="MEGLTPSQLAFFRENGYLVIPGFLSPEDITSLLTETNKFLDDFPL
FT                   ESHPLTKFTTGDDETDENNTHVGDDYFLTSGDKIRFFFEPEAFSSTPDPATGKPTLLKP
FT                   KQQAINKIGHALHSLSSPFEKVSLSARNAAIAKSLGFVDPRVLQSMVICKQPGIGGAVP
FT                   PHRDSEFLYTRPPSAVGWWFALQDAGPGNATLGMWKGSHRQGIKRRFVRKVGENGKVLG
FT                   TEFVENDGPKMPRGAEGDGQDPDQGPDVKDENFEILDIKAGSLVLIHGNVLHMSEKNTS
FT                   PRSRFAYTFHVIEGADGWDYDERNWLQPPEGGEFSKLYR"
FT   tRNA            463802..463882
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        join(464359..464890,464983..465146)
FT                   /codon_start=1
FT                   /gene_family="HOG000184973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266206"
FT                   /orf_name="AFUA_2G01860"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL87283.1"
FT                   /db_xref="HOGENOM:HBG052482"
FT                   /db_xref="HOGENOM:HBG332722"
FT                   /db_xref="InterPro:IPR018908"
FT                   /db_xref="UniParc:UPI0000520232"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH2"
FT                   /transl_table=1
FT                   /translation="MDPDASVPVDEPSVFNYVLSFLLVGIAWGFTTPFIRRAAADFNAR
FT                   QEALQKPQSQMVPQTQSAQSTEEQELQDQNQGVACSTKNGHGHESEEDQDSESGEEDQP
FT                   LTGRSTAASTAAAEGSSRVPAWMKPKSTSSWLKTKIVTVFWTVFNLLRTPAYSVPLVIN
FT                   LTGSIWFFLLVGKHELSLTVPLANSSAFLFTVLGEWYVERKVIEKETWLGMALVLGGIG
FT                   ICVHSKNQN"
FT   tRNA            complement(465235..465305)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        join(complement(468682..468816),complement(466987..468621),
FT                   complement(466532..466933),complement(465854..466483))
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751530"
FT                   /orf_name="AFUA_2G01870"
FT                   /product="Chitin synthase A"
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="EAL87284.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI000051E5E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH1"
FT                   /transl_table=1
FT                   /translation="MNPQHLADRTPSPGRPLNTYQLSDNPYVHDHLQMPSSDRLAEQPT
FT                   YSVERIPNSYGHNEAYEQRHHEQYPAYDYAVNPEAHHDAYYTQPYEPTVTPQDDYDLGQ
FT                   YHEQHQPYQDDQVPILQPENPFGPDPYSEEYHDDPAAVPTPSPAPIRRWKTVKEVQLFH
FT                   GNLVLDCPIAPKLLSQVPHAEPPGRDEFTHMRYSAATCDPADFYEERFTLRQKLFAKPR
FT                   HTELFIVITMYNEDDFLFARTLIGVFKNIEYMCNRTQSKTWGKDAWKKIVVCVISDGRA
FT                   KINPRTRAVLAGLGVYQDGIAKQQVNGKDVTAHIYEYTTQVGLELKGTQVHIKGRSACP
FT                   VQMIFCLKEKNQKKINSHRWFFQAFGRVLDPNICVLLDAGTKPGRDSIYQLWKAFDVEP
FT                   MCGGACGEIKVMLSHGKKLLNPLVAGQNFEYKLSNILDKPLESAFGFISVLPGAFSAYR
FT                   YVALQNDKNGQGPLERYFLGEKMHGANAGIFTANMYLAEDRILCFEIVTKRNCRWLLQY
FT                   VKSSTGETDVPDRMAEFILQRRRWLNGSFFAAVYAIAHFYQIWRSDHSFMRKFMLLVEF
FT                   IYQTINMIFAWFNIGNFFLVFHILTTYLGDAELLGTTGKVLGVVFEWLYLATLVTCFVL
FT                   SLGNRPGGSNKFYMTMVYFWIGIMIYLTFAAIFVTVKSIQKEVADNSFSVGQLFSNSQF
FT                   FSIFVSLGSTYVMWLLASLIFLDPWHMFTSFIQYMLLTPTYINVLNIYAFCNTHDITWG
FT                   TKGDDKAEKLPSANMKPGGKVDVDIPQDDGDLNAQYEAELAKFAQKPPKETKVISEEER
FT                   QADYYKGFRSAVVLAWVFCNFALGAVVLSAAGLDRFNSDKNATDDDRATIYMAVVLWSV
FT                   AGLSIFKFIGAMWFLVVRMVCSRIFDFSILLSHANASHSSEAFDVISLVFSFPCDCTHP
FT                   ALY"
FT   CDS_pept        join(469720..470015,470068..470113,470192..470552,
FT                   470612..471144)
FT                   /codon_start=1
FT                   /gene_family="HOG000048346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208185"
FT                   /orf_name="AFUA_2G01880"
FT                   /product="Low molecular weight phosphotyrosine protein
FT                   phosphatase, putative"
FT                   /EC_number="3.1.3.-"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="EAL87285.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG052483"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI0000520705"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIH0"
FT                   /transl_table=1
FT                   /translation="MYYAAAEHCFACNIPHLDNRKNELQFINQAVDIGALVHGLQWRDL
FT                   GVVLGHWANGKPICLSLPQCHTPNMSALWLSPLKITLRRKGTNITSCIEEFYLLRLRFG
FT                   KIPYLFQHNHIFFLSSVLGISIFHGYIRDNLIAPYQQKSSSYHAVAGALFVELVDVPEE
FT                   CLVAEGGATWQNSYRCGGVCNILIGDAYMHLSQCLFNHQAASQQTTIAMTASESPSAEH
FT                   KVNVLFVCLGNICRSTMAEGVFRNMASTHPLINEIDSAGTGAYHTLEPPDSRTMSTLRR
FT                   HGITNYNHAARKITKDDFLHFDYLLAMDKYNLRDLLDVRESVVASLRKSGGAKGPRASS
FT                   GGAGAKVAEVRLFGDFGPGGVLHDRVGGGEVVQDPYYGGVNGFEEVYQQVVRFSKSFLE
FT                   YLEKKQGSEVEE"
FT   CDS_pept        complement(471402..472175)
FT                   /codon_start=1
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056877"
FT                   /orf_name="AFUA_2G01890"
FT                   /product="Ubiquinone biosynthesis protein Coq7, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="EAL87286.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG267823"
FT                   /db_xref="HOGENOM:HBG656570"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniParc:UPI00005206F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG9"
FT                   /transl_table=1
FT                   /translation="MNSLSSFRKYFLSRSAQSTSPLMLDFLVPSVLRQSRTRHSSTAAS
FT                   SSPDGAQQSSQNSGAGSSKPTYILSKKQREYLDSALRVNQAGELAATLIYAAQTPQVVR
FT                   SHPHLRPLMKHMYDQEVGHFSTFNKLIAKHRIRPTVMYPIWKVAATFLGWSTAAMGREA
FT                   AMACTEAVETEIGTHYNDQVREILSWEADAKSRGEELDDELKEMLVTFRRIRDEELEHL
FT                   DHAIENDAKEAQPYDPLVNVIRLGCRAAIKISERV"
FT   CDS_pept        join(472771..472979,473070..473821,473889..474028,
FT                   474084..474806)
FT                   /codon_start=1
FT                   /gene_family="HOG000184951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266207"
FT                   /orf_name="AFUA_2G01900"
FT                   /product="RNA polymerase II transcription elongation factor
FT                   Rtf1p, putative"
FT                   /function="DNA binding"
FT                   /function="translation elongation factor activity "
FT                   /biological_process="histone modification"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87287.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016570"
FT                   /db_xref="HOGENOM:HBG052485"
FT                   /db_xref="HOGENOM:HBG332725"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniParc:UPI000051F44C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG8"
FT                   /transl_table=1
FT                   /translation="MADDLDAELLALAGDSSDEESSPQPKQNSESPAPSASPSSAMARK
FT                   GTAKSIKRSKKSRNEDEGDEEDGEVSDAGSHHSLESASMSESDAASDSEGASEDAEEDR
FT                   PIFPYEKLYYSAKDKEEIMALPEIQREQILSERAQEVDRRNQDLALRRLLASRERDEAR
FT                   RVKKSKRKASVADLEEGQRKSSRQKTTLGGRKVGEASEAIEAYKRQREKKGRRDELRRR
FT                   DMAAGEAAPVKDEAPSDKDAEGESEVEWDNRERSPSPPKDDPPADLRDIQRARVGRTNF
FT                   AQVCFYPGFDEAISGCYARVNIGPNRDTGINEYRLCLIKRFTEGRPYAMESPNGRSFVT
FT                   NQYAVLAHGKAEREFPFIACSDSPFTEAEFNRYRQTMAVEDCKMATKSMLAKKVADINR
FT                   LINHQFTKEELNEKLRKQGSLDNKMRTFKRLETEKQLKLARAAGDDEEVSRLEKELAEL
FT                   MGPKLAFSTQPSKPRKEKSDYERLAELNLRNQKLNTESVRRAQLEERKASRKAAAAVAR
FT                   GEAQANPFMRVRTLAKTHYDANGNSLIPDSLSSRGGTPATGSETPSKPSTPKPAVTTQK
FT                   KQSKGGIGSIRHRNMDDENIAALDLELDIEI"
FT   CDS_pept        join(475382..478173,478228..479290)
FT                   /codon_start=1
FT                   /gene_family="HOG000184940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208186"
FT                   /orf_name="AFUA_2G01910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87288.1"
FT                   /db_xref="HOGENOM:HBG052486"
FT                   /db_xref="HOGENOM:HBG332726"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniParc:UPI000051EF34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG7"
FT                   /transl_table=1
FT                   /translation="MSTPSTPRTARSASESGTPILTPGRKIRAILAAFDSDSESDNANN
FT                   KQRTIQKPVETMNDVESEDDDDDDIVKPKGRLAARMQAHDQTSASPPVTERTAFDRVSK
FT                   FLRAEREQSKEGEQARLESASASEDEDDLPKAGPRRRRNVRKTPEPGENNTPASSSRAR
FT                   SFSPLFMSSPAPQRNKALSDDEANDDDEEDLKADPRVRALIMQKRKEREEKERLEAEKQ
FT                   TARLAQRDQSSSEIASVEDSDEEEAGRKLTQQRPAARKASKKALEEMNRETQRISRNMQ
FT                   LAHQARTKKKITKESFFARFNFVQQEESNVAGHTEENSSTTAGSQQSSDNEAQKAKETP
FT                   QTSPVLGPSDKLKPDEAVDESNKEGGADLGVEDFPTVDEMLSRSQDQHQQVTVGRVEVE
FT                   ENESKKPLEPTKPERRALTKPPIRVRVSRQSIAQKQLEDSDDDLEVVTDPAKCRRIAAF
FT                   ENLPAKKMQESASMLKLKALAHLTSPTRRSKTMNTAELSAMLLLQARQQAAKERQERIQ
FT                   ELRAKGVIVETAEERAAMEDELENLVEKARQEADAIAKKERGSKTKKLEDVDDVDDEED
FT                   EDFELSGSDQEGYGDGEGDEEDEAEEDDEENEQGFVDSEAGEDEESEDEQTEVMSADES
FT                   EVPAVRRKRPTRVISDDEDEDERQAPKTPAKPTPSTVNSVERPQFPGMTSDGLTMSLTQ
FT                   AFAGTLGASQPVTQEGSPAIPDSLPDPAQITHDRRDSESQIIIKDSQEQRVESTDILAG
FT                   YTPPESRVSESPAPRAMSQYSQIPDPTQDAGFVLSPFDPSKRFLGTPHSTIETVLVGQN
FT                   ESRNTTPVPDGKSKHLRRGRAANLSMIEEQEEEGFEIDASAFDVMKKAAKTKTHVPFDP
FT                   KTSKAKEMVEDAAEESDDEYAGLGGASDESEDEEDAYDRQMINDNSGETVDEKQLAALN
FT                   ALHQRNADEKQVAKLLKDITTGALRRRRHADDEFDLDDSDDELLARRRQKQREFARMRK
FT                   ALLADEKIGEIAENPKKAAFFKAIEDRDSDDDTGLDFLDGEEDPGSQQVSSQGVSSDAP
FT                   QQHSAAEESKKRKRPLEPSAEDINNRPPPHLRRKPASVISKKPATLAEIRETVSFLTET
FT                   PEYDSFHEDASIDDVDEAQDDDEDDSGSAQEQPKETFAVPRHPRRTRGPVVDRLALLRQ
FT                   ASSNSATSASSSNRLAFFAGGGNDLSFRPPPLLRKTTTSSSSGSTSSKSDSSKRVTKPA
FT                   AGASVAKKGAVNYYTAAREREREREIRAKNRSGGSNITALLNKYASNRLGSLGGTGQWE
FT                   "
FT   CDS_pept        479695..481689
FT                   /codon_start=1
FT                   /gene_family="HOG000259232" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266208"
FT                   /orf_name="AFUA_2G01920"
FT                   /product="Glutaminyl-tRNA synthetase "
FT                   /EC_number="6.1.1.18"
FT                   /function="ATP binding"
FT                   /function="glutamine-tRNA ligase activity"
FT                   /biological_process="glutaminyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87289.1"
FT                   /db_xref="GO:0004819"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006425"
FT                   /db_xref="HOGENOM:HBG334108"
FT                   /db_xref="HOGENOM:HBG389548"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniParc:UPI000051E85B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG6"
FT                   /transl_table=1
FT                   /translation="MASTGETTLPERPKEAAAPAEQSPAPAGEKPSEEKSAKAPKPKAP
FT                   KQKAPKNPDGKNNNNNGKKGGGKPKAANAKEAATDLRSVDPDAMFKVGFLADVYQERPI
FT                   SEKHPKIRTRFPPEPNGFLHIGHSKAIAVNFGFAKYHGGECILRFDDTNPEGEEEIYYR
FT                   GIEDIVSWLGYKPVRVTNASDNFDRLYELAKELIRRDGAYVCHCTKAEIKAQRGEADGA
FT                   RGKARYACPHRSRPIEESLQEFEAMKEGKYKAGEAALRMKMDLDDPNPQMWDIFAWRIL
FT                   DVDQKGHFRTGGQWKMYPTYDFAHPLCDSIEEITHSLCTVEFEMSRQSYEWLNDKLDVY
FT                   RPMQREYGRLNLTGTVLSKRKIIELVKKGYVRGWDDPRLYTLIAIRRRGIPPGAILSFV
FT                   NNLGVTKATAIVQTAKLDQIVRQYLETTVPRLMVVLEPLKVVISNLPDGYEEMVEVPFS
FT                   KDPAFGSHLVPFTKNVYIERSDFREEDSPDYFRLAPGKTVGLLKVPFPITATAFDKDPQ
FT                   TGAVTCVYAHYEKPEEGSDGPAKKAKTYIHWVGESAAHKSPVKAEVRAFNSLFKSNDPS
FT                   AHPDGFLADINPDSEEIYEGAYIDIGFHDVSKSAPWPKTSGETGGEVNPYSIRFQGMRT
FT                   AYFCVDTDSTADNVVLNRIVTLKDTQGKT"
FT   mobile_element  complement(483512..483688)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        484338..485867
FT                   /codon_start=1
FT                   /gene_family="HOG000216916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903596"
FT                   /orf_name="AFUA_2G01940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87291.1"
FT                   /db_xref="HOGENOM:HBG052488"
FT                   /db_xref="HOGENOM:HBG328316"
FT                   /db_xref="UniParc:UPI000051ECC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG4"
FT                   /transl_table=1
FT                   /translation="MISCVVILLLASLAAALSAVQFPDNANHIFNAIHSSMRQWGSSLH
FT                   HNGMSFFLASVPAGTQLYHGTHQRDRVNGTEWLAFEPEHAMVFAAFGPGRGPPPGGPDS
FT                   PGSDDPHRPSFQKLLAQIGETEKDKDPELGGWLHTYVAAKDLRLVYIDGMSAAKSSNGT
FT                   LDSQDRILLRDALDDGNGDLMRDEKRRAETICRMAREEWEDRIDGVIRMEAGFEIILCD
FT                   FARDLDLLHVVRVKLDGIGPGAGPGCEPGRGKEMEKGPGGKAGPTRWLRAIAARYDGIG
FT                   GRRVALNYDHFVTAYAYGLDLFASAEGGRRLPRLQHLSSADLDPLRRDLHRLIMTHDTN
FT                   ESSFDWQAVTDMVIERYAHELRYLASGELSTTEQLHAELETILSPFIDYGDRNSTLEVD
FT                   RCSAKLLSARSPAHGVAAHAIRSVVRAICSTLLEAWGQTDYSLAVNQINDLMEYLSWTT
FT                   WKRCSGCGDHEICVIPIWPMGTVEDYEHPQCRDANQPYGEGSRYWGRIRPR"
FT   CDS_pept        join(486488..486533,486591..486791,486848..487935)
FT                   /codon_start=1
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056878"
FT                   /orf_name="AFUA_2G01950"
FT                   /product="Monooxygenase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87292.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052656"
FT                   /db_xref="HOGENOM:HBG321923"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000520480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG3"
FT                   /transl_table=1
FT                   /translation="MAQTPQDLRIAIIGAGMGGLTCALALAKEGFKHIDVFEYAADLGF
FT                   VGAGIQLAPNMARVLDRLGVWKEIEAEAVEIKDTSVRVGASDSELAHVQLGYIRETYGY
FT                   PHMVGHRHSLANGLYKGCLRCPDQIKFHFSTAAEDVTSFGPRATFTAVPRDGSAPYPVE
FT                   ADVLLAADGIKSKTRVAMLQTLGITATVKDTNQAAYRIMIHKDQCQDDPELQALINSNR
FT                   VIRWIGERRHIIAYPVSNNTIYNLSTTQPDTNFAAATNATYTTKGSKATMLRVFADFCP
FT                   LVQRMLNYVPEGEVCEWKLRVHEPLPTWVHEQTALVGDACHPTLPHLAQGAAQAIEDGA
FT                   TIAIALRRMPDPSPASITKALKVYESVRKDRAYALVELAAASGRALHLGEGAAKEERDR
FT                   QFAALRQGTGKGPVPDKWADADVQREIYGFDCQRVTEERCDEYFA"
FT   CDS_pept        complement(488428..489477)
FT                   /codon_start=1
FT                   /gene_family="HOG000184907" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266209"
FT                   /orf_name="AFUA_2G01960"
FT                   /product="UbiA prenyltransferase family protein "
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87293.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052489"
FT                   /db_xref="HOGENOM:HBG331294"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI000051ECDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG2"
FT                   /transl_table=1
FT                   /translation="MHLRLLCSLYQGSDSTEEHGAIRTRMQEKHPLTGVLQELLVTWRL
FT                   LYANAGEGLVLPVVGMLARFLPTPSLLDSTPWLQLLSVLLKTVFLFICHLYVFEIVNQV
FT                   TSVEEDRINKPQRPIPSGLLTVAGGRKRWAVSWIVCPLLAYYLAGFQAGCLFLEYQLWT
FT                   CFCYVWPKINHFMFRNAFASVGVYNMFRLIDVIISSEVPSFPLPPIDFYLVLSAWVMLT
FT                   VHMQEFHDREGDKKTNRQTLPVIVGPRWHGALRWATALLVMGTGIMPLCITGKLVWNGQ
FT                   DTGFRNKRWIYTGTVITAILHVVFASLSGLRCAFSWGEAAYDRQTYKRFYMLAAYTMVC
FT                   YLSFAYLTA"
FT   CDS_pept        join(490770..490884,492385..493682)
FT                   /codon_start=1
FT                   /gene_family="HOG000184896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056879"
FT                   /orf_name="AFUA_2G01970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87294.1"
FT                   /db_xref="HOGENOM:HBG052490"
FT                   /db_xref="HOGENOM:HBG332738"
FT                   /db_xref="UniParc:UPI000052049D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG1"
FT                   /transl_table=1
FT                   /translation="MQQRMALFSEECSNNARLDALNFPDLTSCRVPSSEGPLTKADDEI
FT                   STSDTEESPRSPPLSTARVAPQQRGRELIEDFQDDATHLFDSGLRKAVDEISDSETNHS
FT                   SPPEGASDAEAAFEALFEPTTVDRRKRRRISLDEEPSTARPARHSADMILTSSPETSAL
FT                   MADPPSSPIPFRTPKTKTPTAASLRTVPAVQQTPRPATPVSTAPFRDHPRFKVFQPALS
FT                   SQSQFTPRPTAGSASQLPTPGPQRQKPVFVLPRSPSPSRMDDESMIPTPFSPSSHALRR
FT                   RGRPRSSTADYLPGGMASDVRSWILEMGTKSEQMQKSLDAHSSTHHAQGPPDLSQYYLV
FT                   LRILDVRQSALGSSGPVAYIHGVEVTLPDESESATSQSRRVLLLGPPRPASLQSSRARA
FT                   QVPELRTGHLVGVFRNLVWEVGLDQTHLDGNVPSEDTQKKEEPASSLGRNTSTEHLEKW
FT                   LVGVEWELIDQG"
FT   CDS_pept        join(complement(495189..496521),complement(493917..495136))
FT                   /codon_start=1
FT                   /gene_family="HOG000184884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208187"
FT                   /orf_name="AFUA_2G01980"
FT                   /product="Nuclear protein (Sgd1), putative "
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="EAL87295.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG058179"
FT                   /db_xref="HOGENOM:HBG332739"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F68E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIG0"
FT                   /transl_table=1
FT                   /translation="MRRPRPKHNTTSLPRALRAELGIKDHYGEKKHKRNGPGSRKDRRQ
FT                   AERTEKKRGPPPRSKARQYDGEDDDDDDLAEFGNESDFDSDSDEDVPASKSKSAKSEPK
FT                   PKSILKKNRKGVEESESEDAAHTSSVKPRKISQAVKDKLDEDAAEIAALEKKLGLKKGK
FT                   KLPKSFEEDGLLDLLGDLGDGSEDESRKRKREADEWLKNKRRKAQGLAPEAVSEEDDSD
FT                   LASDEELGDFDGDGFDDMDEDEDEDEEEEKPAPKKRENPYVAPVAPSSENKPGKYIPPS
FT                   LRATSSSESESLTRLRRQAQGHLNKLSEANLISILGEFEKLYREYPRQNVTSTLLTLLF
FT                   GLVCEGSALQDTFIILHAGFIAALYKVIGPDFGAELVQKLVETFDAAGDERGKFQGKEM
FT                   INLISLLSQLYNFHVVGSTLVFDYIRLFLQEINEESTELLLKIIRNSGPQLRQDDPSSL
FT                   KDIVLLIQPAVAKVGEESLSVRTKFMIDTITDLKNNRLKAAPGSSVTSEHITKMRKILG
FT                   SLNNSRVLRASEPISISREDIHNASQKGKWWLVGASWKEDPLVSARQELASLPQDNKAA
FT                   VQEEDSEVEPDLASIAKAHRMNTDIRRSIFVAIMSATDYQDAHVRLMKLRLKRAQEFEI
FT                   PRVLTHCAMEEEAYNPYYTLIARRLCGEMGRRMKVSFMYTLWNNFKRMGESDDMDDDEE
FT                   EDAGFRDDNDERNQLSMKSAVNLAKMYASLIADGALTLSVLKTLNFAYLQPKTKAFLEI
FT                   LIITIIQQSQKSKKGKKNGKKAGQEEEAERNEKPLMEIFLRARDTPQIVKGLIYFIRKV
FT                   VAKTDIVESEREQKLVRWGCRVAVDALKVVANEDVSLG"
FT   CDS_pept        join(496886..496912,496987..497379)
FT                   /codon_start=1
FT                   /gene_family="HOG000184883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751531"
FT                   /orf_name="AFUA_2G01990"
FT                   /product="Signal recognition particle 14kD protein,
FT                   putative"
FT                   /function="7S RNA binding"
FT                   /function="endoplasmic reticulum signal peptide binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="EAL87296.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0030942"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="HOGENOM:HBG052492"
FT                   /db_xref="HOGENOM:HBG629003"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniParc:UPI000051F438"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF9"
FT                   /transl_table=1
FT                   /translation="MAKHLSHEEFFSSLSDLLSKTSQKARGSVFLTQKPLLPNNANTST
FT                   SENASSSSSLPPILIRATDGNTNAPNPKTAKDQSQKAARTSKVKLSTVVAQEDLETFFA
FT                   RYAEVCKASMTGLKKRDRKKGKAKAKGGASKVTKA"
FT   CDS_pept        complement(497893..499512)
FT                   /codon_start=1
FT                   /gene_family="HOG000184862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751532"
FT                   /orf_name="AFUA_2G02000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87297.1"
FT                   /db_xref="HOGENOM:HBG052493"
FT                   /db_xref="UniParc:UPI000051F1BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF8"
FT                   /transl_table=1
FT                   /translation="MPESSAVLPTHIQSIRRSATLPTKLHPRKQPSSEFLRTAASENDL
FT                   LFHPSAKIVHFSPRALAPIPSSTAPADFDYPVDTIETLPWRSATERTVACAPLRLEKVH
FT                   GLTVFLKCGSVVHAILKNSQCWCVDGESTFVLRIRPLTYYRIELPNETEEDKKLVVAMK
FT                   EALSKVLRYEVTPCPFKRGFTVEIPEEAKAPRRKRAWRPKGRRESAPVRSMSLLENTPA
FT                   AEDLTLLNASAGEDTDGNTTDDSGFTTKDSNSTILETVPDVEEEAPSSVTVPGELPLPT
FT                   TSVAETQQSFETLLARFEEASDLQVDPDMSYSSSIESFHSIEIPPSPASEIHSPLTTAS
FT                   PLSVACRDKMPDQQEFLAEDMAFHLADSSEKKIPSAAERINSTDSQAETSPMNQSSGSN
FT                   STSFLDIPSNAETDHAKNLSDMSIEFRRRSRASREREISPMPPPSILVSSSPPEKQDAS
FT                   SFIQKTATLVLVPPVQLFILLIHIAAKIVLGPALNSAMGDFSRRLEYHATNSQEAVDDY
FT                   DIPIAPDRRTATGSDVTKKVDP"
FT   CDS_pept        join(500089..500146,500291..500397,500457..500629,
FT                   500680..501073,501124..501492)
FT                   /codon_start=1
FT                   /gene_family="HOG000184851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266210"
FT                   /orf_name="AFUA_2G02010"
FT                   /product="Transmembrane protein UsgS "
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87298.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="HOGENOM:HBG052494"
FT                   /db_xref="HOGENOM:HBG332741"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI000051E397"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF7"
FT                   /transl_table=1
FT                   /translation="MSNFEPNAIIRGFQLTVVGTVRALRNPELFKYDHFRQAALAIAVG
FT                   VIIHLIIQIPIVGVKLLLWIASWFSDLDRSSWDEFILNGLDFLNNSVLQIPFLLMTLMR
FT                   YVTPTLDEIFMESLKWVDSTYVQKHKADDPKTLRAMYYPHLAMYSTKGATGVSKPIPEA
FT                   IILFLRRYGRKFGTLLGLYLISLLPVVGRFVMPTASFYTFQSSVGTTPAAVIFGTGLVL
FT                   PKRFIVRFLHTYFASRSLMRELLEPYFCRIHFTPEQKRRWFMDRQGVLFGFAFAFTVVL
FT                   KAPYIGVLMYGVAQASTAYLITKCTDPPPSPAESEGFAESQVTWKNKHDFLRLSLDNLD
FT                   KLNLPLQSEGEVQETKVPQSPGRKFS"
FT   CDS_pept        join(502083..502157,502209..502227,502290..502578,
FT                   502639..502912,502970..503548)
FT                   /codon_start=1
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751533"
FT                   /orf_name="AFUA_2G02020"
FT                   /product="Formamidase FmdS"
FT                   /EC_number="3.5.1.49"
FT                   /function="formamidase activity"
FT                   /protein_id="EAL87299.1"
FT                   /db_xref="GO:0004328"
FT                   /db_xref="HOGENOM:HBG300311"
FT                   /db_xref="HOGENOM:HBG552286"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI000051E5E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF6"
FT                   /transl_table=1
FT                   /translation="MGVKGIRTALKVDLDKPAWEQSGLHNRWHPDVPAYGKIANNEVVK
FT                   IECLDWTGGQIKNNDSADDIKNVDLTQIHYLSGPFEIETAEPGDVLLVEIQDVQPFEDQ
FT                   PWGFTGIFSRHNGGGFLDEIYPEPAKAIWDFEGIFCSSRHIPHVRFAGLIHPGILGCAP
FT                   SAEVLAEWNRREGELIATNTRGRDVAKPPEPKNVHAGSADEDLKAKIGREGARTIPGRP
FT                   EHGGNCDIKNLSRGSKVYLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGVITLKFT
FT                   VIKDGMAKMGMKSPIFHPGPVEPQFGPGRYLTFEGFSVDEHGKQHYLDATVAYRQTCLR
FT                   VIEYLRRYGYNDYQIYLLLSCAPVQGHIAGLVDIPNACTTLGVPMDIFDFDIRPEAEVV
FT                   KMDMGSCAFASK"
FT   CDS_pept        join(complement(505015..505207),complement(503811..504955))
FT                   /codon_start=1
FT                   /gene_family="HOG000169862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903597"
FT                   /orf_name="AFUA_2G02030"
FT                   /product="Fructosyl amine:oxygen oxidoreductase "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL87300.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG253316"
FT                   /db_xref="HOGENOM:HBG326153"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000051FDD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF5"
FT                   /transl_table=1
FT                   /translation="MAPSILSTESSIIVIGAGTWGCSTALHLARRGYKDVTVLDPHPVP
FT                   SPIAAGNDINKIMEHSELKDGSSDPRSAAFSTFTRAALKAWKTDPVFQPYFHETGFIIS
FT                   GHTPALIDHIRKDEVEPSETNFVKLETAEDFRRTMPPGVLTGDFPGWKGWLHKSGAGWI
FT                   HAKKAMISAFNEAKRLGVRFVTGSPEGNVVSLVYEDGDVVGARTADGRVHKAHRTILSA
FT                   GAGSDSLLDFKKQLRPTAWTLCHIQMGPEEVKQYRNLPVLFNIAKGFFIEPDEDKLELK
FT                   ICDEHPGYCNFLPDPNRPGQEKSVPFAKHQIPLEAEARARDFLHDTMPHLADRPLSFAR
FT                   ICWDADTPDRAFLIDRHPEHPSLLVAVGGSGNGAMQMPTIGGFIADALESKLQKEVKDI
FT                   VRWRPETAVDRDWRATQNRFGGPDRIMDFQQVGEDQWTKIGESRGP"
FT   CDS_pept        join(506034..506045,506161..506229,506295..506321,
FT                   506374..506736,506796..506951,507007..507473,
FT                   507540..507798,507874..508119)
FT                   /codon_start=1
FT                   /gene_family="HOG000216917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903598"
FT                   /orf_name="AFUA_2G02040"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87301.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058861"
FT                   /db_xref="HOGENOM:HBG331150"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F1CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF4"
FT                   /transl_table=1
FT                   /translation="MPVKELYTWSMVIISSFERIHGDQLIFPSSSPADPLNWSRSKKYW
FT                   SLFLISAYACVNSFGENNWGAAWTTIAKETGVTLENMNGGSALNYLLLGFFNVIWIPTA
FT                   MKLGRKIVYILSLLFVLGSGIWGRFFEGTAQYYVMLAIGGIGTAAYQALIQLTIFDLFF
FT                   SHERGSMVAIYIFFQQLGSILGLILGGYITDGIGWRWSQPIVAIACGILILLFIFTFDD
FT                   TMFPRYRFRNSGFSAAKIETCTTQEDAQVTSEKDQKLEPSTSVAVSQGAGEVDIPPRTY
FT                   RQKIALIHYLEDDQTTWYQYFRRPFFLFAFPNIVLAGIQFAFGCTAGIISFNTISEIMT
FT                   EPPYNWSAGSVGLLFLAALVGNFIGMGIGSFSDWIVLFLARRNKGYKEPEMRLWAYILP
FT                   IILAAIGYFTYGWGATAGDHWISIAVGLCCMIAQQVSATSIATAYAMECFDRISGELVI
FT                   VLAICSSCINFAISFSVQHFIDATNYGWTLTFFGIWVLLSMLMAGPMLIWGKSWRRRCK
FT                   GRYEKFLAETGRSVL"
FT   CDS_pept        join(complement(509971..509986),complement(509819..509898),
FT                   complement(509755..509764),complement(509617..509703),
FT                   complement(508618..509558))
FT                   /codon_start=1
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208188"
FT                   /gene_name="cpr6"
FT                   /orf_name="AFUA_2G02050"
FT                   /product="Peptidyl-prolyl cis-trans isomerase D "
FT                   /EC_number="5.2.1.8"
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87302.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI000051ECC8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WIF3"
FT                   /transl_table=1
FT                   /translation="MAETQRRPRVYFDIQIGSQKAGRIALELVRLPFNDVVPKTAENFR
FT                   ALCTGEKGVGKQRKPLSYKGSIFHRVIKQFMIQGGDFTNFNGTGGESIYGEKFPDENFE
FT                   LKHDRPFLLSMANSGPGTNGSQFFITTVPTPHLDGKHVVFGEVINGKSIVRKIENMPTQ
FT                   ADKPTTDVTIVDCGELSGEDYENATKQVADATGDPYEDYPDDHQGEELNAQVCFKIASE
FT                   LKNFGNTAFKSGDVALGLDKYQKGLRYLNEFPDPDENDPKDLEPQMKSLRFTLHSNSSL
FT                   LANKLGQYKNAQNWATYALEVADAANAKEADRAKAYYRRAVAYSGQKEEDEALKDLQEA
FT                   LKLAPGDAGILNEIAKVKKAIKDSEAKEKAAARKFFS"
FT   CDS_pept        join(complement(511206..511212),complement(510978..511159),
FT                   complement(510873..510915),complement(510592..510818),
FT                   complement(510380..510514))
FT                   /codon_start=1
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266211"
FT                   /orf_name="AFUA_2G02060"
FT                   /product="Aminoacyl-tRNA hydrolase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87303.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="HOGENOM:HBG269319"
FT                   /db_xref="HOGENOM:HBG286048"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI000051F1AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF2"
FT                   /transl_table=1
FT                   /translation="MKVAVIQRVKSASVTVDEKLVSSIGRGLLVLAGVGKEDTEKDADT
FT                   LIQRVLKAKLWPAEEGGQWKRNVQDIEGEVLCVSQFTLYGQLKKGSKPDFHDAADAETA
FT                   RKLYEYFFRRLGEAYKPDRVKNGVFQAMMDVELKNDGPVGVDYRSEDAAVTIEINTKLA
FT                   KEKKPAEGQNKPQGERKDGETQTIEFELPASLLE"
FT   CDS_pept        join(511840..512094,512166..513712,513786..513846)
FT                   /codon_start=1
FT                   /gene_family="HOG000184850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266212"
FT                   /orf_name="AFUA_2G02070"
FT                   /product="CCR4-NOT transcription complex, subunit 3 "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87304.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG181557"
FT                   /db_xref="HOGENOM:HBG395803"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI000051E398"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF1"
FT                   /transl_table=1
FT                   /translation="MTSRKTQQEIDKTFKKVAEGIQTFEGIYEKIRSTSNPTQRDKLEE
FT                   NLKREIKKLQRFRDQIKSWASGNEVKDKGPLLEQRRAIETCMEQFKAVEKEMKTKAYSK
FT                   EGLSAASRLDPKEKEKLEACDFLSTCVDELQLKIEAMEAEEETLHVQMKKGKKDITKTN
FT                   RLSDLSRILERHKWHVNKLELLLRALQNGAVETSQVMDLKESIKYYVDDGHNVDYCGED
FT                   ETLYDDLNLGEDTEAQFGMIGDNDRVSSQDTQSIQEDEPEVKAKSSKADASGLRRPSAQ
FT                   MKSPLPVLATLHPPTSTNATSGMKPAPPPTRPPGETLKYASAAAAAAASDKNGVGIAPL
FT                   PPPPGTSPAYTAAIPVSRASSTASPVVSSVQPVSKAAATATEEPGGHGRSKTPALNPSA
FT                   TATPAAASASNTMPSTPATDKANTTAAKEQSATANGETAKEDEQRDESIYHLPPGLQDL
FT                   IQSFEITKSRATNSASSSSPSVQRLLAASLATCPEPADAEKPRHYRPSNPYNTPLYYPQ
FT                   EPLAIFDDPRLYDTGRIDTDTLFYLFYYRQGSYQQYLAAKALKNQSWRFHKQYQTWFQR
FT                   HEEPKNITEDYEQGTYRFFDYESTWMNRRKADFKFIYKYLEDEL"
FT   CDS_pept        join(516262..516306,516364..516695,516765..517008)
FT                   /codon_start=1
FT                   /gene_family="HOG000184829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056880"
FT                   /orf_name="AFUA_2G02080"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87305.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052495"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051FDE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIF0"
FT                   /transl_table=1
FT                   /translation="MYSQMNDRLYPRFTVNSSRPSSTPMEPSSSPHSAQSFSFADVFPG
FT                   GNELEIPLGHPFDSVYEFSPPSPYNATTIPDLYALNTSYSVPIPSYSSSYETQFAFTPS
FT                   FEDSLLAQYSLSTSASSSDSPKLSKPYACEDCGKAFTRSADLKRHQSSVHYPVYQDCPV
FT                   EDCPRKDRNGFPRRDHLIEHLRSSHHMDLPKRRMTKRVSKASA"
FT   CDS_pept        complement(520334..520786)
FT                   /codon_start=1
FT                   /gene_family="HOG000048347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266213"
FT                   /orf_name="AFUA_2G02090"
FT                   /product="Methylated-DNA-protein-cysteine methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /function="methylated-DNA-[protein]-cysteine S-
FT                   methyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="EAL87306.1"
FT                   /db_xref="GO:0003908"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG052498"
FT                   /db_xref="HOGENOM:HBG752398"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniParc:UPI000051F901"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE9"
FT                   /transl_table=1
FT                   /translation="MRTKQSPSKPTPTPPSSQECISLSPQTKKFLHRISLHPTLTPYRR
FT                   RVYRTLLSVPKGRWTTYSALATHLGSSARAVGNAMRTNPFAPEVPCHRVLATNGTLGGY
FT                   KGEWILGGKYQVEKRLLLEAEGVVFDERGRAQGECFRGFVDLGSGK"
FT   CDS_pept        join(complement(523175..523316),complement(523003..523079),
FT                   complement(522407..522889),complement(521496..522335))
FT                   /codon_start=1
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056881"
FT                   /orf_name="AFUA_2G02100"
FT                   /product="Dihydrolipoamide dehydrogenase "
FT                   /EC_number="1.8.1.4"
FT                   /function="dihydrolipoyl dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87307.1"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316802"
FT                   /db_xref="HOGENOM:HBG515043"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI0000520241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE8"
FT                   /transl_table=1
FT                   /translation="MFRSMMPRATPRAALRTSGPQTIPSSFVAAPSLSVYGRFRRGYAS
FT                   ETEHDVVIIGGGVAGYVAAIKAGQEGLKTACIEKRGRLGGTCLNVGCIPSKSLLNNSHL
FT                   YHQILHDTKKRGIEVGDVKLNLEQMMKAKDTSVEGLTKGIEFLFKKNGVDYIKGTGAFV
FT                   DEHTVKVNLLDGGEQTLRGKNIVIATGSEATPFPGLNIDEKRIITSTGALSLKEVPKKM
FT                   VVIGGGIIGLEMASVWSRLGADVTVVEFLGQIGGPGMDADIAKQAQKILQKQGIKFKTN
FT                   TKVTKGDDSGATVKLSIEAAKGGKEETLDADVVLVAIGRRPYTEGLGLENIGIDKDERG
FT                   RLVIDQEYRTKIPHIRVIGDCTFGPMLAHKAEEEAVAAVEYIKKGHGHVNYAAIPSVMY
FT                   THPEVAWVGQNEAEVKAAGIKYRVGTFPFSANSRAKTNLDTEGQVKFIADAETDRILGV
FT                   HIIGPNAGEMIAEATLAVEYGASCEDIARTCHAHPTLAEAFKEAAMATYSKAIHF"
FT   CDS_pept        join(525726..526152,526209..526399,526485..526812,
FT                   526875..526957,527011..527239,527294..527391,5
FT                   27444..527767)
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266214"
FT                   /orf_name="AFUA_2G02110"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87308.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG052499"
FT                   /db_xref="HOGENOM:HBG324430"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FDCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE7"
FT                   /transl_table=1
FT                   /translation="MEYRTQAGEKEAPDRDQLCCCSVNPLLWLVCRIASLMLLLIRYSG
FT                   YDQGMMGGVNNAKDYIDLMGFGYTEMKDGQPTPVVTNSLLQGGIVSVYYLGTLCGCLLG
FT                   GWIGDSIGRIKTIASGAVWAIFGAALQCSAQNHNWMICARFINGIGTGILNAIVPVWAT
FT                   ETAEHTSRGQFIAIEFTLNIFGVVLAYWLELWVPFSSPTSSEEIIFLIVLFAAVWFFPE
FT                   SPRWLVKVGREQEARYILGRLRGSSGDDAVRAEAEFRDIQSVAELEKTINHSNSYLSML
FT                   FGYKSGKLHLGRRVQLVIWLQIMQEWVGIAGVTVYAPTIFSIAGFDSMKSQWISGLNNI
FT                   FYMFATLICVFTLDRIGRRWTLYWGSVAQGIAMFLAGGFSRLAINAREAGDASKASSYG
FT                   AAAASMIFIFTSVFGATWLTVPWIYPAEIFPLAVRARGNAWGVVGWSIGNGWLTLLCPV
FT                   MFSSIGEKTLYIFAISNVITIPMVWALYPESNQRTLEDMDLLFAAETPWVWDAERTFAR
FT                   LKAENPGYIETAGRKNSLLDSEAGVGKPAAQTTQHEENVSSE"
FT   CDS_pept        join(complement(531564..531842),complement(531426..531470),
FT                   complement(531279..531357),complement(530889..531208),
FT                   complement(530509..530751),complement(530168..530457),
FT                   complement(529425..530101),complement(529212..529372))
FT                   /codon_start=1
FT                   /gene_family="HOG000268676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208189"
FT                   /orf_name="AFUA_2G02120"
FT                   /product="Phosphoglucomutase, putative "
FT                   /EC_number="5.4.2.8"
FT                   /function="phosphomannomutase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87309.1"
FT                   /db_xref="GO:0004615"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG193285"
FT                   /db_xref="HOGENOM:HBG571743"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniParc:UPI000051F1AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE6"
FT                   /transl_table=1
FT                   /translation="MKVQSGNLGIGLRRSGAGSGDSGLLKHAQSGDKTSPTEAHETCSI
FT                   ALAIIIPPMIHPFHSSSKATISHRPITLSFLSIRSVYSVHIHHRMIHHEPLSLLVQKWL
FT                   EWDRNPETRAEIEQLQKAGATAELELRLRQRIQFGTAGLRGRMAAGFSCMNSLTVIQAS
FT                   QGLAKYIRDKHSDIAPNGVVIGHDARHNSAKFAALAANAFIAMGIPVWYYSKPTLTPSV
FT                   PFGVTHVRAAAGVMITASHVTKCSAHASLIQMDDADWWTRYFKNGAQINTPMDVEIAQS
FT                   IDNNLEPWPNAWDSLEATAYLHAEALQTILPRYTEAVWNYAKSTVPSWSSPRPFMYTPL
FT                   HGVGGLIFPELCRSVGITDFAAVTEQVEPNPDFPTVAFPNPEENGSLDLAMQSADKEGK
FT                   TLIIANDPDADRFAAAEKVDGSWFTFTGNHLGVLLASHLFDSLEGRNDKSRIAVLNSAV
FT                   STGMLEKMARSKGFHFEETLTGFKWMGNIARRLEESGYHVPFAFEEALGYMFPDVCHDK
FT                   DGVTAAMVFLAAEARWRSQGLTPYSKLQQLFKDFGYFETLNNYFRSPSPEITKSLFGAI
FT                   RNGPYRTQKSLGSFKILRWRDMTEGYDSGAEDQKPALPIDKSSQMLTIWLDRDVRFTIR
FT                   GSGTEPKVKVYIESCSASHAQAVDAVCDTFRTVLKEWIRPFAPSMSYSKNLPTSSGHIL
FT                   NID"
FT   CDS_pept        join(531972..532192,532257..533733)
FT                   /codon_start=1
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903599"
FT                   /orf_name="AFUA_2G02130"
FT                   /product="Fatty acid desaturase, putative "
FT                   /EC_number="1.14.99.-"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with oxidation of a pair of donors resulting in the
FT                   reduction of molecular oxygen to two molecules of water "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87310.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016717"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052500"
FT                   /db_xref="HOGENOM:HBG325617"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniParc:UPI000051EA90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE5"
FT                   /transl_table=1
FT                   /translation="MAQTQEAARTPGFRARKDAILSRRYIEGQIADGKHIIIFDDRVLK
FT                   VDAWIKFHPGGDKSIKHMVGRDATDEINALHSSEARQRMLSFQIGRIQGPWLNFLPPIQ
FT                   GGKFRPYPGETCSSDEDSTDQDISQPPSPVFDAADAGDKAPRVRRRRKSATISDTSVST
FT                   TPTEGFEPKPFFLDARTQEEIIFDVAKYPSLDTANQEEIKRKYRELNERIRAEGLYNCN
FT                   YFSYFIECCRYTLLATLSYTFLRLGWYGISAFLLGCFWHQLVFTAHDAGHMGITHYFHV
FT                   DSVIGIIIADYLGGLSLGWWKRNHNVHHIVTNAPEHDPDIEHMPFFAISHRFLTSLRST
FT                   YYDRIMHFDAMANFMLRYQNYLYYPILLFGRFNLYRLSWEYLFCGQAPKKGPAWWHRWF
FT                   EIGGQVFFWYWFGYGVLYRSIPNWSSRIAYILVSHMVTAPLHVQITLSHFAMSTADLGA
FT                   QESFPQKMLRTTMDVDCPTWLDFFHGGLQFQAIHHLYPRIPRHNLRRTQKLVIDFCRDT
FT                   GIPYAVFTFYDGNKKVIGKLGDVAKQVRILEECRKSCAEQGVFSDHHH"
FT   CDS_pept        complement(534147..536261)
FT                   /codon_start=1
FT                   /gene_family="HOG000184807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056882"
FT                   /orf_name="AFUA_2G02140"
FT                   /product="CUE domain protein, putative "
FT                   /protein_id="EAL87311.1"
FT                   /db_xref="HOGENOM:HBG052501"
FT                   /db_xref="HOGENOM:HBG333975"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI000051EA91"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE4"
FT                   /transl_table=1
FT                   /translation="MSGAIMEKLPPLAPVPPPAVQRSISHEEWESFLDAWILLLGIRIE
FT                   ASDSVFKEVVSKDEYTRGFLSSFYQQLATTNAPELRTGTKARTLRKCCFLLTRRLLLEA
FT                   PTSPSEMLEWNFLGAMCCCYPSSSALKRLLSETWGRHHEAITSSLEKAKSIVIKRLSVP
FT                   NPSGNLEVTSDIRLLTILCSALPPCGQVLMAGSDFIDTLSDAYQSERRVDFHKVLVANV
FT                   YVGLTSLLKGAKPNLSLLLDQLFGLKASAGVGTPTAKREPTILSDLICSSDLLARLERY
FT                   LNMHPQKRGEDLLSSLRSYRDESKAFHHRYQKQRKKTDKGKGRVLDLPTAENMHVHKMS
FT                   LVTQVQDLFPDLGSGYIVRLLDHYGDNPEAVVAHLLDDSLPPELQELDQSEQLPVSETS
FT                   PRHDPLPPHATPPEIPSPAAPAPRKNIFDNDVDLAELARSADQARQGKLHFGRRDSDLT
FT                   ADTILADRSQHAVNKAAIMSALAAFDSDDDEHDDTYDVADVGGTVDGLTAVTDAEADAD
FT                   IRNRRAEDLDMTLFQAYKANPALFARDSATRRSQPRASLKRETGMTDEAIEGWSVMLAR
FT                   DPKRLAKLEDRFTMLAGAPGGALAQPELPSTAYRKPGPREDGESDSDTDQPSSASGGRG
FT                   GPRRGGGRGGRRGGGGGRARRGGTNAGASGDQNPTVARQRKEENKASRANHNRRQQRAR
FT                   KIARGGGMPG"
FT   CDS_pept        join(536724..536765,536861..537084,537142..537226)
FT                   /codon_start=1
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903600"
FT                   /orf_name="AFUA_2G02150"
FT                   /product="40S ribosomal protein S10a "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="EAL87312.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG236852"
FT                   /db_xref="HOGENOM:HBG317444"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI0000520245"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE3"
FT                   /transl_table=1
FT                   /translation="MSFQKPEKEFGEGPKVHKIRITLTSRKVASLEKVCSELIDRARSK
FT                   SLQVKGPVRLPTKTLHISTRKTPCGEGSKTWDKYEMRIHKRLIDLLAPTETVKQIIINI
FT                   EAGVEVEVTIAA"
FT   CDS_pept        join(complement(539557..539602),complement(539413..539499),
FT                   complement(539117..539150),complement(537633..539064))
FT                   /codon_start=1
FT                   /gene_family="HOG000184796" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266215"
FT                   /orf_name="AFUA_2G02160"
FT                   /product="CCCH zinc finger domain protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EBA27307.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG324011"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000F51837"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V0"
FT                   /transl_table=1
FT                   /translation="MVVCTFFQQGRCKFGERCKFEHPGQQTVGSSNRFGALAPGGGFGG
FT                   RSAPQAQQPVNYGITAEDIKADLTAGKGLPEWIFSAYGPGRNAPRQLFGGPQREQSFEE
FT                   LRLRHYEAAAAGNIEVAVQEAQALYAESIKQMEAALNDVNGAVKFILDGINEHPNRIDI
FT                   TEGKAGPASGQGPSPFGQPAAVAQTSAFGQPSALGGAGAPAFGKPAGFGQPSAFGQPST
FT                   LGQTPGFGQPSALGQSTPFGKPSALGQPAFGKPAFGQPSFGQPAFGQPSAPGTGTGPFG
FT                   QPSTTSPFGQISSQNQGQGGGFAQAAGATTTSPFAQAAGGQQPAAPTGFGQTSTTTQTS
FT                   ATPFGRPVQAPSPFGQPQAPTAPFGQPAAAPSPFGAAAQQATPSPFNQPTGGFGQAAQA
FT                   APTTSASKPITDNGPPPTIKIDDPNELNPIPPLSGQTVKDPMTQRLSMWKGQPVKYIDN
FT                   VPCYLHPQDRQTYVRIFFPDGPPDQASLRDAHGKPEEYTPEVTEQYEFFLKNGYFKDGV
FT                   IPSVPPKSEWVSFDF"
FT   CDS_pept        join(complement(541099..541339),complement(540798..541027),
FT                   complement(540166..540738))
FT                   /codon_start=1
FT                   /gene_family="HOG000184785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266216"
FT                   /orf_name="AFUA_2G02165"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27308.1"
FT                   /db_xref="HOGENOM:HBG324012"
FT                   /db_xref="UniParc:UPI0000F5182B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U6"
FT                   /transl_table=1
FT                   /translation="MTPSAKSPIRAEDQQRANSVTVTHPGAIIMGTWEDFDSIFYFNKS
FT                   FNYDDKVIEQILSNRRALGNQLFADRLLGLLGVQAVKQLYPPRSNADLRALVNHIVSSA
FT                   LDIHHKQALIYYILKDCRAASDAASQFARRCHLPEKYRLFIEGLWNLDRLELRRAIEYL
FT                   TEPSIIPTFPDEILYVLTLPQLPKHDDNLAMAYYLTVTPPLASEKVQKAFFEILCRSSI
FT                   TEAFYFTRKRDESLRRAYLEQLIEFVLKTSPGQMRSQRAMELISLPLDNTEEEWFEEAL
FT                   LRGCAKTLHGAKDTAMMRRFATGKLDALSPELESLGGKKIDGLDWDALRQSVRTAHTSV
FT                   PTASGQP"
FT   CDS_pept        join(541579..544977,545033..545785,545847..545924,
FT                   545980..546075)
FT                   /codon_start=1
FT                   /gene_family="HOG000184777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266217"
FT                   /orf_name="AFUA_2G02170"
FT                   /product="Nuclear condensin complex subunit Smc4, putative "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL87314.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG315927"
FT                   /db_xref="HOGENOM:HBG505437"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI0000F51813"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE1"
FT                   /transl_table=1
FT                   /translation="MSSSLARARPSRRSAPRRSYVIEEASESEDPGNVTPTASNHSDND
FT                   DDDEDEEEEYTPVPAKRAKSVSRRRTTNEAITPTTARKVRKTRRSTTAEQGDTLEINNK
FT                   NDEGDSVVPKEEEPESPLQNAAAALKRKSMAHPRKSRVSSTLHPEKSSLPTPGPSVSPE
FT                   PEPRSQRGSVPPLADITESVVNQTPAKPSDDPKSQISIINPNSTILERPMDIVMKSRNL
FT                   APSVPEEPSGPKPRLIITHLVLTNFKSYAGKQIVGPFHASFSSVVGPNGSGKSNVIDSL
FT                   LFVFGFRASKMRQGKISALIHNSANFPNLPFCEVEVHFQEILDLPGGEHEVVPDSQLMI
FT                   SRKAFKNNTSKYYMNGKETNFTAVTTLLRERGIDLDHKRFLILQGEVESIAQMKPKAAN
FT                   EHEDGLLEYLEDIIGTSKYKAPIEEAAAELEQLNEVCVEKNNRVQHVEKEKTALEDKKN
FT                   KALAYIQDENELAQKQSALYQIYIDECADNIRVTQEAILQMQELLNMELEKHEGNESGI
FT                   KELEKAYKRGMREYETMEKELQGLMKEMAKYDKESVKFEEKKKFLLGKQKKLEKSMQAA
FT                   RLAASECESLVQKHTDDINKKTAETAKLEEEMKAEEEELSTIREGLKGKTQGLSEQIAA
FT                   KQKSLEPWDERINKKLSAIAVAQSELDILRERSNAGAVQLEEAQSKVTSIEETLATKQT
FT                   DLEERKAQKATLEEEVASLKRDLKKFTSRETEVRAHVSSARQKAEEARASLASTQNRGS
FT                   VLAGLMRLKESGRIDGFHGRLGNLGTIDEKYDVAISTACPALDNMVVDTVEVGQQCIDY
FT                   LRKNNLGRANFILLDRLPRRDMSPIFTPESVPRLFDLVKPKDPKFAPAFYSVMQNTLVA
FT                   KDLEQANRIAYGARRWRVVTLDGQLIDVSGTMSGGGTRVARGGMSSKQVAEVSREQVSK
FT                   LESDLEEMERKFQNFQNKQKHVEAAIREKSEEIPRVETKIQKIMIEIESANRSLADAQR
FT                   RVKELSVAHKPSKADANQAEQLEAQIAALEEEIEDLRAQKGGIEEEIQTLQNKIMEVGG
FT                   VRLRSQKAKVDGLKEQISLLAEEISNAEIGKSKNEKLIMKHQKARAEAERELEQVAEGL
FT                   EKLNADVENQANDASGWKQGVEEAQEALETKKGELKTLKQELDEKVAELNETRATEIEM
FT                   RNKLEENQKALTENEKRQRYWSEKLSKLTLQNVSDLGEEQQPTELQMYTKDELSEMNKE
FT                   SLKAVIAALEEKTQNASVDLSVIEEYRRRAAEYESRAADLATALASRDSAKARLDGLRS
FT                   ARLNGFMEGFGIISLRLKEMYQMITMGGNAELELVDSLDPFSEGILFSVMPPKKSWKNI
FT                   GNLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVASYIRERTKNAQFI
FT                   VISLRNNMFELASRLVGVYKVSHMTKSVTIENKDYITGR"
FT   CDS_pept        complement(547176..548588)
FT                   /codon_start=1
FT                   /gene_family="HOG000184756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266218"
FT                   /orf_name="AFUA_2G02180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87315.1"
FT                   /db_xref="HOGENOM:HBG052503"
FT                   /db_xref="HOGENOM:HBG332798"
FT                   /db_xref="InterPro:IPR021713"
FT                   /db_xref="UniParc:UPI000051F1BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIE0"
FT                   /transl_table=1
FT                   /translation="MEAFSVRKDSVLTMPLYQLSLTHFCEVHGPTSIICSQVLPFSCSQ
FT                   CYPETSDFSPDDTPATSHDTQSSHGMRNRLGDARDTKATKRPDASGATVGKSPKIEDSP
FT                   YFLKNQPNSSEPSKLNILGGADGDTCASCSLTLPDDVSRQLPPGAPGTASRDGKGRNSS
FT                   PVLRSREVVYSCGTSHSDGDDSAHDLHGHASLPDSIHSSSVASDASCHTHILTYLSLRG
FT                   PPNPSDYALLRRSSIRTLSCELLPRGLSSGPLCFGDATAGYTIAYVFRLPDPMARGKRR
FT                   SYALVALAGKDAGRAFRACPVIWRAFGRIATGIVNSAEKYQEEEAKRLEEQNDAANRAN
FT                   NRHYTPVSSFLTGRRVDPDGQPRRLGQIRARNLSEIVGNQYIFAEIHAHFVALLQQLGS
FT                   MFGAVPISEERFICSTLGDDVDVKSRRGTSIDNGKDSTSKGKSESDLGLSGLDLSSGPK
FT                   PIPIAARRTVIA"
FT   CDS_pept        join(complement(557287..557320),complement(556802..557216),
FT                   complement(556604..556751),complement(556263..556574),
FT                   complement(554571..556208))
FT                   /codon_start=1
FT                   /gene_family="HOG000048349" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056883"
FT                   /gene_name="grc3"
FT                   /orf_name="AFUA_2G02190"
FT                   /product="Polynucleotide 5'-hydroxyl-kinase grc3 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="polynucleotide 5'-hydroxyl-kinase activity "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EBA27309.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0051731"
FT                   /db_xref="HOGENOM:HBG052505"
FT                   /db_xref="HOGENOM:HBG324013"
FT                   /db_xref="UniParc:UPI0000F51821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WID9"
FT                   /transl_table=1
FT                   /translation="MKRKAEKQQATAPVSAFAARKARQQQARLLEPEKTAQNEPAVEPP
FT                   SKRARRSPEEGAARQAANENDRVQTRRSARTKAETLSSAELAEKQPQESAAAARAQTAE
FT                   RTPPPEKGDADTFDAAEEEEEEEKEEDILERENGVGVIAVEDDAEGYESPADDVPQVQN
FT                   FPLSKTRLNKSNIVSSDERTLCVRIKEKMVRNGMRHTLVLLGHYDLWVKRGVISLMGAK
FT                   LHPSPRLYRVYAPSTHSLPVIKCVAGVDGESEIEVKSCNSGIYRLRHLSPLYQRIWNGK
FT                   HTAADKLTLKKVSASTKRTFSVLYTSSDDSWNRHLRPLHLEKQWSSAIRSLSQRGGRLK
FT                   VLICGPKASGKSTFSRYLLNHLLSPAPQTENNHRNTDGVAFLDLDPGQPEFCPMGQVYL
FT                   AHLRSPFFGPPFTHPSLAESQDGSIIRSHHIGAISPKEDPDHYVLAAMDLMDRYRALLA
FT                   SYPQCPLIINYPGWIFGLGLEVATWLVKSLGLSDVVYMSEKGPAEVVEPLGHAAQEARV
FT                   PLTTLPSQPTDFVSRSSAQLRSMQVQSYFHMSHPSEIHNPQWLDTTMSRTRPLVVDYAG
FT                   PRQGIRGIMVMGSQISPNLLHEALDGALVGVVAVESPNAIMGQADAAGFSGSSHGDATQ
FT                   GAEDLSSAASDIDMNDVTDACHGDVAPTSSSSFESMIIRTPNEDLPYLFVGSGSCNPLD
FT                   PKASNCLGLALVRSIDVPSRKLELITPIPASKLRDALEQGHGIVLVRGMLDNPSWAISE
FT                   DYYAARAAERRHQELVAKARKETNTRDGQDAAVDADTQGMVSALLKDRIRRASNVPWMT
FT                   VIEDNSRRHREAAQRKKSLWKLRKKAYPGSESETDW"
FT   CDS_pept        join(557698..557873,557929..558664)
FT                   /codon_start=1
FT                   /gene_family="HOG000184745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903601"
FT                   /orf_name="AFUA_2G02210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87318.1"
FT                   /db_xref="HOGENOM:HBG052507"
FT                   /db_xref="InterPro:IPR013240"
FT                   /db_xref="UniParc:UPI0000520258"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID7"
FT                   /transl_table=1
FT                   /translation="MAPAKSIKKTSSGSSSISSSRSTSPEPTTKSKSDRETEDSASSDS
FT                   ESVPSSPEIKASNISSSNDSLYPKPSYKPPSGFKAAKKQLPPSSTTSSLLSDLRGKQLF
FT                   HITAPSFLPLSKVKEVSLAKILQGEPILEHEGVQYGIPSENIGHGDLGGKSLLLYDSKT
FT                   QTYYSAPATTMPTYHVQQLIDLPKSLGTEDAVLAAAQDQIKPPRKQPKHLKMRFRPVGS
FT                   EEGPPETIGSSSEESEGEGKPNSKFPRESKTEREERKRKHAEEVEGSQSAGLPRKKTKK
FT                   QTVDTSQSSKKRDEKKRKKEKA"
FT   CDS_pept        join(559873..563832,563894..564199)
FT                   /codon_start=1
FT                   /gene_family="HOG000034145" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266219"
FT                   /gene_name="atg26"
FT                   /orf_name="AFUA_2G02220"
FT                   /product="Sterol 3-beta-glucosyltransferase "
FT                   /EC_number="2.4.1.173"
FT                   /function="sterol 3-beta-glucosyltransferase activity "
FT                   /biological_process="autophagy"
FT                   /biological_process="lipid glycosylation"
FT                   /biological_process="protein transport"
FT                   /biological_process="sterol biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87319.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="GO:0016906"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG052508"
FT                   /db_xref="HOGENOM:HBG332791"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000051FB90"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WID6"
FT                   /transl_table=1
FT                   /translation="MRPFLDDAKRRVDRKLSARRQSLSASRFLPSALPDRLKDNHDAQV
FT                   DFTAPPGGSGSREGHLQYMQQSIFGMIAAVGSRSDFHARFDESSDSDGETGQRPRKESS
FT                   VRKGTSVSVNTSSLDPSQRSSSQTDGNSEKDLGTRGRRHRRTISDHKLLRPFMSNSKHE
FT                   PDPSTGDEMPTVSPPSRPRSATPRAAPILSRMVEAQAQFDLKASSTERSQSSLNETGAK
FT                   GPRDASVSPLSTRLMDMFGFDKPEKVLVEYACSLLQSMLLQGYMYVTEGHICFYAYLPK
FT                   KSTVAIKSGYLHKRGRKNPKYSRYWFSLKGDVLSYYADPSNLYFPSGHVDLRYGISASL
FT                   GDPKEKGREPRDFQVTTDQRTYYFRADSAMSAKEWVKALQKVIFRTHNEGESVKISFPI
FT                   ESIIDIEESPMVDFAETFKIRVIEDDDSYAIDEVCLFTTIRLYKAHGSQYFFTFFNSGR
FT                   EAFEFLKILINDQSLKISSQHLSPQPDRSPRSDRTRKSRNRWSLTSGTSRAETQRKRSA
FT                   STSHMSLAHDIVKSSPATRHQDSSDSILNSFEQATESSAAWQSITDAAESASQILNRSD
FT                   VFQSPTIYGLDRRPSGRERRGRRNSDETARSPSTRVNVGTGQQIDELDRRTDGNTSGRE
FT                   ARDTTSESDQYTQDPTKSFSGAPSLNELVKAGVYPLQRAAGLAEYLRTRSKQMSNLLAS
FT                   ESMGYIEKVSGMWTGGRKHYGEAEDVLPDDQDVDPEDKEDGCNYGDRFRAHFALPPTEK
FT                   LQATYFAYLHRVLPLYGKIYVSQKKLCFRSLIPGTRTKMILPLRDIENVEKEKGFRFGY
FT                   HGLVIIIRGHEELFFEFRTSDARDDCAVTLHQHLEAVKFMAESGLLAEQEQNESEAAMT
FT                   EHRMLQEARYYDYGENDLRPLNESSELHPIFDDPRASIVNFKPAESLRITCLTIGSRGD
FT                   VQPYIALCKGLLAEGHRPKIATHAEFEPWVRKHGIDFAPVEGDPAELMRICVENGMFTY
FT                   SFLKEASQKFRGWIDDLLSSAWASCQDSDLLIESPSAMAGIHIAEALRIPYFRAFTMPW
FT                   SRTRAYPHAFAVPEHRMGGAYNYITYVMFDNVFWKAIAGQVNRWRKNELGLKATTLDKM
FT                   QPNKVPFLYNYSPSVVPPPLDYPDWIRITGYWFLNEGSDWTPPTALSEFIHRAREDGKK
FT                   IVYIGFGSIVVSDPSALTKTVIESVLKADVRCILSKGWSDRLGDPASAKPEVPLPSEIH
FT                   QIQAAPHDWLFSHIDAAVHHGGAGTTGASLRAGVPTIIKPFFGDQFFFGSRVEDLGVGI
FT                   CMKKLNVSVFSRALWEATHSERMIIRAQDLGARIRSEDGVATAIQAIYRDLEYAKTLAR
FT                   QRSIASSTPFSPTPSAKTAAEQDADDDVEDSEEWTFVGDDTDVEMSRRLRDRAISDADM
FT                   LPDRLLANSVPGDSGPGRN"
FT   CDS_pept        join(complement(565763..565782),complement(565415..565655),
FT                   complement(565081..565359))
FT                   /codon_start=1
FT                   /gene_family="HOG000184744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266220"
FT                   /orf_name="AFUA_2G02230"
FT                   /product="Prefoldin subunit 3, putative "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="EAL87320.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG021776"
FT                   /db_xref="HOGENOM:HBG631514"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="UniParc:UPI0000520247"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID5"
FT                   /transl_table=1
FT                   /translation="MADKKSSTVTTQTNPRGIPAAPFIDNVSDYVASRADVEPTLQRFQ
FT                   EMISKYQFMELNTQRRAAGLREKIPDIKKTLDVVRFLKMQKETNSSSTLETSFELNDTL
FT                   YARAQISPADTDEVYLWLGANVMLAYPIPEAETMLSEKLSAAEQSLANCDEDLEFLREQ
FT                   ITVRAGVQFLFLLSSD"
FT   CDS_pept        join(566156..566413,566474..567160)
FT                   /codon_start=1
FT                   /gene_family="HOG000184723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266221"
FT                   /orf_name="AFUA_2G02240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87321.1"
FT                   /db_xref="HOGENOM:HBG052509"
FT                   /db_xref="HOGENOM:HBG332790"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="UniParc:UPI000051F8F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID4"
FT                   /transl_table=1
FT                   /translation="MVLLVTTTHIISAFEAVPPSSRKELDLPDSLSIGSPISHEQVIRL
FT                   SRYSNNGANSTSPHPKPDRSLNSLLRGTRVYVPPPSKKPEPSPEYLALKARLLAAAETD
FT                   AYNRMTASTFTSSAPGQSGPSPIFSSSTPTLSALHDSKALAGDTGTKDPLTPSLVLNIF
FT                   LSVLITGFSVYWALTSFRTPDILVSSVSSLWRGQPPSKPSANRVSGGATEPVRVLVSLL
FT                   AALMVGVAEVLIYAIYLQKVDQARARERRIKERKEVVETDVVRAGPGQAGKEGVQRIDG
FT                   EQETIWGRGANGGVRRRVREKWEEKESQWNHDG"
FT   CDS_pept        join(complement(568601..569101),complement(567515..568540))
FT                   /codon_start=1
FT                   /gene_family="HOG000219146" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056884"
FT                   /orf_name="AFUA_2G02250"
FT                   /product="Allantoinase Dal1, putative "
FT                   /EC_number="3.5.2.5"
FT                   /function="allantoinase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="allantoin catabolic process "
FT                   /protein_id="EAL87322.1"
FT                   /db_xref="GO:0000256"
FT                   /db_xref="GO:0004038"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG455879"
FT                   /db_xref="HOGENOM:HBG724623"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="UniParc:UPI000051EA9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID3"
FT                   /transl_table=1
FT                   /translation="MEAPPQMPSISVVASSRAVISGRLTSATIVISRTTGKITAVFDSV
FT                   ILASEFPAGTPYTDYSPHVLLPGLVDAHVHLNEPGRTEWEGFYTGTQAAAFGGVTTVID
FT                   MPLNAIPPTTTVAGLKEKIQAAEGKCWVDVGFYGGIVPGNAGELKALVQQGVRGFKGFL
FT                   IDSGVEEFPAVSSEDIKLAMKELADEPTTLMFHAEMLPPIAASVGDAVSTSDPPAAPAG
FT                   PVEAYSTFLASRPSVFETCAVQEILSLAHLAPNLPLHIVHLSAMEVIPLLHKARTDGVK
FT                   ITAETCFHYLSLAAEEIRDGDTRHKCCPPIRSKLNQDGLWAELERHAEDGVIKTVVSDH
FT                   SPCTPDLKLLPSHIPGHHAANGEVENSGSFFSAWGGISSVGLGLPIMWTELSHRKNLTS
FT                   APDDANTKRALQDIVRWCCANTAAQVGLQNQKGDLVPGFDADICVFDDTAEWVVKPSTM
FT                   LFRNKCSPYQGRTLRGMVRETWVRGEKVFSRDDGFVAKIPTGRLLLEKRV"
FT   CDS_pept        join(complement(573724..573791),complement(573554..573669),
FT                   complement(572912..573487),complement(572428..572837))
FT                   /codon_start=1
FT                   /gene_family="HOG000184712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056885"
FT                   /orf_name="AFUA_2G02260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87323.1"
FT                   /db_xref="HOGENOM:HBG052510"
FT                   /db_xref="HOGENOM:HBG332789"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="UniParc:UPI000051E39B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID2"
FT                   /transl_table=1
FT                   /translation="MFVYRPQDLPRDPIFPADLEKLGYFINEKDQIRKIANPEQEFQFK
FT                   INRNDRWNDLQRGAMNECVRTVVSSRLRNLGLTTIRLPLTSGPKDPHVPIWASANLACA
FT                   SRVIVVFGEPIQDLGIWAYRTVGTEGVDAGSAVAFARAVLGPNCAAGFKDADTALLLAN
FT                   TGQLIWHCGSSRAVTHQTWLALPRSSAVDAPLMMTRRNKIPLNQDWQEHVACVFDEILS
FT                   ARGRLVREDAKIDIIGLSEGGLGAMRYLAAEWDAWRPYISAIALSNPLHYTHFDLVKES
FT                   PAVPSSFISFISSHCRAYVLSDKPVGVPVSGFQEHGCNCYSSGEALHTECIMPKAWKDM
FT                   LDWLAKTYADPFGGEAHLEFRELEGATSEDVVEDGDQLNGRCPYSPYAF"
FT   CDS_pept        join(complement(574804..574910),complement(574544..574715),
FT                   complement(574410..574472))
FT                   /codon_start=1
FT                   /gene_family="HOG000039864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266222"
FT                   /orf_name="AFUA_2G02270"
FT                   /product="40S ribosomal protein S14, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87324.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG393379"
FT                   /db_xref="HOGENOM:HBG742589"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="UniParc:UPI000051E860"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID1"
FT                   /transl_table=1
FT                   /translation="MSHFRSKRLDLSGFINARVIRDHTKRKVFEQYEPERQALRYIIRN
FT                   TTLPQRVRAQAQLQLSQMHAYTRPTQIKNRCVAGGIARSVIRDFRIARYQFRQQALNGE
FT                   LPGVKKASW"
FT   CDS_pept        join(complement(576101..576137),complement(576001..576030),
FT                   complement(575836..575886),complement(575656..575711))
FT                   /codon_start=1
FT                   /gene_family="HOG000184701" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266223"
FT                   /orf_name="AFUA_2G02275"
FT                   /product="Mitochondrial F1F0 ATP synthase subunit Atp18,
FT                   putative"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="EBA27310.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG398405"
FT                   /db_xref="InterPro:IPR006995"
FT                   /db_xref="UniParc:UPI0000EA623F"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U8"
FT                   /transl_table=1
FT                   /translation="MSLLGKKFPAPVAKPMAPFFAAGVVILYGVNSLANALMNTEEFKN
FT                   DPRNPNAKNVKH"
FT   CDS_pept        join(576409..576540,576610..576990)
FT                   /codon_start=1
FT                   /gene_family="HOG000184690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751534"
FT                   /orf_name="AFUA_2G02280"
FT                   /product="Mitotic spindle biogenesis protein Spc19,
FT                   putative"
FT                   /protein_id="EAL87325.1"
FT                   /db_xref="HOGENOM:HBG052511"
FT                   /db_xref="HOGENOM:HBG332788"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniParc:UPI000051FB6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WID0"
FT                   /transl_table=1
FT                   /translation="MAASLQASVDSLQSSLQTLDSSISTLDSAVSDFPRLCKVLQTTRH
FT                   FELLPEPTLREAQQSLLDEISPSIAHLLSLASNHVEKLSRREQALKAKCELQEGRLHSN
FT                   DSRQSSSRGLGAMRDRQRQDAGSAVAKAAEYRRLVQKKERLKYTVERLELQSQQRERQL
FT                   RKSMAFQ"
FT   CDS_pept        complement(577583..580165)
FT                   /codon_start=1
FT                   /gene_family="HOG000184679" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208190"
FT                   /orf_name="AFUA_2G02290"
FT                   /product="37S ribosomal protein Rsm22 "
FT                   /function="methyltransferase activity"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87326.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG052513"
FT                   /db_xref="HOGENOM:HBG332786"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="UniParc:UPI0000520011"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC9"
FT                   /transl_table=1
FT                   /translation="MLSRSPALRAHRSCSHDLLRPVYNLPRPATQLLRCGAANCIAQRL
FT                   KSTLSRRAPSPTSHTISLRSAFSNSSKRWQVGRRHVSSNTPSDTHPYADRKDAIYALID
FT                   KINETELELAELMDDLGLLEEYQGALNLDGPEPDHVFSHWIGHRDEQALESRVRSARQE
FT                   FGEYLPAGYLNETELRLYTRLYGEPIIKVEEPQSELEAESSEEDRDPNRLFQEDGQGGW
FT                   KEVEFERGESQDDGPPLVYDMDVGPPVEESAAMRRTREVAEQLGGELMLEQFEDEAVPD
FT                   AAPRLHPLTRQGKFSTDPSTVFLPKDTVTGPISVILSEYSNKHIADVAHRTFGGRLLPH
FT                   STTTPPPRAQVPQLPIPLEASQRHMSQMEGNVYMAALYPGMYASALSVLVEVRKRLGTN
FT                   WIRRLMAQQDGPHVLDAGAGGAGILAWRDVLRAEWEAMVPDHPETDPIPLGRSTVVTAS
FT                   EALRNRASVMLDNTTFLPRLPDYIHVREKPTLDDERPPPPRKQYDVIIAPHTLLGLEEE
FT                   YMRKEHVENLWTLLNPHGGVLILLEKGHQKGFEAIAGAREMLLKRYISSPGSTQYDELT
FT                   ESPNENKHIDKEEGMIIAPCTNHAKCPMYTVAGHAKGRRDFCHFEQRYIRPAFLQRILG
FT                   AKDRNHEDVKFSYLAVQRGVDLRKEMNIVQGPEAAEAAFAGYEHLHDMESEDAQVSDDA
FT                   ATSEPSAAQDGRDFHTLSLPRAVYAPMKRRGHVIFDFCTPAGKIERWTVPRSYSKQAYR
FT                   DARKARWGDLWALGAKTRVPRSLRLGAKHGEGKKERLEKRAASKAALGESEDGGLESAP
FT                   SDNWDVFTTPVRKKGQTIPSWKKHQDKKKIRQASKKQSTVKLTDHDLD"
FT   CDS_pept        complement(580451..580636)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751535"
FT                   /orf_name="AFUA_2G02300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87327.1"
FT                   /db_xref="HOGENOM:HBG052514"
FT                   /db_xref="UniParc:UPI000051ECD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC8"
FT                   /transl_table=1
FT                   /translation="MGDVFFWKGEEVKVKEKIRVESQDPSLMAVMAKLTALEHEVMKWL
FT                   TSLKVLMGTEDTDSES"
FT   CDS_pept        join(582441..582453,582527..582803,582874..583056,
FT                   583118..583364)
FT                   /codon_start=1
FT                   /gene_family="HOG000184656" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266224"
FT                   /orf_name="AFUA_2G02310"
FT                   /product="Actin cortical patch protein Sur7, putative "
FT                   /protein_id="EAL87328.1"
FT                   /db_xref="HOGENOM:HBG052515"
FT                   /db_xref="HOGENOM:HBG332784"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI000051EF49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC7"
FT                   /transl_table=1
FT                   /translation="MALSSLFFTASALLLMFLAFLGGARNSNPLDRIYWLEAATGNIPG
FT                   APALSRWTYWNLCAVNSEGHNECGKSYPDYPFDPPSHRNFNTHVNIPAAFIGTRHYFLT
FT                   SRFMFPFHIIALFFATCSLLTGFLAMCTRIGNWVSAFSAYFALTFQTITTCLMTAVYVQ
FT                   GRDKFNNNGQSSHLGVKAFAFMWTSVALLFLSCVIYCMGGAVGRKDGGYSGREQRRRGF
FT                   FNSHRSGSLRSNKETAP"
FT   CDS_pept        join(complement(585915..586013),complement(585817..585850),
FT                   complement(585603..585729),complement(584085..585537))
FT                   /codon_start=1
FT                   /gene_family="HOG000184645" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16266225"
FT                   /orf_name="AFUA_2G02320"
FT                   /product="Hsp70 chaperone (BiP), putative "
FT                   /function="ATP binding"
FT                   /protein_id="EAL87329.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG332783"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniParc:UPI000051E399"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC6"
FT                   /transl_table=1
FT                   /translation="MGDSNGVAAEAPERFAIGISFGNSSSSIARLTPGKAEVIANEEGD
FT                   RQIPTVLSYIDGEEYHGTQAKAQLVRNPQNTVAYFRDYVGKNFKSIDPTPCHQSAHPQQ
FT                   VDSTVAFTIRDTASETPNTVTVSEITTRHLRRLKQSASDYLGKDVNAAVITVPTDFTDV
FT                   QREALIAAAGAAGLEVLQLIHEPVAAVLAYDARPEATVTDKLVVVADFGGTRSDAAVIA
FT                   CRGGMYTILATAHDYELGGASLDQIVIDHFAKEFIKKHKTDPRENARGLAKLKLEGEAT
FT                   RRALSLGTNASLSIESLADGIDFSSTINRTRYELLSGKVFAQFTRLIEQVVQKAELDVL
FT                   DIDEVIFSGGTSHTPKIAQLARNMFSEKTKILAPSTSASAINPSELAPRGAAIQASLIQ
FT                   EFDKEDIEQNIHPMVTATPHLRNAIGVEFVHGETVEFKPLLNAETALPARRVAQYSAPK
FT                   DGGDVLVRVCEGVREIKVTKPEPKPKEEKPPKAEDDEDEDSDFDSDEDEEEEIREIVWK
FT                   TEKPIAELAVKGVKAGSKVELMVHVNADLGMQITAREVGGQNAVRGAVESPKA"
FT   CDS_pept        586068..586256
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056886"
FT                   /orf_name="AFUA_2G02330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87330.1"
FT                   /db_xref="HOGENOM:HBG052516"
FT                   /db_xref="UniParc:UPI000051F1B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC5"
FT                   /transl_table=1
FT                   /translation="MKEVCEERRSQAQKFDSALIAVGFRLPPSRKKNLLICLAAGGNCG
FT                   FALIDIRCGGAAKNSTN"
FT   CDS_pept        586585..587409
FT                   /codon_start=1
FT                   /gene_family="HOG000184644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056887"
FT                   /orf_name="AFUA_2G02340"
FT                   /product="Exosome complex exonuclease Rrp40, putative "
FT                   /function="exonuclease activity"
FT                   /protein_id="EAL87331.1"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG352200"
FT                   /db_xref="HOGENOM:HBG738075"
FT                   /db_xref="UniParc:UPI000051E85C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC4"
FT                   /transl_table=1
FT                   /translation="MSSPVILLPGDHVPSDKLPSNKSAPLRLGPGLRLLSPAIPSPSSG
FT                   HVIASTQAGLLSTDYKKNAVSVLSFPNRRYIPTPNDLVIAQVHHSSAEYFYCMITPQSP
FT                   HVLLGQLAFEGATKKTRPMLRQGDLVYARVLSIGLGAGAEVELTCVNPATGKAEPGGLG
FT                   PLNGGMVFDVSTGMAARLMRASSSTSEQEDGVDGLVVLEELGRKLEKVGGFEIAVGRNG
FT                   KVWVDCSNGGDAAVKATVAIGRCLTAIDEHDLNQTDQRKLVTRILREMKVES"
FT   CDS_pept        587935..590748
FT                   /codon_start=1
FT                   /gene_family="HOG000184623" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266226"
FT                   /orf_name="AFUA_2G02350"
FT                   /product="MYB DNA-binding domain protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL87332.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG052517"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000051F1C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC3"
FT                   /transl_table=1
FT                   /translation="MNEERDAVGSPDSPTTSMKGKLETQVGETATPKRKRKQTVNDTNT
FT                   GMPSKTPNQSQESPLDRAGARPVKRTKIVPSTTNTKEARRPEKNGSREAIPSPETPVVA
FT                   NISEMTEAQRQSTGMQPLADVAHTNETASKKPKKSKAKTTQQDEERDLSAPPQNPAETK
FT                   PIRMASANPSLADSSTDQKDLTDTSAVRGPRKGKTDKMIGFFAPSEVSALETFKLQFCN
FT                   QHAISSEKFDKMVQHVDRRKDSGWPCDDGIIKKPEFWQQIYEVLPSRDRRSVYRFMRRH
FT                   FQDSSQKPHHWTHEQDDELIDLVGQYGPRFAHIAKILGRVEDDVVQRWKNRLEHRSTMR
FT                   RGAWSEEEVRGLLDALQESWNNLKKDGQDVGRDIYEMDEGLVSWGTVSNKLQNCRSRQQ
FT                   CADKWRKIRRKIMGQRRTGNQDAIYDPATEAKPQGRAKSITLAEQMEMERMLKSSEYVD
FT                   SEDGDEEDVEQSLGTESQSPNIKDEGESAEKESIIIPAPEKPPAPSVKALNETSQFKES
FT                   QTENDVDSESDASSDSADSASDDASEAEIKLGSESGSDADSSVESDAKVDARMRAQSSK
FT                   RQEKDVRNNKASSVKSSLEPTKPMPKQKLVERSKPKTSDGKQSGSQATKKSASDSVVNA
FT                   ETNTTPRPKASKPSKPTIKEEEPPQETLSESESDSESASDTSDSEDESVSGPEEPSDRK
FT                   PAKVTPKAPTSMQKASVKGQVSQKTQKKDEPEESSSTSDETSSGDDNTDDSEADDDSDS
FT                   DSDNSSSASADKPVESPKAAALKGTKRKAQQPADKAGTSESKRPKTGQKPSKKLSTSSA
FT                   SATSSSEDSESEDDADSDSEADTDESSSASDSSDSASEPQPKSKSDPKQPSAQPKVDKA
FT                   VNGQKPELSKPRTPVSKEGGNVKNGQSGAKQKSKQVKPSLPQVGKDGKKEKSKLGSAPV
FT                   SKGKNSK"
FT   CDS_pept        join(complement(595568..595713),complement(595157..595510),
FT                   complement(594265..595096),complement(593952..594212),
FT                   complement(591029..593899))
FT                   /codon_start=1
FT                   /gene_family="HOG000184622" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208191"
FT                   /orf_name="AFUA_2G02360"
FT                   /product="UDP-glucose:glycoprotein glucosyltransferase,
FT                   putative"
FT                   /function="UDP-glucose:glycoprotein glucosyltransferase
FT                   activity"
FT                   /biological_process="protein glycosylation"
FT                   /protein_id="EAL87333.1"
FT                   /db_xref="GO:0003980"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="HOGENOM:HBG018186"
FT                   /db_xref="HOGENOM:HBG396631"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="UniParc:UPI0000520001"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC2"
FT                   /transl_table=1
FT                   /translation="MAIGLGSVTSWRLCLVILAAFTPLVCGSPSVNVALQASFDSAPYL
FT                   LELLETAAEENSTSYFPLLDRIAEGTFDDATTEKQLYDRFLQVVYDDGHLSTPELLSSF
FT                   KLSLAIRSAAPRITAHYHFYNASVQHSLMAAQDAACPVWVHSEGKQYCSSSMERAQQDV
FT                   MGESDPRELPFDRVLGDLSLPPAVLYADIASPMFKDFHHTLSALAKDGQVSYRVRYRPP
FT                   QHWISRPLFVSGYGVELALKRTDYIVIDDRDAEKRSQKDSGSSEWASVEEESPDDLGAL
FT                   SSSEVARLGLNTVSYVMDSEEPLDTLVRISQDFPKHSAKIAAYNASDALLKDIRTSRLG
FT                   MLPSGVNVMWINGVQIDPRQIDAFSLLDHLRRERKLIDKFRSIGLSAQEAVDLLCHQTL
FT                   GETLAKDSPPRYNYRDQIEGGGVIIWMNDLEKDTKYQSWPDDLSAYLQPMYPGQLPAVR
FT                   RDAHNIVAPVDLTSSDDMELVVKTLQVFVKRKIPVRFGLVPLASSPGSVAQLKVAHYLH
FT                   ETFGLASLIHYLEESAAKKKIGSPDKAIFQHAIKDRTSRPNKQILSFDEILKSDELEIL
FT                   VSRTKQYQDRLGIKGNAPYILVNGVFVPRDDNWPQEMSMRVGRDLQTIQQGVVDGSIEE
FT                   DTWLPELFLSEAFDRRNPLIIPEDSKDIRIVDISKLAKSRGDSADTLRIASEMDTLDSK
FT                   HLIVVGDFDSENGLKLLVEALELRATHGEVEMVLIHNPAPDVETESGSALIYNALKGTD
FT                   KVDASRVLRHLKTAENTNFPEAEAKKMSQFWEAQQALARDLGFLPGTNGVIVNGRAIGP
FT                   LPDGSTLSKEDLDGLLTYEEARRIGPVAKAAKDLGLESKLSGPLALAELSSLAALSTVS
FT                   DVPEGIFEQMSSIRMDLFKKWNDLLSVITVSTSEDPAIIIAASIDPTSETAQRWLPILK
FT                   VLSRLAGVRVTLALNPRDQIQELPTKRFYRYVLDSEPSFNDDGTLARPTATFSGVPVEA
FT                   LLTLGMDVPSPWLVAPKESIYDLDNIKLSSLKPDANVDAIYALEHILIEGHSRDVTVKT
FT                   APRGVQLILGTEDNPHFADTIIMANLGYFQFKAQPGLWKINLKPGRSQRIFNLDSVGGQ
FT                   GYSPQPGDENNEVALLSFQGKTLFPRLSRKKGQEMEDVLDTDVKSGSAMDYVSKGFNFA
FT                   QGVLSSVGVGSKDGLAEKQADINIFSVASGHLYERMLNIMMVSVMRNTKHTVKFWFIEQ
FT                   FLSPSFKSFLPHLAREYGFSYEMVTYKWPHWLRAQREKQREIWGYKILFLDVLFPLSLD
FT                   KVIFVDADQIVRTDMYDLVSLDLEGAPYGFTPMCDSREEMEGFRFWKQGYWKNFLRGLP
FT                   YHISALYVVDLNRFRALAAGDRLRGQYQMLSADPNSLSNLDQDLPNHMQHHIPIKSLPQ
FT                   EWLWCETWCSDDSLSTARTIDLCNNPQTKEPKLDRARRQVPEWTKYDDEIAALAERVAL
FT                   EQQRQQLEEMESADEDEESGWEKDEL"
FT   CDS_pept        complement(596266..597348)
FT                   /codon_start=1
FT                   /gene_family="HOG000184601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266227"
FT                   /orf_name="AFUA_2G02370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87334.1"
FT                   /db_xref="HOGENOM:HBG052518"
FT                   /db_xref="UniParc:UPI000051EF51"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC1"
FT                   /transl_table=1
FT                   /translation="MPPSTNTLTSPEVKAKLRPKLKEYIVRNREDDTAQFLETCYMFLP
FT                   PDGQKNLYDDIWACQSNDELHELAETLDTGLIRPLLANANHTPELGSSYSAEEDAIDLI
FT                   GSDYRKVLERLRKKCLERDANKCVISGSYDQNSDAPDEALTGPLEAVHILPSVLGGPKD
FT                   ERKALSDAWANLYRYFPALRSRLKFTLEDINREHNAIMMLFPLGREFKAFSLILEETST
FT                   PNRYRVKTFPHFATAYRGFLPADGLVTLTSQSKRCQPPSPILLAVHAAIGNILHASGRG
FT                   KAIENVMQEAREDWVCMAGDGSTDVGELLSVTSLALLASSDRARRHQNGQRRGKRRSSP
FT                   PEADASRKKKGDILGGNDGI"
FT   CDS_pept        join(complement(598960..599559),complement(598144..598899))
FT                   /codon_start=1
FT                   /gene_family="HOG000184590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056888"
FT                   /orf_name="AFUA_2G02380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87335.1"
FT                   /db_xref="HOGENOM:HBG052519"
FT                   /db_xref="HOGENOM:HBG332778"
FT                   /db_xref="UniParc:UPI0000520248"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIC0"
FT                   /transl_table=1
FT                   /translation="MAHLEERPSSLDGSAWTWIFDHCLRYPETYEIPLRTMYALNCNPT
FT                   RQPSSGTRTPETAFSNRSSSSSKTSVSSQDFILDPAADFRAQLTHHIARMPSQPCSLPP
FT                   SFVTSFLRRCFAPQLDEVDFPQALTALDYLKDLENRRRREVAAALQRLNIHPDDLKEKT
FT                   ELAKKYPGVLTWIESINVQGRKVEALYTQIYLGLRRWILINEMLLAPFNKANCIAMLNT
FT                   LFPPVTEATVTPTSQLTPQILKSQRDGFFRYISAFETNGRQILDKVITQGAPEGEANGW
FT                   PLVREALDKYLRIANEIIDECVLVNGPSSFEEREDPAPRGHKSRKVDSGISLESNDKLP
FT                   PPSIRSGNGNEDILDKPLPPPPEKLPHFKSGGSALDRLARELRKLGDVGKAKSLKKMRS
FT                   TSALGIRPENLPSHAPDEESYFDTDELKRRNLIWEATTRKRTHSKQSTSDSR"
FT   CDS_pept        604823..605437
FT                   /codon_start=1
FT                   /gene_family="HOG000184579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266228"
FT                   /orf_name="AFUA_2G02390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87336.1"
FT                   /db_xref="HOGENOM:HBG052520"
FT                   /db_xref="UniParc:UPI000051F6A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB9"
FT                   /transl_table=1
FT                   /translation="MSGFHRPKGLSEEVEVLPTAATFFRRVSRINSRLLPIARKAAVPY
FT                   KVANMSHDKLQQETASPSPNLRRCVGHTAVLRNTMEATQKERRHQMHRLSYYEDNGPNY
FT                   GANDTTEMDIFAFREQVSRIVKTMIRRRSVTGTPRGSGSEKANSLARTSSHGSHKSDTF
FT                   QRATEKKNRFATKSRKYASMLVPGRRMFTCPSSILHTNAVF"
FT   CDS_pept        join(606550..606622,606697..607346)
FT                   /codon_start=1
FT                   /gene_family="HOG000184568" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903602"
FT                   /orf_name="AFUA_2G02400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87337.1"
FT                   /db_xref="HOGENOM:HBG052521"
FT                   /db_xref="HOGENOM:HBG332774"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="UniParc:UPI000051EF42"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB8"
FT                   /transl_table=1
FT                   /translation="MAKQPLVKTLQFEKKNKDMLKLPKYARVQKRPIPHAPVASPYAGA
FT                   SVPKIVYVSTKSPFMSAVKRVQKLLRQAEKRATAAVNLSSSKTTDRQKLAEVARGQEQL
FT                   SEEAVFVKATGRAIEKALSVGRWFEERGNEYAVRVKTGSVLVVDDIEEDEEAKRKAIVE
FT                   AERVLQQEQAQKKKEDEKDDGQPAADQSVDAPAQPVSKSETKKRKRAANVLASASSEEL
FT                   PETRTRWVNMVEIAVTLK"
FT   CDS_pept        complement(607561..607713)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266229"
FT                   /orf_name="AFUA_2G02410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87338.1"
FT                   /db_xref="HOGENOM:HBG052522"
FT                   /db_xref="UniParc:UPI000051FFFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB7"
FT                   /transl_table=1
FT                   /translation="MAYSLDLKQHHSSRLRRYRPAATESATIKSVNQNGSGGNEVVGMR
FT                   VGSLQ"
FT   CDS_pept        join(complement(609799..610917),complement(608612..609718))
FT                   /codon_start=1
FT                   /gene_family="HOG000184557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751536"
FT                   /orf_name="AFUA_2G02420"
FT                   /product="Cytoplasm to vacuole targeting Vps64, putative "
FT                   /protein_id="EAL87339.1"
FT                   /db_xref="HOGENOM:HBG052523"
FT                   /db_xref="HOGENOM:HBG332772"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI0000520233"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB6"
FT                   /transl_table=1
FT                   /translation="MTAVASPPSVQEGPRLGWYDSGKGGQGALTSMNDEVSRMFMPRKS
FT                   IQRSNSSSSLGSNSSTSTVVAGSQNVHAVQSNTAESCTWSSKKKSSRSIWPSTKSEPAT
FT                   GVSTTRTQVMPAFSSGPGATSAMSVLHQPSSIVPSQHMLQSSQQNGVRAGSAPSGEPPA
FT                   ILTLLPINGTFEKKQITVPFYPEVLRIGRQTNAKTVPTPVNGFFDSKVLSRQHAEIWAD
FT                   KSGKIWIRDVKSSNGTFVNGQRLSPENRESEPHELRENDTLELGIDIVSEDQKTIVHHK
FT                   VSAKVEHAGIYGTMPNIFDLTLGDLDPASGNGLLPSPLSQPLSHLRGRSGSAMSNRSSQ
FT                   SAASSQLSALQQQRQMNYWNSPISIEQIVKRLTAKQQAQDLRQTDEFLTSLTKQGHQER
FT                   EKAKHSPPDSGVSRQVNGRPKMPRVDSFSRFSDPPAPPPQQPLPEKPDAPPRTGADAFS
FT                   PLKRSDTEKPKLGSNNSPASRESSQILSLIEALSSAKRELDSQGARVKELETLLLQERN
FT                   ARESAEEKARNLELQAKGVNGESLEQGMNGRSDDAAISEKHAHEQPANAELPPNSGSDK
FT                   SSTSESLADTQAYHLQLRLETMMEEMEEMKKQVAMFRSMAEKAESETAEARKSLAEMIE
FT                   TLRRERAEKCELSNESAAKDITITRDDSATADAGYVAGGEVEEQAHPNTTPSSPYTNVN
FT                   NSGTAFAKQPLKHDVLEQTSPYASMLGVVLLGVGLMAYLNGWQKMDK"
FT   CDS_pept        join(611825..611879,611956..611982,612048..612077,
FT                   612132..612222,612345..612468)
FT                   /codon_start=1
FT                   /gene_family="HOG000184556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266230"
FT                   /orf_name="AFUA_2G02430"
FT                   /product="Mitochondrial genome maintenance protein Mgr2,
FT                   putative"
FT                   /protein_id="EAL87340.1"
FT                   /db_xref="HOGENOM:HBG113405"
FT                   /db_xref="HOGENOM:HBG395519"
FT                   /db_xref="InterPro:IPR018450"
FT                   /db_xref="UniParc:UPI0000520242"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB5"
FT                   /transl_table=1
FT                   /translation="MPVVAAPPQGHGPSTFDKMKMGALMGSTVGGIMGFIIGTVTIFQY
FT                   GAGPNGVMRTLGKYMLGSGATFGLFMSIGSVIRTEGPHNDAWLRARGPPMMLPRQSPLR
FT                   PMRQ"
FT   CDS_pept        615300..615659
FT                   /codon_start=1
FT                   /gene_family="HOG000184535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056889"
FT                   /orf_name="AFUA_2G02440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87341.1"
FT                   /db_xref="HOGENOM:HBG052524"
FT                   /db_xref="UniParc:UPI000051EF4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB4"
FT                   /transl_table=1
FT                   /translation="MKINAIVSSVLCLAATQLVAADTTTSTYTQTITKTLIRVNSETPG
FT                   ASASVSSYVIPSGSATPSSSWVASSSAAATSTPASSTPSASGLVNHSGAGSVADVRMPV
FT                   ALVAGSVAILLGAAL"
FT   CDS_pept        join(616760..617388,617438..618401)
FT                   /codon_start=1
FT                   /gene_family="HOG000184524" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266231"
FT                   /orf_name="AFUA_2G02450"
FT                   /product="Leucine Rich Repeat domain protein "
FT                   /protein_id="EAL87342.1"
FT                   /db_xref="HOGENOM:HBG052525"
FT                   /db_xref="HOGENOM:HBG332765"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI0000520243"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB3"
FT                   /transl_table=1
FT                   /translation="MDSEIPLPPPRRIRHRSPASSSSSTANPPTASSFRKTYRLSRFDD
FT                   RSSQPSSDPALFSSDDIPASGLENYNAPVSSGDAVGRKRRYRGTWWGETVVDPKRKRAD
FT                   FKDKRLVDSGVWMGSDESTAESLLPSEDASIWGEDLMRNMQTSTSAGACSERQMGAASS
FT                   QPANSQLRPTVSQPRGPRKVEEPREHQLARTIVNDCLEKGQDSVDLSNGNLRALPSGLL
FT                   RPLQYLTKLPSVREPPISEEGYSSLKPFLRLFLAGNALTAVSGEIFELDSLRVLSLRNN
FT                   KLTEIPPAIRKLTMLQEINLAVNRLRCLPWELLWLIRKGDLKHLMVRPNPLLQTNDVEV
FT                   TRWYTPDGSDAASPEEALKACHYEGPPPEEAWAPIQVAISPIRRFNMEGIPITDGQSGA
FT                   LPLRSSDDTPSHVPSLREVSLLAFSKSAYCDQISESEMIGYPELMVRLLRQAKGVRNAG
FT                   GRSCSICHRSFVIPRTEWIEWWDCSTYENGLKRPRCPGEQLRPLPFRRFGCSWACVPEA
FT                   EESMLQAETGQQG"
FT   CDS_pept        complement(621833..624088)
FT                   /codon_start=1
FT                   /gene_family="HOG000184491" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266232"
FT                   /orf_name="AFUA_2G02460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87343.1"
FT                   /db_xref="HOGENOM:HBG052526"
FT                   /db_xref="UniParc:UPI000051F902"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB2"
FT                   /transl_table=1
FT                   /translation="MLKLLVFCLFCSNTNCLHQPSGLHFSVFHSIPSPTSKHIHSTHII
FT                   LELQVSRLIESHSGQPLTLLIAFPRAQSVVERCLYHPKPNTNILATCIPQLLVGNPQNK
FT                   PTMMSQILSRTHQSKQGLVRAATGDGINMGVQHPLHSLDDIASSQPIALSELWNRASLR
FT                   GKVTKPLKPLQIADRQFHDAKEISTDTGSIVVAQCKPRSHLVPMHRPCTETGHHSGPQT
FT                   EILQRSRIRSEAYYPTYAHEAKEYLWQEKADGHVQQNPLSYCGGYDPSYPQCLRHDYRS
FT                   ISDGLFYKHQNILQSEHAIWPAEPCAATNNTRVASYEQCRVADHKYIQESYIELPHDGI
FT                   RTRDDLSGYLSLEGPGYHYSQRDMRGAALPIENAYSNQAQLNYTCHDSVQADAEVLKVV
FT                   RQKLLRNISSSTRAEALGDAEAQAPNSIRVSLPSHDRKPSSAESDSSKASSKRSIKEEA
FT                   TAFLQSVVENSHLDAKGTRSLAVTVQSEESAVARLQQGSQETEYVKSEPVSMCDRNASL
FT                   EDTRLINEQINLGDKGTISLLNAGTNEYLLRNTNHHLVHRADIIKDNQGNTYHKLFIAN
FT                   SKAVPPPPGLPIPLEQQKDADSLFFDTLAPNRARLEEANSWFHTDNRGASELRQLVSSI
FT                   AYDNVERGALLHGNSRPTSETTTAWQTTLLLGNVIANLQLHASSDLTQQADYFSDYAVV
FT                   DSACCEPSHGGRRSYFFQDPAVTHWKLPADRATPGTAKESEYELAGPQIYSQPSGTW"
FT   CDS_pept        join(628322..630531,630588..630951)
FT                   /codon_start=1
FT                   /gene_family="HOG000184502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266233"
FT                   /orf_name="AFUA_2G02470"
FT                   /product="PA and RING finger domain protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL87344.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052527"
FT                   /db_xref="HOGENOM:HBG332764"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000051F1AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB1"
FT                   /transl_table=1
FT                   /translation="MRPPRLVSIVFCILFFPIFLTLFSALSSSPRVADPSSLAGQTTGF
FT                   HAFFSFNIPSSLFPPSAIISLTDDNSTFFLARPAAFGPLLSDKGLSGPLWVGSGFGEKT
FT                   SGGAEGELGCSDIPGWGDGDSRRSPDKSTIAADKTSSSGIRDGLAASLGQHRADPQQES
FT                   DSEHLAAGVASPPSTNDGTDDHLHHPLPDSDVVDAGAPEKPRERQNKPAAHADIQSLQE
FT                   SAEIDGKVVLLSRGGCGFLEKVKWAQRRGAIAVIVGDDTRGGSLVTMYARGDTSNVTIP
FT                   AVFTSYTTAHLLSSLMPPQAGAESSLDEKAASSRTVVSSGPDKQRLSPTTTTSVTPSST
FT                   PTTQAAVDEQLQTAPRPKTGFFHSLLSLLGLGRSNNGHALQKFEDSRRPPNSGNIDWVR
FT                   LGDKQQSNKPHNSAAHDRKESESVSSLADGDGFIIGVQDWRDPDLVPARTISLPSPSSV
FT                   ASSAKTESGNSAKSQKKTSNSPKGGSITPGSGEYRSVDRSSDNKEVPSRDGSPVNSAGN
FT                   AGSDKGWFFKRFFAPRRTEGANLYKPANNKMRRNTDQNAKVTEHEGLWVTLTPTSMSTS
FT                   PFFDTLLVLVVSPLLTLTVVYALLLIRSRIRRRRWRAPKSIVERLPVRTYHTIPTPSSA
FT                   ASSSRSSSPGPVSPTSPLLGSRSRPELAPSRSSFLRSGTAEAKKTRNMDSAKGEKSGSA
FT                   SSVWRRKYTGRQVECVVCLEEYIDGQSRVMSLPCGHEFHAECITPWLTTRRRTCPICKG
FT                   DVVRSMAQNTTAESRDSSQRMVDGDDHHGFESHRSVSSAPMLIANPGEEETSAPEHYGA
FT                   SDLGPLQGHASSAPPSSSWRNMASLSLSALSGDTIWHQTQPDNDR"
FT   CDS_pept        join(631467..631568,631626..632200,632256..632373)
FT                   /codon_start=1
FT                   /gene_family="HOG000184513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266234"
FT                   /orf_name="AFUA_2G02480"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87345.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="HOGENOM:HBG052528"
FT                   /db_xref="HOGENOM:HBG066043"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI000051ECD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIB0"
FT                   /transl_table=1
FT                   /translation="MADKLKGALHEEADNFKAVAHGIAVSGAYLYPVKGILFFSYHKDL
FT                   WRPFISRAVQTIGLGLGVTTAMFFFTYVPQAAIMTFTSGPLAPISAALLVLSESSTITN
FT                   LLARSFVLADALTDTFDGTLVARGHTELVAKGRQIKASGGGAVSRLGRLLNRPLERMRP
FT                   SALVRSLMLLPLNFIPVIGTILYVYMQGKKTGPVAHLRYFQLKGWDERKREEWVKKNQG
FT                   GYTGFGMAAFLFEMIPFASLMFSFTNAVGAALWATDMEKAMQ"
FT   CDS_pept        join(633252..633498,633573..633662,633726..633811)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266235"
FT                   /orf_name="AFUA_2G02485"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EBA27311.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51812"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U9"
FT                   /transl_table=1
FT                   /translation="MQTVLSVGAAGKIGASAIHAALSSEFHVLAMVRKHISAEKLFYNV
FT                   GAHEGITTVEADIMSDRRVKGVVEKVRKGKLPVYAAGAGELFDMTSILDLTTEGINKHM
FT                   QVNFEPNFFAYQGCRVRVCQPGDLTEMKLRKKLDVL"
FT   CDS_pept        join(634993..635053,635112..635188,635238..635654,
FT                   635730..635963)
FT                   /codon_start=1
FT                   /gene_family="HOG000147851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266236"
FT                   /orf_name="AFUA_2G02490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27312.1"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0000F5183D"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U4"
FT                   /transl_table=1
FT                   /translation="MAAKQEQADYHLIGLFTRYSSWTARVEIVLEYFQIPYTEQQIKVD
FT                   DIRKFSPSGLVPLLECHSLSSTMRINDSLAICEFLAESNPHLSLWPPDRLLRAMARSAA
FT                   AEMHSGFAALRNTYPTNFIVQYTGNIPVPEAAKKDIQRLFTIWDNARQAAKTRLAELGE
FT                   KDDGFLFGGFSIADAFFWPVLWRFRTYNLPLEGASADVVKWIETMWNDPTMQKLAHKYY
FT                   RQAELPESHMERYENIFPDRDDIQYARFPEDWKFTVPGKL"
FT   CDS_pept        join(complement(636393..636933),complement(636057..636331))
FT                   /codon_start=1
FT                   /gene_family="HOG000184480" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266237"
FT                   /orf_name="AFUA_2G02500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87347.1"
FT                   /db_xref="HOGENOM:HBG052530"
FT                   /db_xref="HOGENOM:HBG324648"
FT                   /db_xref="InterPro:IPR012664"
FT                   /db_xref="InterPro:IPR019261"
FT                   /db_xref="UniParc:UPI000051FB6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA8"
FT                   /transl_table=1
FT                   /translation="MSILKPPNNAQRQRLAAETLSLTEYVIKATTGASQASRAHPHLLP
FT                   PIKGISNSATQKPTLSVTSQDSFTAAQDILQRTGGRARVGVLNMASERTPGGGWLNGAL
FT                   AQEEALCLRSTLAATLDRKYYPLPVYGAVWSPAVVVFRDEVANGCRLYRDEEKFVVGVV
FT                   SLAALRRPVLTADGRHFANPNDMLVLKNKMRQVFRVLAENGISHCVLGAMGCGAFRNPP
FT                   YEVARIYKEVLQEAEWDGVFEEIVFAVLDTKGESNYTIFKNVLLSRNGR"
FT   CDS_pept        join(complement(642006..642476),complement(639214..641937),
FT                   complement(638889..639139),complement(638499..638832),
FT                   complement(638103..638440),complement(637850..638039))
FT                   /codon_start=1
FT                   /gene_family="HOG000184479" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751537"
FT                   /orf_name="AFUA_2G02510"
FT                   /product="TORC1 growth control complex subunit Kog1,
FT                   putative"
FT                   /function="binding"
FT                   /protein_id="EAL87348.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG028839"
FT                   /db_xref="HOGENOM:HBG737108"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000520249"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA7"
FT                   /transl_table=1
FT                   /translation="MRDPTINMEQDIAAKPQATSLQVEPRKNQKSVRVAFGPDLDTYIP
FT                   PRDKSPAPSSGHHRSYTTVEHSQPSISSLHRPASSSAGDNAAAFEPSPRLTSDRASDSG
FT                   GRPTAALKRARSDYGPRLGFDKSAVADEEEDFAMRHGWQEEYTSSEYLKVLHSNFYMYF
FT                   TEKRHDTNGIPRDPVGSWPSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLE
FT                   CWVDPTSTTGGGQNKIMEQIGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNA
FT                   KDERVLFHYNGHGVPLPTQSGEIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAG
FT                   NIVQNFHIFVEKHEKENLEAKKRDPNAVVQNYGDCILLAACQKNESLPTNPDLPADLFT
FT                   CCLTTPIEIALRYFILQNPLQTNLSIDEFRVPGRLQDRRSPLGELNWIFTAITDTIAWN
FT                   TLPRALFKKLFRQDLMVAALFRNFLLSERIMRTYKCHPISSPELPETHHHPLWKSWDLA
FT                   VEMVLSQLPALIDHEEGRRQYEYQHSTFFAEQLTAFEVYLSSGPTEKNPPDQLPIVLQV
FT                   LLSQAHRLRALILLSKFLDLGPWAVHLALSIGIFPYVVKLLQSAAQELKPVMVFIWARI
FT                   MAVDHTVQNDLLKDNGIHYFISILNPSSPIPVGNASEHRAMCAFIVSIFCKNYPQGQNV
FT                   CLSGELFDSCLKHLTDVENPLLRQWSCLCISMLWSDFPEAKWMGIRCAAPARLCELNFD
FT                   PVPEVRAAMLHAATTFLGIPDLTDQVAQIEESLALAVLPMASDGSVLVRKELLVFFSTF
FT                   VKRYQNKFLVAAYEEFQDEKQTLLLRLEHDGSRGFTMEDVQNGTANSRNKSQKLSQNTA
FT                   FGTIWKQLLILSVDPHPDIAQDASTIIDYIHLTLLASPMASLTDKARKEIMELTSRLSQ
FT                   KLQVRERAESKKAAPPPAPPSQTAAPKQEGYLSLSIKRTASVAASLKNLAFGGPPQNEQ
FT                   QSSQNVTSPTKSRTPVTPRGRAPPEWTRPPEVNDQVASAAAYHQAPIPPSRGFEPRDPS
FT                   LAPMIPLLSRFLDWSTEYFREPQMKPNEPDEPGSADYNERLWRRGRNEKIITETQPLKG
FT                   KAGSSRWDNSLALLTNTSQPLKMCFHQFEDHLAVADDRDTIAIWDWQRHKRLNRFSNGN
FT                   PPGSRINEVRYINEDDQALLMTGSSDGVLKVFRNYESPKEVEIVTAFRALPELIPSNRN
FT                   AGLVFDWQQGQGKALVAGDVKVIRVWNAATEVCTNDIPARSGSCITSLTSDQVAGNIFV
FT                   AGFGDGAVRVFDQRLKPTTSMVKVWREHKQWITNVHMQRGGLRELVSGSRNGEIRLWDL
FT                   RMDGPISTIYATKDTLRTLSVHEHAPVFMVGTNRHEVKTFNMDGTYLSTFEPYSSFLHH
FT                   NRSSPIASTAFHPHRTILACAALNDNHINLVSC"
FT   CDS_pept        join(645542..645796,645863..646262,646332..646614,
FT                   646675..650227)
FT                   /codon_start=1
FT                   /gene_family="HOG000184458" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751538"
FT                   /orf_name="AFUA_2G02520"
FT                   /product="Cell polarity protein (Tea1), putative "
FT                   /protein_id="EAL87349.1"
FT                   /db_xref="HOGENOM:HBG052531"
FT                   /db_xref="HOGENOM:HBG332756"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000051F1C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA6"
FT                   /transl_table=1
FT                   /translation="MAFLFKSKKNQQASGLPPATRHVHTSEGAPTVASLGAPNGAKEQS
FT                   GGISQTPTPSSSYNNSLNSVNSTNSPEHQRARPRAESESQAHRPPQAANTTSPNSSPGA
FT                   SLYPWSQRRLNFSTPQGNPFPRYGAAINAVASKEGDIYMMGGLIDGSTVKGDLWMVESS
FT                   GGNLSCFPIATVSEGPGPRVGHASLLVGNAFIVFGGDTKVDENDTLDDTLYLLNTSSRQ
FT                   WSRAIPPNPRPAGRYGHTINILGSKLYVFGGQVEGYFFNDLVAFDLNQLQNPTNKWEFL
FT                   IHNSHEGGPSPGQIPPARTNHTMVSFNDKLYLFGGTNGLQWFNDVWSYDPRANQWSQLD
FT                   CVGFIPTPREGHAAALVNDVMYIFGGRTDEGIDLGDLAAFRITTRRWYSFQNMGPAPSP
FT                   RSGHSMTAFGKQIIVLAGEPSSAPRDPVELSMTYILDTSKIRYPTETQNGDKVGAPPLA
FT                   MRKGSSDRHGAPTGRTSREAQITPPADSQQRRGPGQTRESMMVAPNGRPGDHGPGPGSR
FT                   LPRASIAQAPAGPPPPGQAPTPGPRGSTPQHAMNPRSKTPTDRNYGGPAADTVRTMESE
FT                   RDRESPVARDSSKDPRSANDPGSMSSGHRTPTQTPSRMSARAMEAGEAAPLARQRSLRQ
FT                   HRQRSSMDSADESVLGRHASIDGSIESRGHRNSKSMGDEPRSPRLTAHQEALIKELEAA
FT                   KNRNAWYASELALAKRAGYTINFSNNAIADERAVDMFADEDRPLIEAFLAMRAELAKMQ
FT                   ATVDRQAAIASKRVAEVEHQRDVAVNEAAYSRAKLAAHGGSQRGTPQPDGSSQDPDEAI
FT                   ADRATEMGRRLALALASQNELKSKLEAVSAELDQEKRGRELAEETCEATRRRLAELEMQ
FT                   NNTLEVESLRAEFHRVEATAREESLLRSEAEASLKQLTLDKEELLKRLEDSSSRLRDFG
FT                   NNLGNLREAVTASSEKTALLERQLEEERELREGLERKLLQLRSEHEERTAELENATRRL
FT                   RDAEELAESNAREAETHKNAFLAGLERASSFDSETSIRSMADQRVAALEAQVDRANKLA
FT                   KANQAAADEAADKLRRAEERIAGLEAYQEQASREGLQLRRQLQAIMKESQAHAAENREL
FT                   KSKLENQQREAGALAIQHAALKDLLAERGVSYTDSRRSPRLESPGSRFGTPEQTRLREL
FT                   EQQLSASLKAHEELKASFETREQEADRAYREKLEQLENDYQSAVHYVKGTEKMLKRMKD
FT                   ELTRYKAQNAKIQADLEAAQRSISQASGLGSEPPAEWESERSKLQQSISDLQQDTASSI
FT                   ANLESQIAKLKEDLSAAEAEKDKSRSEYESVKQELIAAAEKNRAELEQLKQENALLEAR
FT                   ALDADQKVAMLLDQVEASVGHYRRQSQPVQGMNGISRTHSNASSNTISGVTGRSRADSA
FT                   VSQDDPFPDNRGSMALDSLANELEALRSHWESTNRNYRLSTQSDFDRTPTKETHGLSDS
FT                   LAEWRRKLDEEEARAGSPEKNKPRAAGEQAAANMI"
FT   CDS_pept        join(653145..653265,653328..654358)
FT                   /codon_start=1
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267173"
FT                   /orf_name="AFUA_2G02530"
FT                   /product="Casein kinase I, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87350.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F456"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA5"
FT                   /transl_table=1
FT                   /translation="MHPSNLVLCTNIVTTQDLRVGNKYRIGRKIGSGSFGDIYLGTNII
FT                   SGEEIAIKLESVKAKHPQLEYEARVYKSLAGGVGIPFVRWFGTECDYNAMVIDLLGPSL
FT                   EDLFNFCNRKFSLKTVLLLADQLISRIEYIHAKSFIHRDIKPDNFLMGIGKRGNQVNVI
FT                   DFGLAKKYRDPKTHFHIPYRENKNLTGTARYASINTHLGVEQSRRDDMESLGYVMLYFC
FT                   RGTLPWQGLKAATKKQKYDRIMEKKMTTPTEVLCRGFPNEFSIYLNYTRSLRFDDKPDY
FT                   SYLRKIFRDLFVRESYQYDYVFDWTVYKYQKNAAMIADATNNKKDKEADGRQNAAGAQA
FT                   PMATTATAAKPGAISSQRRKVLDHNTLNNTPDTNRAMGGSDRM"
FT   CDS_pept        join(656345..656482,656537..656787,656898..657417)
FT                   /codon_start=1
FT                   /gene_family="HOG000184447" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267174"
FT                   /orf_name="AFUA_2G02540"
FT                   /product="BZIP transcription factor (Fcr3), putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL87351.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG052532"
FT                   /db_xref="HOGENOM:HBG332752"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniParc:UPI0000520706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA4"
FT                   /transl_table=1
FT                   /translation="MDYSFYSNPQSQQPFSVYDLHGLPTPDQNNPAPNGDDINDPFSSL
FT                   VNYHSFHPSFRIQNPAAPSSFVPPPHSPPESFSKHSVSSNDFPNSHAEPGSVEGGDDQL
FT                   QHRSSSEEKDNLTPAQSKRKAQNRAAQRAFRERKERHVRELEEKVSALEQESTTLAADN
FT                   ERLKRELAKFATENEVLRATTGQLASSQGRHLDSEPTITGPMKYTPTDFYTNLVPKGEP
FT                   APTHRVTVCEKTGERLLDAGATWDLIQGHELYKQGLVDIGDVSNRLKGMAQCNGQGPAF
FT                   REGQVLQAIEASAAACRDELI"
FT   CDS_pept        join(complement(658843..658976),complement(658569..658793),
FT                   complement(658139..658494),complement(657942..658084))
FT                   /codon_start=1
FT                   /gene_family="HOG000184445" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267175"
FT                   /orf_name="AFUA_2G02550"
FT                   /product="Phosducin family protein "
FT                   /protein_id="EAL87352.1"
FT                   /db_xref="HOGENOM:HBG316414"
FT                   /db_xref="HOGENOM:HBG358009"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000520491"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA3"
FT                   /transl_table=1
FT                   /translation="MHHIIISGAWEPQQTIACELSFYLPKLAIFIFHDRSTYFSLWRSS
FT                   FLSKAPDNRSPRPRNDILRKHGIIPEKPQDPEPLIQEALVEAERKAHENRLEDKDLDEL
FT                   HDLEDEEDEEFLEQYRKKRLAELSTLQKTSIYNQVYPLQKVDYAREVTEASSKSFVLVH
FT                   LTSTSGNVESRVLSDLWRQLAMKYGDIKFCEIRGDMCIEGYPERNTPTILVYKDGEIRR
FT                   QLVTLRELNGPKTKLENLERMLVDLGALKESDVRLKKRSYSFDEERQSNIRSANVEDYD
FT                   DDWD"
FT   CDS_pept        join(659395..659470,659556..659866,659926..660892,
FT                   660945..661292,661350..662165,662226..662458)
FT                   /codon_start=1
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057136"
FT                   /orf_name="AFUA_2G02560"
FT                   /product="Coatomer subunit gamma, putative "
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="EAL87353.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG022373"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI000051E3A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA2"
FT                   /transl_table=1
FT                   /translation="MSYVKKDEDADQVMIKLDRTSVFQDARLFNSSPISPRRCRTLLTK
FT                   IAVLMFTGEQFPTNEATTLFFGISKLFQNKDPSLRQMVYLILKELANTAEDVIMSTSII
FT                   MKDTAVGSDILYRANAIRALCRIIDATTVQGIERLIKTAIVDKTPSVSSAALVSSYHLL
FT                   PIARDVVRRWQSETQEAASASKSSTGFLGFGGSSSSHAISQSNFMTQYHAIGLLYQMRS
FT                   HDRMALVKMVQQYGAAGVVKSPAALVLLVRLAAKLAEEDPGLRKPMMQMLDGWLRHKHE
FT                   MVNFEAAKAICNMRDVTDAEASQAVHVLQLFLSSPRAITKFAAIRILHNFASFKPHVVN
FT                   VCNPDIESLISNSNRSIATFAITTLLKTGNEASVDRLMKQISGFMADITDEFKITIVEA
FT                   IRTLCLKFPSKQAGMLAFLSGILRDEGGYEFKRSVVESMFDLIKFVPESKEDALAHLCE
FT                   FIEDCEFTKLSVRILHLLGVEGPKTSHPTKYIRYIYNRVVLENAIVRAAAVTALAKFGV
FT                   GQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALNLRLMAEEDEMAERFIKNDSMFSLSTF
FT                   EHQLVMYVTSTDKETFAAAFDISTVPVVTQEQALAEERTKKLTTATPTLKAPSAGPPKG
FT                   KANGVAEAATAAATQKYAEQLMQIPELKAYGTLLKSSVPVELTESETEYVVTAVKHVFK
FT                   EHIVVQYDIKNTLPDTVLEDVTVVATPSEEEVLEEEFIVPAPKLAANEPGIVYVTFKKL
FT                   SGEHSFPVTSFTNILKFTSKEIDPSSGEPEDSGYEDEYQVEDLELTGSDYVIPTFAGSF
FT                   DHVWEQTGANGEEVSETLQLSNMKNISDATEQLITALSLQPLEGSDMALSNSTHTLKLF
FT                   GKTVSGGRVAALIKMAFSSKTGVTTKITIRAEEEGVAPAVMAALA"
FT   CDS_pept        join(complement(664380..664750),complement(663517..664282))
FT                   /codon_start=1
FT                   /gene_family="HOG000184413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751784"
FT                   /orf_name="AFUA_2G02570"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87354.1"
FT                   /db_xref="HOGENOM:HBG052533"
FT                   /db_xref="HOGENOM:HBG332751"
FT                   /db_xref="UniParc:UPI000051F8EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA1"
FT                   /transl_table=1
FT                   /translation="MHSTRQIYLPTEIVVQIVRFVATDEAHRQEALYACCLVSRQWYSA
FT                   AVSLLYEKPRLHIGNSFQQFVSTCSGVGGRRNKLNLGSFVRRLDLSRLVHHSSNSVTAR
FT                   LLGRVKENLEVFVAPRVSFAVNSLPALSKCTNLRHLDLSLVADPIAFPNLKKALSRLPR
FT                   LRTLRVPRSTNLDVPDSSRAEWPPLLHKLQLSGNFSATTIPSFSWPPALTSLTLKNCTD
FT                   LSVTSIACLFSSPQLSETLKHLTISYANRGLEPGSINAVTAFLPNLTYLSVPGDMVDET
FT                   FFDVLYFLSPPLALEVLEFGMPYLDPVLHFETGSLIMALDKGLGNVRSVGFSDIFCTDE
FT                   RIVEDEEVDDVLHKHARQRAEQGAPTAVDETEVGVYYM"
FT   CDS_pept        join(665044..665168,665226..666306)
FT                   /codon_start=1
FT                   /gene_family="HOG000184411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267176"
FT                   /orf_name="AFUA_2G02580"
FT                   /product="HAD superfamily hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87355.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG348240"
FT                   /db_xref="HOGENOM:HBG593961"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051EAAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WIA0"
FT                   /transl_table=1
FT                   /translation="MRPQLLWRSLGRFQSAYSYSCRRAIRTATSTSQIPDFAFAFDIDG
FT                   VLLRSSKPIPGAAESLALLKDQGIPFILLTNGGGKHETERVAEISEKLKVPLDASVIIQ
FT                   SHSPFAELVKGPDEHSSLEDKRVLVVGGDGDGCRRVAEQYGFKNVLTPGDIFMANPSIW
FT                   PFSKGFKDYYEKFARPIPNPLDPRDPTRGLKIDAIFVFNDSRDWGLDAHLIIDLLLSSQ
FT                   GVLGTISDKNGRADLPNRGFLQDGQPHLYFSNPDLWWAAAYHLPRLGQGGFREALEGTW
FT                   AAITGGPSKGVELKKTIIGKPYQGTYEFAERQLLRNRTEIFGTDGTKPLRNVYMVGDNP
FT                   ESDIRGANSYRSGNGSNWHSILVRTGVYRGGEPAWTPKVIVDDVKKAVEWGIKSSGWKL
FT                   TE"
FT   CDS_pept        join(666730..667719,667780..668457)
FT                   /codon_start=1
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267177"
FT                   /orf_name="AFUA_2G02590"
FT                   /product="Aspartyl-tRNA synthetase Dps1, putative "
FT                   /EC_number="6.1.1.12"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87356.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI000051F6A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI99"
FT                   /transl_table=1
FT                   /translation="MADSELPVRPKPEETPAAPPAEGAEKGPSKSALKKAAKEKAKAEK
FT                   AAARAAQEKAQAAAAEANDTAKGLYGKLPDSEDVVPSTKFSELGEDHYEKQVTVVARVD
FT                   NARVQSAKLAFLMLRQQGKKVQAVIAAAEPISRQMVKYTGGLNVNSIVQVTGIVKKPAI
FT                   PISSATLSDLEIHIQKVYMISEAAQMLPMQVKDAERPPPETTEEGNLVDAEGAPIVTLK
FT                   TRLDNRVLDLQTETSQAITWISSGVAELFAEYMIKSGSRWIFTPKLVGAATEGGSNVFE
FT                   VKYFKRNAYLAQSPQLYKQMCIAGDMESVFEIAPVFRAEDSNTHRHLTEFAGLDFEKTF
FT                   RSHYHEVLEFAENLLVFILSQLKERYKDQIAIIQKSYPKAGDFKLPKDGKALRLNYMDG
FT                   VALLKEAGVDVSEQERFENDLTTAMEKQLGQIIRDKYDTDFYVLDKFPMAVRPFYTKAC
FT                   PQDPRFSNSYDFFMRGEEIMSGAQRINDIKELEESMIAKGLDPKQEGFEDYLAAFRQGC
FT                   PPHAGGGLGLNRIVMFFLGLPNVRLASLFPRDPQRLRP"
FT   CDS_pept        join(668755..669002,669160..670234)
FT                   /codon_start=1
FT                   /gene_family="HOG000184390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267178"
FT                   /orf_name="AFUA_2G02600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87357.1"
FT                   /db_xref="HOGENOM:HBG052534"
FT                   /db_xref="UniParc:UPI000051F1CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI98"
FT                   /transl_table=1
FT                   /translation="MPEKRKPPTSASGLSPYSKRPRPSYAEEDDADEMTPALTPYERPR
FT                   NHPVYGQKSAFPGLDVDVEDELFYGEAEDGMEYLRMVRSEANSLPFLFTAPKPAGTPTE
FT                   TTKVVITEEQEPEPASAPLRDGIYADGVYIAAPAEPEIAQVATGPQEDKYSEAQSSYYN
FT                   LLHHRFLLLRSILKCTPPSSAIAALDDSHPISFPRHSKTARKEWRRLLLAVDPQTVQLA
FT                   CMDMDSVLAVLGIMARLMSENVRSGDAERVRRIGAWAWGLLGKCRDVGQLGTEEVGDIR
FT                   DLGKRAVKILQKMREEDEKTTAARRDGGLSNEESDDDEFQEDDHGQPENAQENDLAAEQ
FT                   IGHEMQDSDREPPAEDLDAAKARLQAMLQGNANETLEPDKSDNVDVANHAEESRKDSAI
FT                   EVAMQTRAMLDMIITVVGEYFGQRDLLKEREVWIGSSSPAT"
FT   CDS_pept        join(670750..671849,671902..671953)
FT                   /codon_start=1
FT                   /gene_family="HOG000042713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267179"
FT                   /orf_name="AFUA_2G02610"
FT                   /product="SNARE complex subunit (Vam7), putative "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="EAL87358.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG052535"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI000051FB6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI97"
FT                   /transl_table=1
FT                   /translation="MAPKVEISIPTTTTSHTSPPYTIYNITLRLPLRSFTISKRYSDFV
FT                   AFHTSLLNQTNAPPPAPLPGKHWFSNTVSNQVLREERRQGLESYLRAINEADDPRWRTC
FT                   SAWRAFLNLPSSAIGNGNGSTTTSAKLHAAITEPGAAGTQSAITDPTLWLDCYRDMKAH
FT                   LHDARLHLTRRDQETTPQKQHESSARAKSSLVRAGSLIGALEDGLKNLGDANADARSTA
FT                   SGKRGAWGSGNGLGDGEIRRRKDLLVNAKKEKNGLEDLLNAMAAKSRIDNAVASIQDKE
FT                   ALVGSASRKPPRSGRVLGKETERTRELDNQGVLQLQKRTMEDQDMSIEELRKIVQRQKE
FT                   LGIAINAELEIQNELLKLTDEDTDRYVLGKKIEIGNKRVGKIS"
FT   CDS_pept        join(complement(674753..674881),complement(674640..674694),
FT                   complement(674515..674581),complement(674399..674466),
FT                   complement(674168..674336),complement(674058..674118),
FT                   complement(673484..674005),complement(673041..673426),
FT                   complement(672777..672988),complement(672214..672722))
FT                   /codon_start=1
FT                   /gene_family="HOG000184379" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267180"
FT                   /gene_name="ku80"
FT                   /orf_name="AFUA_2G02620"
FT                   /product="ATP-dependent DNA helicase II subunit 2 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87359.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG052536"
FT                   /db_xref="HOGENOM:HBG332749"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR005160"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR014893"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI000051FB74"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI96"
FT                   /transl_table=1
FT                   /translation="MAEKEATVYIVDVGKSMGEKRNGRSMTDLEWAMQYVWDCITATVA
FT                   TGRKTATIGVIGLKTDETSNELDDDPHFKHISVFTEIQQFLMPDIRRLGALVKPSETDK
FT                   GDAISAIILAIQMIVTYCKKLKYKRKIVLVTNGQGWMSNEDLDQITKKIKEDNIDLVVL
FT                   GTDFDDPEYGFKEEGKDPRKAENEALLRGLVEDCNGAFGTLEQAVSEMDIPRAKRVRTV
FT                   ATFKGFLQLGNPEEYDTALRIPVERYYRTYVAKPPSASSFVLRSDVGAEGEQGESSQLP
FT                   KSPPEGGALTSVRNLRTYEVPDENAPGGKFDVEREELAKGYEYGRTAVHISETDENITT
FT                   LETYAALELVGFIQTDKYDRYMHMSTTNIIIGQRGNDKASLALSSFIHALFELECYAVA
FT                   RLVVKENKPPVMVLLAPSIEPDYECLLEVQLPFAEDVRTYRFPPLDKVITVSGKVVTEH
FT                   RNLPNKDLLDAMSEYVDSMELVDTDETGNPVEGLPIDDSFSPVLHRIDSAIRYRAIHPD
FT                   DPVLPPSKNLTKLSQPPQDLVEKSKAYLQKLMEAADVKKVPPKVKGRKRIRESEKPLSG
FT                   LDVDALLHQEKRARISPTNAIPEFKQTLTQAETIETIKDAVKQMTSIIEDQIKNSLGDA
FT                   NYDRVIEEMGVMREELISFEEPALYNDFLRQLKDKLLKEELGGDRRELWWLLRRSQLGL
FT                   INQRESDQSDVTEEQAKEVSLRCHLSSRGIY"
FT   CDS_pept        join(674955..675131,675418..675745,675800..675966)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057137"
FT                   /orf_name="AFUA_2G02630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87360.1"
FT                   /db_xref="HOGENOM:HBG052537"
FT                   /db_xref="UniParc:UPI000051EF52"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI95"
FT                   /transl_table=1
FT                   /translation="MHGQTRLSRQTRNISRLGVRQNAKAHDIINGRCVDIARSKCTYFG
FT                   SNEKPLHLSYSAGRLDIHYAVNSKAQQTFIGGVIAFRVLPRPQFSALQTSIFPVYFTLQ
FT                   SALPVVIALTSSKGGQLNGISGLLAPESRFGTLLPLATVAVSGLINQVILRPLTVRTMK
FT                   ERKHQETRDGKKSYDPAPHSKEMMALNKKFGRLHGLSSLINMVSLIATVYYGVVLSKRL
FT                   S"
FT   CDS_pept        676543..677871
FT                   /codon_start=1
FT                   /gene_family="HOG000216919" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267181"
FT                   /orf_name="AFUA_2G02640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87361.1"
FT                   /db_xref="HOGENOM:HBG052538"
FT                   /db_xref="UniParc:UPI000051FB91"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI94"
FT                   /transl_table=1
FT                   /translation="MSILSDAIVVVAVVSPMFISAVKSILEYLACANIYISKAFRWMSA
FT                   FKLDGILKKLDLWRELHTSNVKPFSASTPVPEFDNACLGTDNLHHKNHTFFDLDLGDLG
FT                   SLWLGRISQNLVPTSGHLNNGPTFGSLHSEVLLLNWQVLLFMMIFLLIIPAVTSICTWY
FT                   SRRHCFQVANIEILDFINEVRSWREFLFKRMSAAVSILNGKIDSMIKQIVMEHERVSAE
FT                   LPTFLDAEVRELRDALDTQFQNEDDHHILGVKNSADNLERARRRFPDPGGIEAECKGLQ
FT                   SVFQRWRQRMGNFLEHASSEAERSDNIQIPVKRIMELPEKAPTAQATQTKYEAMQDKVD
FT                   KNEPASLTVSEKQCSEAEEPISTMGLWATASGYPAPTPAEIEEGRRIRRERVAKRLTEN
FT                   NGQRYVRSESGPRKHRCLFRNRLHGLHKQDHAAARQSLNLTLH"
FT   CDS_pept        678733..682029
FT                   /codon_start=1
FT                   /gene_family="HOG000216920" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208464"
FT                   /orf_name="AFUA_2G02650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87362.1"
FT                   /db_xref="HOGENOM:HBG052539"
FT                   /db_xref="UniParc:UPI00005206F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI93"
FT                   /transl_table=1
FT                   /translation="MEATIFVLSSLATNLAGIYRQVPFTVVDPHHTFLERLVGSVQVSC
FT                   TIYTLRYWHPLVFPEAAKYESRCEGPCESPAQNTTIELGGMLKNLMDQYVQKSNLVIPR
FT                   PRNSGNSCSDQPPPLTTIHHTLFGRNFDIPVSQNSVDICWTVFFTALVLIAIILVLWKG
FT                   FTQGGCKHDTDTTSGQKSNKSADLSSEKEVLDWIRIARFAVVLDIKDDISHDSVNIRAK
FT                   IMEIPKNLRRFQSILQSDSMLAESKEGDDVERNKTTLAHVFDGHLRFCTETVKSTLEVL
FT                   NQLSRRVDHKINLQEQPVDSYGHSQGDQKLIDPTNEFSLYQQELLTKDTLEVTTSAMEK
FT                   RILGTVDDHTPALDEEAKKRIGIESALANISALHEETKRRIDNIESALVKVQQSLSVGV
FT                   VDQEQLNETVGGLKADMGNLRTSLQSLSREGSDSQVGVDTIVHEQLQSLENRVRSLERA
FT                   ASVTPLDKKQIEQELDELDQAVINMKNSHAEIQSKLDSTVTETQVKEALKQIAAHLEQE
FT                   TGGMKSQLRGLVEALDEVKHAAIQSKNNDPELAKQLEDIERAIDDSARKVQCFKKDLDT
FT                   HAVEHKSLREAVNRALEWNKELEDGIKQKISRVTETILETNARMHISTETRDKLEEYKW
FT                   HQRNMNMSIWGHLHKCMNALGIRFDLSAANLVTVHDKNQDPVEKPESNDEHLAAEHGAH
FT                   KTETDVADKWPSQDEAQAAGFGVQSLKKTAQPTKDEAKSPKGEAQIKEQIQTSDDQHCA
FT                   SAQSEPINPRTSNPASQAISGPKQSPVAGRSDEAVKHDKADTAQSRAEHNQEDEKGHES
FT                   ASYETHKEAIAQPKASVGTQSLQVPGSVKGRSSEKHAPEPLRLKIETHTSARHEKDQAS
FT                   AQLPSKPSIESTSAKLSKSRWALSTPTQPQSKTPTHGETEEGQLITPTLTEPPSKPITE
FT                   SISSGMSNSKWAPSTTTQAQPETLERTQSLQTSGSAEGKSSKKHTPRTPGLKQEASAFS
FT                   AKREKSKGADTASAQSPSKSSTESASAEMSKSRWASTPTQTQSKTPTHGGTKGDQPASS
FT                   ASTPEVPSKPPASGELSKSRWADDSPDAKRSKGVSLPSEKYPKGDLGETF"
FT   CDS_pept        join(complement(684586..684675),complement(684321..684521),
FT                   complement(684055..684233),complement(683830..683999),
FT                   complement(683407..683729),complement(683215..683351),
FT                   complement(682368..683157))
FT                   /codon_start=1
FT                   /gene_family="HOG000184377" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267182"
FT                   /orf_name="AFUA_2G02660"
FT                   /product="DNA topoisomerase III, putative "
FT                   /EC_number="5.99.1.2"
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL87363.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG286281"
FT                   /db_xref="HOGENOM:HBG525547"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="UniParc:UPI000051EAAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI92"
FT                   /transl_table=1
FT                   /translation="MPVPRILCVAEKPAIAKAVAQHLSGGSMQTISIHGNKYVKNYLFE
FT                   FNFGDPWGTCSVTMTSVLGHLMALDFESQYKSWLSCPPGALFEAPVREFVEEDNKPIAE
FT                   NIKEQARMSKALFIWTDCDREGEHIGTEVRKKAKEGNQRILVKRARFSNTERAHVLRAA
FT                   RALTDVDENQANAVAARIELDLRIGAAFTRLQSLQLQRMCADLSNKLISYGSCQFPTLG
FT                   FVVDRYLRVKNFKPETFWGIKVVHVQERKKVNFLWRRVHLFDRAAVTVMLERCLLAKTA
FT                   KVTKVNQKPTSKWRPLPLTTVDLQMMGSRYLRMDSSAVMKAAESLYTKGYISYPRTETD
FT                   QFDKGIDLKKLIEKQYPDTNWGEYARGLINGAFKTPRSGRHNDRAHPPIHPVCWVSPSA
FT                   LNSDEKKVYEFVVRRFLACCSDDAKGQSTEIEIQYGDEMFHANGLIVLEKNYLEVYIYD
FT                   KWESSQQLPNFRVGEVFVPTEANMFEGKTTAPNYLTEPELIGLMDANGIGTDATMAEHI
FT                   AKIKEREYVAVHSRGSGRNAVKEFIPTRLGIALVEGYDNVVANLPDKPSLSKPFLRKEM
FT                   ELRMREICAGSKSRQEVVQESLDMYREVFIHTQRRIDMLKAACRKYLIEQATV"
FT   CDS_pept        join(685087..685458,685514..686251)
FT                   /codon_start=1
FT                   /gene_family="HOG000184356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267183"
FT                   /orf_name="AFUA_2G02670"
FT                   /product="DUF1295 domain protein"
FT                   /protein_id="EAL87364.1"
FT                   /db_xref="HOGENOM:HBG052540"
FT                   /db_xref="HOGENOM:HBG288158"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniParc:UPI000052049E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI91"
FT                   /transl_table=1
FT                   /translation="MAIPLPQVHSVVDCASFNRTVLPFLSQLTTLPAQLQVAASTKDVD
FT                   SLKDIYLSTNPFISALGFTLVLWVLFAVAAEFNRNYSQVDRFWSILPSVYTVHFVAWAR
FT                   LWGIKNQSLDTIALITLLWGIRLTFNYWRKGGYQIGSEDYRWEIVKSHINNRFFLFLFN
FT                   VTFISLIQPLLLLLVTAPTYNFILLSRLPGAEPFGLPDLAFSRLAFFFLIIEYFADQQQ
FT                   WNFQSAKKEYQKTARIPDQYKGQFTPEDLERGFVVSGLWSLSRHPNFVAEQAIWLTLYL
FT                   WNCYRTGSYIQWTGLGILGYMLIFQSSTRLTESISAGKYPEYSEYQARVGRFIPRFSVK
FT                   PKYNGSKKKTSRSKTESAGTATQEGKKSQ"
FT   CDS_pept        join(complement(687644..689522),complement(686807..687585))
FT                   /codon_start=1
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267184"
FT                   /orf_name="AFUA_2G02680"
FT                   /product="Mitochondrial inner membrane AAA protease Yta12,
FT                   putative"
FT                   /EC_number="3.4.24.-"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87365.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI000051EF43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI90"
FT                   /transl_table=1
FT                   /translation="MATLLRRPGNLARYSRRAAECINRTRPLSARAPQSRLSSLITAHR
FT                   VRTYATGTPGGPNPPNDKRSQNKAATGPGNDGGKSGDGKTPNDPESSLSKEEQEQVNLF
FT                   VDHLKNKVPPSQHQMLDDIRTLLLREGLPAEMRQFIEKHVQSGRPASLMDYVKLTRYMS
FT                   QHMTDYAYKLNQIEEERNKEKAKSEGGAQGEQQKQQQQQEQQREQKKGRDQANKQIPPN
FT                   FRTFEIKFDPASFLITSLITYYVYRSFFPGENGKEITWQEFRANFFDKGLVEKLTVVNR
FT                   AVVKVDLHRDALARVYPDSPALQPNFRYYFSIGSVDSFERRLDEAQDELGIPSSERIPV
FT                   AYVDEVPWFTTFLSVAPTLFVIGTFFWLSRRAAGGAGGQSGIFGMGRSRAKRFNHETDI
FT                   KIKFSDVAGMDEAKVEIMEFVSFLKTPEKFQKLGAKIPRGAILSGPPGTGKTLLAKATA
FT                   GESGVPFFSVSGSEFVEMFVGVGPSRVRDLFANARKNAPCIIFIDEIDAIGKSRAKQGF
FT                   SGGNDERESTLNQILTEMDGFNTTEQVVVLAGTNRPDVLDKALMRPGRFDRHITIDRPT
FT                   MEGRKQIFRVHLKKIVTKEDMDYLEGRLAALTPGFAGADIANCVNEAALVAARENAESI
FT                   TMKHFEQAIERVVGGLEKKSLVLSPEEKRTVAYHEAGHAICGWYFRWADPLLKVSIIPR
FT                   GQGALGYAQYLPAGGDTYLMNVNQLMDRMAMTLGGRVSEELHFDTVTSGASDDFNKVTR
FT                   MATAMVTKFGMSPKLKYIYYEEDPQQQLHKPFSEDTAREIDSEVRRIVNEAYNQCRALL
FT                   TEKKKEVGIVAEELLAKEVLSRDDMIRLLGPRPYPDSGEFAKYFGAANGQTIAPPEPTP
FT                   PIEGGSESGAKPPS"
FT   CDS_pept        join(complement(691884..692783),complement(691650..691825),
FT                   complement(691034..691597),complement(690239..690911))
FT                   /codon_start=1
FT                   /gene_family="HOG000184345" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903883"
FT                   /orf_name="AFUA_2G02690"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87366.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052542"
FT                   /db_xref="HOGENOM:HBG332817"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005206E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI89"
FT                   /transl_table=1
FT                   /translation="MESLLRLSGLLSEDDGGKTDLGTLEKRLADRYHASGSNTPHNPQK
FT                   INIPSQSQIAMSQQNSSSHYSTPRLESQSSPRTAATSPESQKESETEVEGLSDMMCSLV
FT                   TNNCGETRYIGNHLDNGHCWYDNLLTVLITGSSSGFSIFSPKGIQWVNEKTGDNSFQEM
FT                   ISSAYVDDNKWMYWKPEIFSDIFARRVFKPLPPKDEAMSLFKDFFDNFNCMFPLYHEPT
FT                   FMHLVERQYSRDPYEGSGWWASINVVLAIAHRLRVMSNLVPQEEDRKAWLYLKNAMGVL
FT                   TELTMRNTDLLSVQALLGMSLFLQGTPNPQPSFFLVAAAIRLSHSIGLHKRGSGFGLNP
FT                   VEVEQRKRVFWIAYLLDKDICLRSGRPPVQDDDDMNVELPSDDPPDNIGNVPLSDGRSK
FT                   FNLFRSMCRFATIESKVYKRLYSAKASKQSDGELLNTIGELDKELEDWKDSIPLDFRPE
FT                   HEIKASHTPLILHVVVLHFAYYNCLTTIHRMSVHHGYWTSRLSNYAIQGLNARPLNPRV
FT                   FLSAVLCVTAARASINLIKYIPQGDFACVCDARARSDVKLMNVVVNFLSTLVSDESNGS
FT                   IKRMLGLCGEFERIAKVVLDKAEKESYSKKKRKSPEEPVNLQQSTPEEHPAPSPSTTQP
FT                   TQAPSRNVPMSSPLFAENPGDPGGNTMADDAGGFASSREIPGTTGVSTNIPPNIQAMPG
FT                   IAQDYQDMLSPDPLEGVSFADQPPYSATANTPLSSFQQPFVPQDLWQMPMTIEWDWADM
FT                   STNFPVFDTNGPPHGGL"
FT   CDS_pept        join(complement(695375..695425),complement(695232..695305),
FT                   complement(695115..695168),complement(694923..695061))
FT                   /codon_start=1
FT                   /gene_family="HOG000115841" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903884"
FT                   /gene_name="pam18"
FT                   /gene_synonym="tim14"
FT                   /orf_name="AFUA_2G02700"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit tim14"
FT                   /function="heat shock protein binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL87367.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG435009"
FT                   /db_xref="HOGENOM:HBG526913"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI000051F1AF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI88"
FT                   /transl_table=1
FT                   /translation="MASTFAIGLGVATAAFLGRAGYVALRRYQGGINAMGKAFYKGGFE
FT                   PRMTRREAALILELPERTLNKEKVRKKHRQLMLLNHPDRGGSPYLATKINEAKEFLDKH
FT                   I"
FT   CDS_pept        join(695694..695725,695779..695840,695899..696371)
FT                   /codon_start=1
FT                   /gene_family="HOG000184344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903885"
FT                   /orf_name="AFUA_2G02710"
FT                   /product="60S ribosomal protein L24b "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87368.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniParc:UPI000051FDCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI87"
FT                   /transl_table=1
FT                   /translation="MRVETCHFCSRPVYPSKGITFVRNDAKSFRFCRSKCHANFKMKRQ
FT                   PRKLKWTKTHRAARGKEMIVDSSLVLSQFAKKRNIPVKYDRNLVAATIKAMERVEEIRA
FT                   RRERAFTKRRLGGKLARERKREEDRRVVAEGEHLIRKELREREEGQPLDVSKISSRVVG
FT                   EEKLRQKKKTRLLVDGGVEEEMDLD"
FT   CDS_pept        697018..698415
FT                   /codon_start=1
FT                   /gene_family="HOG000184321" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267185"
FT                   /orf_name="AFUA_2G02720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87369.1"
FT                   /db_xref="HOGENOM:HBG052543"
FT                   /db_xref="UniParc:UPI000051EF53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI86"
FT                   /transl_table=1
FT                   /translation="MLLLFVGGFIFLTLWGSFFQVPGNNDSHGRFVRTISDAVGATALA
FT                   KGIYDLAEAITSTYTAPGHKELLYVRSTGFPSPAAHVGFPNATGTRKSTISVAIPLWEV
FT                   ADVLQICVDSSPVGYDTAASNSPTSSSHAGLIVAWGLLAFIALLCKGLLSYGVSALGDK
FT                   LGWLGQFLEGTPKVAHCLAADSAPSLYEEVDALVEGKMPSGVAVSSSDVDALTISTIVA
FT                   PLEEQQTWRFVSIHPEVEKAISRSERQRIVTVSMELDSCTVKGLKVNTNGVVDGLTGTA
FT                   RGASDVVGSSALHPSRKWALVLRRPENLSPILVLQVVCVFLAGWESHTASAAPDSPGSQ
FT                   VAEEPEADAERAPTPGSRRRKRPSQAKRRRYARRLRELEEGLNGAAHETPSPAARPTAC
FT                   DPPAPNQSRAPLVVGNRVPSQDARHGQFGGPRPAPTPVMGVYPSPYDWQQPMYSQSPPY
FT                   YYYYGQY"
FT   CDS_pept        join(complement(702008..702609),complement(700965..701808))
FT                   /codon_start=1
FT                   /gene_family="HOG000184310" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208465"
FT                   /orf_name="AFUA_2G02730"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87370.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052544"
FT                   /db_xref="HOGENOM:HBG332818"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051E5EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI85"
FT                   /transl_table=1
FT                   /translation="MNDRLEMTALTDVPAPYLKELSLSRPLPQSTPRHHAHSISLGAVN
FT                   HNHRVTRRKSVTTTAAANAAAAVAASMKDTNGEPIGVPMPSHRRSSTRRGLESTSVGAP
FT                   SGFGHYLSRSMNSPSQEPAVARKPSPNHSNIGASSVAAAGGEESSSDNKPVNTKSRNRR
FT                   ASEGSHLVKGEGKRALAELRCDRCGKGYKHGSCLSKHMWEHDPAWAITSKLLISKHQQV
FT                   QLLEAASVLVNMNQHAPSESAEAESDQSSASPDTSSELRDGISSAETTPPPMDEDDENE
FT                   EDMEMSGMPVFPNKRYSVGNVSAQYSHSYQSVPSSSFNGDAPLHSPAFSHFRHSSIDTR
FT                   PSTAEAKLHEDDEADLAAAIGLCNFGTPRTRPVPMSPGIPPVPPLPSRYLDLSNGTGSI
FT                   SQSLDPAATVNATSSLTESTPNIFLSVSYNPSLSYKISDEREVKMGDADRVQRQNRNAD
FT                   VDFSNRPAHADDDDDGVFGRMEE"
FT   CDS_pept        complement(704903..705352)
FT                   /codon_start=1
FT                   /gene_family="HOG000048350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267186"
FT                   /orf_name="AFUA_2G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87371.1"
FT                   /db_xref="HOGENOM:HBG052545"
FT                   /db_xref="UniParc:UPI000051EF44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI84"
FT                   /transl_table=1
FT                   /translation="MKKSRRKRSNHAVGEKHLVFTSVGVTSRDKYRYTPEEVGKQVSAS
FT                   LVLNHRPFLRQGHNIFGPFLTLAKARTHRHGIYEAGMRSRNPRIFIAFQVGRLHLEIRA
FT                   LVQKPKKLEDGGVLAGEGKKPRSDIEKFEAIRRNGGGRSGHGKES"
FT   CDS_pept        join(complement(706941..706999),complement(705750..706758))
FT                   /codon_start=1
FT                   /gene_family="HOG000184298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903886"
FT                   /orf_name="AFUA_2G02750"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL87372.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG326187"
FT                   /db_xref="HOGENOM:HBG396293"
FT                   /db_xref="UniParc:UPI0000520707"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI83"
FT                   /transl_table=1
FT                   /translation="MADENHPAHLSPSELGTKNYWETYYARTLAHLSSKHQPNARPTPT
FT                   ADADADSAESESETESVDDDDDPGTSWFSEHKAPEKVLRFLTDESFPLAPCNTLPATST
FT                   AKTAAKKPQSDEERGRQPSILDLGTGNGSMLALLRKRGGFRGVMVGVDYSARSVELARE
FT                   LQRLKIHSAYLSGSESEGEEQEEGEEEDVVVSNGAETAEAIPVPEEDKDMMIRFEEWDI
FT                   LNSEGQLEGEGRLDWFPYAQGGFDIVLDKGTFDAVSLSEEVVVEGKSEGKVIQRRVCER
FT                   YPSIARRLVRKGGFLVVTSCNWTEEELVRWFTGEEAKGPGADRLEVWGRVEYPKFRFGG
FT                   QEGQGVCTVCFQRVD"
FT   CDS_pept        complement(707855..710185)
FT                   /codon_start=1
FT                   /gene_family="HOG000184277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751785"
FT                   /orf_name="AFUA_2G02760"
FT                   /product="Protein-tyrosine phosphatase, putative "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="EAL87373.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG052546"
FT                   /db_xref="HOGENOM:HBG332821"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI0000520002"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI82"
FT                   /transl_table=1
FT                   /translation="MEVGKMDADRSSSKRSFAQVASATLLSFQLSGCNQCTSVFAPAPR
FT                   ESCDPESVSPFKRRSTSRPWSIMPVQTSPPSLPDSFPSLMSVFGGISPKFAEGGEHSAA
FT                   LKPLRVPPHVTINTSRRPLPFRHRTSISSVTSGSTDSSPTTTISTFDSPVAADTTPSSS
FT                   PESPSAMPLSFPKFMPPSRNIEHQSLSGEPSTMSKPSQDVISRARPDSPGRRARNLKNL
FT                   SLRMPPPSQSSRPAIATASVVETASQRNLSAPPSPAHIPPKSSRRKPANLTIQTPGLDR
FT                   SFSSNVMEMVPPTPGGLHSLRHTESSPSLTSVFSPSFGPKGGMQLPRPVTHHGSRRPSG
FT                   ASEHNFSPIQSAVEEGSPVGGVLHELEEEEDHLDSRESTRQNERGYPNGPVQIYDSGVY
FT                   LYLEPTMQEAAQFDVVVNVAKEVANPFANAQGDNGTVMSAWRSASAGANRSSTAEPPTA
FT                   VSEVSFKSAFEYLPSETESPVTPCSDSSRPEYIHVGWDHNSEILDDLLPLCQLIDSRVS
FT                   QGKKVLIHCQLGASRSASLVIAYGLYKNRHLDFNSMYEIVKGRSRWVGPNMSLIYQLTD
FT                   FRSRLQQLSGTSKPAPEEWFVNGPRRGSEPQSSRSERTTEASLTPPSSSSCNSGYSRIA
FT                   TPASWSQTSSGTLSVPSTERATPPSVSPWRIPKSLSHKRSLSPRPLPLRQRFETAQTAA
FT                   KDVGTRSLAPADAIEKDTVEDPLNLFSPRTSQFLAPSLAPPFPDGLEDRLPGGPHFRTE
FT                   TADPRSPPPGNERLIMRNIDEFL"
FT   CDS_pept        join(716490..717665,717766..719616)
FT                   /codon_start=1
FT                   /gene_family="HOG000184266" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267187"
FT                   /orf_name="AFUA_2G02770"
FT                   /product="LPXTG-motif cell wall anchor domain protein,
FT                   putative"
FT                   /protein_id="EAL87374.1"
FT                   /db_xref="HOGENOM:HBG052547"
FT                   /db_xref="UniParc:UPI00005206E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI81"
FT                   /transl_table=1
FT                   /translation="MSKDVTFSPVSTIIPRSPPNDPTNPYIRRRRRQTDSAVVLKRTTH
FT                   GPQRDQHPILARRSIANPDWAADSIPSFFSPTISSVSSRLSLTGSSAGPTKTEDSQKRR
FT                   QTARHDLDDRQHNQDSGYKSHRDDQSIARTKVFSRQTIMFAAASRDTGRAATLISAGPS
FT                   ASPSVPGTTTTTPANSTSSSASHPYPSSASPPRLPQSRFSFEYQPPRHKQALPTSASFP
FT                   SEIPSDTDPTPNPQRAFLYDRSRRSVSTFSTSRVRKSTALASPSQLPSPLSISEKSSDL
FT                   PLPFDANSIDNALSFNASKRRRKQSLSQSQQESQADVKRRMPVSTATYVQGSPQASDRD
FT                   RAIHDLDQTDQEDGARTPVAEDSKSKNEDIFLNIARSDSKRRDSLGRSEHRRSRLGLSN
FT                   GHLRSPNSRLNEQTSSPGQLRLSTYDTPLHSLNNSPSNPYSALPYSYSASAHPLDDHPR
FT                   SRHSVVGSSSRSTLGISRSRLGQASPDSSPYSAELHIERRGSLQDPRVYRHSALASLRT
FT                   SRQASGSDVTERPRPEPERSRHDGTESTLSTTAPSTVWDELEDLKSRIKKLELTGKLPP
FT                   SSQAAISTASGERPRTATTTVTTVSSSPNYNHKISPSGAETEASTATNPVHPLLQSALL
FT                   KARDVLNNEVYKSLEAAVTDALALSSLLGTNKAPSGGVSVVNGYSSSDRQSRRKADSVC
FT                   RSLTELCLALSDEQLSKQQMPASDDDTITQLHTSSNEESSTLNRSLRRSMTLEPGIPGR
FT                   QKSTTHVTSRLEARRQSLATANGNSSIKKDLSALPDGNSPSSPSASAPKSRLSRLSASL
FT                   RSKRLQPEDADTDLPSPHSRSISRAMTDIDNSAAAQRLSPRQQVAHGYTTSQQVSDPQR
FT                   PQGSRLSYQSTRTQLQQPRTPTAPQSSIPLRRSLAIPANYTPTTSRLNILAGSRRYGTS
FT                   GIPSAAGDGSVPDGQSDGMSSQQGLCQTRITAPSSKQAASYTPIQQNRVRANSLGVRTY
FT                   GLRQRPTATHEDPLDVSID"
FT   CDS_pept        join(complement(721975..722347),complement(721173..721867))
FT                   /codon_start=1
FT                   /gene_family="HOG000184255" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267188"
FT                   /orf_name="AFUA_2G02780"
FT                   /product="KH domain RNA-binding protein "
FT                   /function="RNA binding"
FT                   /protein_id="EAL87375.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG159228"
FT                   /db_xref="HOGENOM:HBG397524"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI0000520234"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI80"
FT                   /transl_table=1
FT                   /translation="MRDAPPVDETMADAVNVADEGDMEVTPKTEEEYAQSMLTLRAIVS
FT                   SKEAGVIIGKAGKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGPLQGTARAYALVAKG
FT                   LLEGAPQMGMGGIVNNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEM
FT                   LPQSTERIVEVQGTPEGIEKAVWEIGKCLIDDWQRGTGTILYNPAVRASVGGSTSMNTS
FT                   SVGNGYSSRPYNRTGNGADFSDGQSGGYGRRSNPDTSNRGYPLVTEDGEEIQTQNISIP
FT                   ADMVGCIIGRGGSKITEIRRSSGARISIAKAPHDETGERMFTIMGSAQANEKALYLLYE
FT                   NLEAEKTRRSQLPQE"
FT   CDS_pept        join(complement(724558..724687),complement(724365..724525),
FT                   complement(724171..724278),complement(723649..724113),
FT                   complement(723471..723592),complement(723289..723391))
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267189"
FT                   /orf_name="AFUA_2G02810"
FT                   /product="Alcohol dehydrogenase, zinc-containing, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87376.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E5E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI79"
FT                   /transl_table=1
FT                   /translation="MATKDTMRGVVFHEPFKVAVEERPVPKIQDSADIVVKVTYTALLI
FT                   VYVLIEPGGGSDLHTYRGIEPSGSGFIMGHEFTGVVVETGDAVTKFQKGDKVTNNSGKC
FT                   FYCKQGYSSRCEENILFGCEALDGGQAEYVRIPNAEGTAMKAPEGIDEKFLVLMGDIFP
FT                   TGYFAASNAFKGRTPEQISEQTVVLIGCGPVGMCALINALEFKPKHLLAVDSVPSRLEL
FT                   ARSLGAEPWNFKTDGEGLRKRVEELTNGRGADAVIEVVGLSPALRTGFDLLRPWGILSS
FT                   VGVHNGEIPWNGSEAYGKNLIVQMGRCPVRSVSEAALEVLKKNQHLLGFMTENIMPLSR
FT                   AAEAYELFNAMKVQKVIFEADK"
FT   CDS_pept        join(complement(725804..725902),complement(725497..725730))
FT                   /codon_start=1
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267190"
FT                   /orf_name="AFUA_2G02820"
FT                   /product="Yippee zinc-binding protein Moh1, putative "
FT                   /protein_id="EAL87379.1"
FT                   /db_xref="HOGENOM:HBG268212"
FT                   /db_xref="HOGENOM:HBG524054"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI0000520244"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI76"
FT                   /transl_table=1
FT                   /translation="MGLAYNVYLTSNKIFGCKKCKTHLADYNDIISRNFRGQHGKAYLF
FT                   NTVVNVTHSEAVERNMTTGRHIVRDIFCRQCAELVGWKYDKAYESSEKYKEGKFILEEE
FT                   LLCVVC"
FT   CDS_pept        complement(726947..728323)
FT                   /codon_start=1
FT                   /gene_family="HOG000184233" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267191"
FT                   /orf_name="AFUA_2G02830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87380.1"
FT                   /db_xref="HOGENOM:HBG052551"
FT                   /db_xref="HOGENOM:HBG332824"
FT                   /db_xref="UniParc:UPI00005206EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI75"
FT                   /transl_table=1
FT                   /translation="MSADLFAEFGIKAPAVQPSNVSHQRQQGSQAHPLIPDLDVLDVVS
FT                   SNPRTDVQDQASSSYINKSQASPNQFALASTADFPKLQDYSNGSNVVLFDATLESMPDD
FT                   EDEDWGEFESAESAIGKNQPAARFQQQDGLRDSQSRNKDATTLIDMMDTPSIADSKLPN
FT                   ASKPAVKQPIDKPRSHMKAADPTAVPDPVQDDSFEDWGEFIDGPPAEVKPTKFQSFSKS
FT                   RSPQGKIAQARTTVITPPSFTIPGEKVSESQIRPTNIPPPSVLLELFPRLFEQLREEAT
FT                   KTRRGLQQEVQVETAASLVLCTLKVVARVVAGRTLRWKRDTILSQSMRIGPARSGKPGG
FT                   MKLSTVNKNENIKEQQEAVDVLTMWRDQAALFNSVIQASGRQPVQAIAENTRVVTATAA
FT                   EGAIKAPHACALCGLKRDERLPKIDENVQDSFGEWWVEHWGHSECKGFWETNMGLLAQR
FT                   "
FT   CDS_pept        join(729153..729742,729820..729962,730022..731211)
FT                   /codon_start=1
FT                   /gene_family="HOG000184222" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208466"
FT                   /orf_name="AFUA_2G02840"
FT                   /product="TBC domain protein, putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87381.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG052552"
FT                   /db_xref="HOGENOM:HBG332826"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI000051F68F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI74"
FT                   /transl_table=1
FT                   /translation="MLLLVCYRGLSFARTSDPVFCRKKSPWQTLRQDEQMRADISQDVD
FT                   RCLQENYFFREPATKAKMIDILFIYAKLNPDLGYRQGMHELLAPILWVIHGDAVDGKVL
FT                   EESSVKEEGDDLMLHLLNFDYVEHDSFALFCSVMQTTRVYYEHNKERSANGQMDEIPIV
FT                   NQCQHIHQNLLTTTDLELADHLQALEILPQIFLTRWMRLLFGREFPFQDVLSLWDILFA
FT                   EGLRSELIEFTCVAMLLRIRWQLLSAGYSSALTTLLRYPSPQPHSPQAFVHDGLYLEQN
FT                   PTPERGRFLISKYSGKPPDPTKTLDRSGERFLSLRRFHFRNDSREDSQTSSPSRSPARS
FT                   SPKSFESLLQDFSEGLQRRTESWGVAKAVRGAVSEARRNMQAMQPERFPRTAVYDSTPS
FT                   AVHRRNLSKSEEPERVSILKAQIQTLEERNKSLAKTLSKALNDIRTELMKAEDLKTTTA
FT                   DALRQALTQIQSVQTCLEDPSKALITVVGRESATNATSLNVPSQPPISTDKEAEDGGAK
FT                   EGQQAPSDPGWPSVSSIAVENKVHKLPSSNKVPSSLPLRPAARSSLADSEFSWMLGGNR
FT                   HLSSFVSPASVPPEETRYGDTRNKPHTLFGNGADEQQRYSDEVDSLALRSLGGAKVQGQ
FT                   SNSTY"
FT   CDS_pept        join(733381..733427,733537..736433,736496..736764)
FT                   /codon_start=1
FT                   /gene_family="HOG000184207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267192"
FT                   /orf_name="AFUA_2G02850"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="signal transducer activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87382.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG052553"
FT                   /db_xref="HOGENOM:HBG332828"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000052024A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI73"
FT                   /transl_table=1
FT                   /translation="MKLSVDSLPSGYDLSRSSLLEHEHGLGPSGLDRIRQPPSRTLNLP
FT                   NRSASSLVPLSPQSNTPSRRSSTASKPSLMRISSNDSISTLEDLHRFPLESLHSFSFAQ
FT                   QSDELLNSRHNILKRSIDFMRDRFGWSAGNSAIANAQARMAGDAEAQSMVELMSKTSIA
FT                   GKDDRHNYAGLSRGPLTSPADVDSGNIFDQAFTGPGGSAIESKATRQGHDASGGNLLST
FT                   GNIPHQRREMKSAPSSRRVSLKRTYTDASSVCSQNKLMENLAQPYSIADSVTSASSSIL
FT                   GLGLPVPALHTHSSKWNPISQAVFRTESQAPWTILAANDLSCLVFGVTQSELRRLSILE
FT                   VVQPDHRQWLESKLRDPKTSAAAKLQPLAERSQIRPVHPKSMGMGNGVTAQLLSKPPSR
FT                   MAKSGRAQTDDGYGSSKRNSRHLNHPATKSRGVLLCGDVIPIQKRNGTKGSASVWVMEK
FT                   RGGLIWVLEEIQENVAYIFCDDSWTITGTRGETDKIWGQGVVKLGSHITDLLPHLPTDC
FT                   LKASPSKGIPKLADIKYFAARASAEICIPAIVGKEEDPRCLRVSSFPHVAGMMVLSSST
FT                   LKVISSNPVFSSALFGHARPEGMHVNDLIPGFDTLLNVLSEEENLPLVEGVVIPEPSFR
FT                   RARTLSILRDGKANVASVFLEPMGITAAHRDGSTIAVDVQLRVVESETFFRQNHSEDTE
FT                   SHDESSDYQEDAIAIKELVYALWVTYSRKIHSIGPSATFPPPRQRSETASPSIARSPGL
FT                   EKPSLEPRIPSSTLSQQLSEAASEPLTDRPVQPVPEVNHAKAKENQKKRTIADYVILEE
FT                   MGQGAYGEVKLARLKKNPSKKVVLKYVTKKRILVDTWTRDRRLGTVPLEIHVLDYLRRD
FT                   GLKHPNIVEMEGFFEDDVNYYIEMMPHGLPGMDLFDYIELKVNMDEVECRNIFRQVVDA
FT                   IHHLHTKALVVHRDIKDENVILDGEGRIKIIDFGSAAYIKNGPFDVFVGTIDYAAPEVL
FT                   QGKSYRGKEQDIWALGILLYTIVYKENPFYNIDEILDHPLRIPFLPFSEDCIDLIKKML
FT                   DRDVDNRLTITEVMEHPWMLYN"
FT   CDS_pept        739810..741993
FT                   /codon_start=1
FT                   /gene_family="HOG000184196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903887"
FT                   /orf_name="AFUA_2G02860"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87383.1"
FT                   /db_xref="HOGENOM:HBG052554"
FT                   /db_xref="HOGENOM:HBG332831"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051F8F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI72"
FT                   /transl_table=1
FT                   /translation="MAAAFPDEIEPSPGAVSPASPTSSTGQIPIEQPQKLKGRHKLLQS
FT                   LQRMSSSPSLTRRGRSHSTGYRRDGKASLSCVSLGQSAYNPCLGNGSSSQLYGGLNVRP
FT                   VTPGSQGEHTDGNARIRLVGTDPPNGSNAKTIPLPTELRPASRGSPLEFAPVEETVVTE
FT                   QPASEPKVVFDFWGRMPDEIKMNILRYLTPKEIVRCSAVSRAWHKMCFDGQLWTCVDAA
FT                   DYYREIPSDSLVKLMTSGGPFVRDLNLRGCIQLREKWATEGERITDLCRNIVNFSLEGC
FT                   RIDKTSIHCFLLRNPRLQYINVSGLSTVTNSAMKIIAQKCPHLEILNISWCTGVNTTGL
FT                   RKVIQACPRLKDLRASEISGFHDEEFTLELFRRNTLERLIISRTDLTDDSLKVLMHGID
FT                   PEIDVLTDRPIVPPRRLKHLDVHQCPELTDVGVKSLAHNVPELEGLQLSQCPQLSDDSV
FT                   IDVIRTTPLLTHLELEDLEQLTNNTLVELAKCPCAERLEHLNISYCESIGDVGMLQVMK
FT                   SCPNIRFVEMDNTRISDLTLMEASFRVRKRGYSENLPKVGLRLVVFDCANVTWAGVKEV
FT                   LSSNAYIPRSRKPSSAVTAVTRELEEDNSPTTAMMSTSSITPPPPPPVFPNEIIQLKCF
FT                   YGWQMTVDEHNKRVLRGDLAAASRLDRKWADYMMATEEAGAGGAGARRRRRRAREAERL
FT                   YNADDDEDAYGIGGISALGGRRRRAQSGGCTVM"
FT   CDS_pept        join(complement(743482..743812),complement(742795..743423))
FT                   /codon_start=1
FT                   /gene_family="HOG000048352" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057138"
FT                   /gene_name="efg1"
FT                   /orf_name="AFUA_2G02870"
FT                   /product="rRNA-processing protein efg1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL87384.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG052555"
FT                   /db_xref="HOGENOM:HBG332832"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI000051FB75"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI71"
FT                   /transl_table=1
FT                   /translation="MPREFSREKRAHSDSTTTSKRKYHEGSEDSQPAKKKKVHPPKHEH
FT                   NYPSVNELKKRIRDVKRLLNRVDLPADARIVQERALAGYEKDLEDELARRHRSQMIKKY
FT                   HFVRFLDRKAASKDLKRLLRREQEISNSDLDPAAKKEKLAALAGKIHAAQVNHNYTIYY
FT                   PLTQKYVALYAEQKKKKKESSAQSEKPSEPEAEVASKLIYDTTGERPPMWRVVEKCMED
FT                   GTLDLLREGKLDGSEKGEKSSQAPEQKKSKKSTDDDQYARNKSSTEKVSDKPSGKSRKS
FT                   GGKQDRKPKRSAAMEGAYWSANEHDDDDIESDGGFFEA"
FT   CDS_pept        join(744231..744777,744861..745853,745906..745998,
FT                   746049..747325)
FT                   /codon_start=1
FT                   /gene_family="HOG000184185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751786"
FT                   /orf_name="AFUA_2G02880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87385.1"
FT                   /db_xref="HOGENOM:HBG052556"
FT                   /db_xref="HOGENOM:HBG332833"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000051E5FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI70"
FT                   /transl_table=1
FT                   /translation="METAIRWSPSSNTAEQRFLLVDVTGKTFRLCRVTGFDGKNLEHEV
FT                   LLTHTKVPAFRAFDWSPVDESLVAVGQSSGDATVLRLSSENAESISFPIRHQRYCNAVS
FT                   FSRHGLLAAGLDRVRNDFCLNIWDVNQRMINKSAKGYVEPLRKLASSEPITSVKFFRDQ
FT                   PDVLVTGVKGQYVRIYDLREGPGHPSLQFPTRCVHNLAIDSLDENYIASCYPTNDPTIC
FT                   LWDRRASSRFNVTGGANMLESGYSGPALEFKNAFGPKTSLWSLRFSKTKRGCLGALSNT
FT                   GSFKTFDIVKEYLSEEYRMSVEETLGQGSFHTYPEQIYTKSIRDVLSPFDHPTRGCKES
FT                   DRIVAFDFLNLSTSSEPTAITLAGNGQVSLVTVQLPCPPVRLSSQGVLIRGSSENHLDF
FT                   TELRPAFGDQTKVSEVVENIREANLAALEERKVSQGGRAARSESRVRDPFSSRESRERN
FT                   LSLGTLGQPLTAEEALALLTVNRLRCKEGYLFDETRNKQILADDPQLQCLWDWVERARS
FT                   DSSDESMIINGLDFNYLGIYDVWNNDLGQSYDSRHIGPSGDEPPSISESIIGIVREQLR
FT                   LPESKGCQTARPEHRRLCLRLCGAAQSHRELEELVKMLSADNQHTKAAALAVFQDEAKL
FT                   AYQALRSHTPTQAHKLLAMAIAGAAKGDTDSDWEETCAEIAKELTDPYARAILALVSKG
FT                   DWKSVIHESTLPLRYRIEVALRWLPDAELSGYLKETIAEVIRQGDIEGIVLTGLGHSAL
FT                   DLFQSYINKFNDVQTPVLAMSHTVPRFIRTGWGRARYEAWRETYRWQMNSWKLQLERAR
FT                   FDVGSRKFAVTWDGRKLVEPPRQQVSLTCNYCTRPLTQHDASSQFSPSASGEGAHQTAG
FT                   NPLGTAVMSGMVCARCGRPMPRCGVCTLWMGSPDPMSRACIAADAGQEQRKPTEADIMR
FT                   RFIVFCINCNHGFHAHHAREWFAKHKVCPVAECSCICDR"
FT   CDS_pept        join(748081..748227,748289..749182)
FT                   /codon_start=1
FT                   /gene_family="HOG000229875" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267193"
FT                   /orf_name="AFUA_2G02890"
FT                   /product="TRNA splicing 2' phosphotransferase 1 "
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="EAL87386.1"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG052558"
FT                   /db_xref="HOGENOM:HBG332834"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="UniParc:UPI000051E3A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI69"
FT                   /transl_table=1
FT                   /translation="MSQNQRRGRGGNQSREVTISKALSLLLRHAAEKEGLKMDSQGYAN
FT                   VADVLAWKKLKSLKVTLPEIIHAVASSDKKRFALLHIPSAKALSDKTTTGAREGETPVC
FT                   ETEPSSMPTSQVPTTSAGQENATATALAVNDTDPSHFLIRATQGHSIKSVDAAAFLERL
FT                   TLEDESRLPDTVVHGTYHPVWPAILQSGGLRCMGRNQVHFATGPSVESVLPAHVDGTAH
FT                   SAMGSSGLNDGRVISGMRRDAQILIYIDIKKAMAAGCPFWRSENGVILSEGVDVGENQE
FT                   VGDGASQKIIPLEFFDVVVERKCGLGKIWERGQTIKELPEELLQKGNPKGPKARLDGRR
FT                   GSKRNG"
FT   CDS_pept        join(749813..750060,750135..750496,750568..750635,
FT                   750690..750875)
FT                   /codon_start=1
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267194"
FT                   /orf_name="AFUA_2G02910"
FT                   /product="Catechol dioxygenase, putative "
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87388.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG109213"
FT                   /db_xref="HOGENOM:HBG429220"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI000051EF45"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI67"
FT                   /transl_table=1
FT                   /translation="MATHRFDPNFTDNVINAMGPKTNPRFRKVMASLIRHVHDFARENE
FT                   LTVDEWMAGVKLLNWAGQMSDDKRNEGQLVCDVIGLESLVDEITFKLADEAADAPTATA
FT                   ILGPFFRADTPYRNNGDNIVKDVPDGEMVFMHGRVIDFQTKKPLVGATVEVWQASTNGL
FT                   YEQQDPNQEEFNLRGKFKTDADGRYYFYCLRPTPYPVPNDGPAGKLLELMDRHPFRPAH
FT                   IHIIATHDGYKPLTTQIFDRQDKYLTNDSVFAVKDSLIVDFVPRKDDPQAGLELEYDVK
FT                   LVADQA"
FT   CDS_pept        join(complement(751589..752021),complement(751163..751524))
FT                   /codon_start=1
FT                   /gene_family="HOG000184174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267195"
FT                   /orf_name="AFUA_2G02920"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87389.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG397124"
FT                   /db_xref="HOGENOM:HBG502488"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000051FB76"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI66"
FT                   /transl_table=1
FT                   /translation="MPCLEVCGHSIHYADSHPNGAPKDGATIVFIHGLGSSQNYYFPIL
FT                   HHLTLKHRCITLDTYGSARSPYTGQAITISTIASDVIAVLDALHIPKAVVVGHSMGGLV
FT                   VTLLGAQYSDRITTVVAVGPTHPSESLASTMRQRSDTVLEVGMEAMANTVPNAATGSQA
FT                   SPLAKAFIRELLLGQNPNGYATLCQAIAKASAIDYSRITVPFLLIAGEEDKSASLEGCK
FT                   YIFDRVSSKTKKIEVLPKVGHWHCIEAPDLVGGMIAGFIERV"
FT   CDS_pept        complement(752613..753404)
FT                   /codon_start=1
FT                   /gene_family="HOG000184163" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057139"
FT                   /orf_name="AFUA_2G02930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87390.1"
FT                   /db_xref="HOGENOM:HBG052560"
FT                   /db_xref="UniParc:UPI000051F457"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI65"
FT                   /transl_table=1
FT                   /translation="MPDQPRRIILEKSKTVRRRYQRSNKRFQFTASQIERIQREEEREA
FT                   RAKRLREKEKKRQANKKKKAEKEAKAREARRRLGLPDPHALPIPSSQPLLSKFLKKPAA
FT                   KPDTETETCEDTEPDSHSQGSIATEIDESLLSDLDVAAFDGQTAAGASGPDNHPASIDE
FT                   KGHVGRTQGDDDEFSECSIFYDEDIIKEVETIATAQVTTGRLGEIDQAMKESCKPALTV
FT                   GESFQDDTAILLEEFGHEFASDEEFEQELIRLDTVSVGKQS"
FT   CDS_pept        join(complement(754912..754983),complement(754702..754809),
FT                   complement(754457..754638),complement(754026..754395),
FT                   complement(753816..753971))
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751787"
FT                   /orf_name="AFUA_2G02950"
FT                   /product="Aldehyde reductase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87391.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000F51829"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI64"
FT                   /transl_table=1
FT                   /translation="MAPPSLQSTYKMVSGYEIPVVGFGSSFRIETPCLTCRWQCRPPEI
FT                   TEKATLKALETGYRHIDSAKYYANEKECAVAMKKSGIDRSKIFFTTKVPASSMSYEKAK
FT                   EAIEQSVAATDLGYIDLILLHAPYGGKEGRLGAWRALVEAQKAGHVRSIGVSNYGIHHL
FT                   EELEEYINSGVGGEISVGQYEIHPWCAREDIVAWLKKRNVVIEAYSPLVQAQRLDEPVL
FT                   QNLAKKHNKTGAQILIRWSLQKGYVPLPKSVTDSRIVENTQVFDFELSGEDMESLNTGI
FT                   YAPVCWDPAKDVPL"
FT   CDS_pept        join(755787..755864,755924..756418,756475..757134)
FT                   /codon_start=1
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267196"
FT                   /orf_name="AFUA_2G02960"
FT                   /product="Translation factor pelota, putative "
FT                   /biological_process="translation"
FT                   /protein_id="EAL87393.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG049937"
FT                   /db_xref="HOGENOM:HBG629960"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI000051EF54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI62"
FT                   /transl_table=1
FT                   /translation="MRLIKNKIEHGGSGTVTLCPEEPEDMWHAYNLIRPGDLLRASAIR
FT                   RVTTTHDTGTTTSSRVHLTLEIRVKSLDFDPQSSQLHVGGTIVNETPHTKVGQHHTLDL
FT                   ELNRNFTLEKEIGANGEGVGWDSIAVQMLQDAVDESGKRRAEAVAVVMQEGLAHICFIG
FT                   QFQTVLKQKVEMSVPRKRQGGGGGDHDKGMSKFYQVTLDTLLRQMEFNTSATSLTSNEP
FT                   VKPVLLASPGFVAAGFQKYIQSVASTTTPALKRLLPSIVVVHSASGYLHSLAEVLQSPA
FT                   VKTILADTKYARETKLMDDFLGHLRKETNKAIYGPREVEAAVDQGAVGRGGGVLIISNR
FT                   LFRSQDVAERKRWVSLVDRVRDVEGGEVRVLSSDHESGRRLDGLGGVAALCTFPVVEED
FT                   FESDEEPAEAS"
FT   CDS_pept        join(complement(759287..759664),complement(758554..759210),
FT                   complement(758422..758487),complement(758174..758350))
FT                   /codon_start=1
FT                   /gene_family="HOG000184141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267197"
FT                   /orf_name="AFUA_2G02970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87394.1"
FT                   /db_xref="HOGENOM:HBG052562"
FT                   /db_xref="HOGENOM:HBG332837"
FT                   /db_xref="UniParc:UPI000051EA9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI61"
FT                   /transl_table=1
FT                   /translation="MFFSSANHSIPSFRTSRNKNQLLCRSDYSEVVLAGFYITFSRPSL
FT                   LLLAADTCFVLLLVSSSVSSFHHTSVHWLSLWSKRVSRVCSMYPQTPSGFAGQMPYGQA
FT                   TPGRQGDDLDEYYEPLPPQWSCSPYLAMNHPNSTTAAAYPSAAILTPISLPDSSFIQAR
FT                   PSPVVSHRSQEYQYNISETVAQHGLGITAPFPSDFPRTVTAGLGHAIDQYDFGHAEATL
FT                   SPHPPPAKRARRSSPKAASSNRETPVSILPHPEGLQRLEQERRQGHIDLHSHHRSRAPG
FT                   RGRRDPQAEEEDAFVEGLREQNLAWKVIREMFREKFNKDASEARLQMRMLRRRKERLAR
FT                   WDEHDIPLLIRARDHWKREKYRIIAQKMRDLGARGTYTPQQCEAQLKDMEAESRERADG
FT                   LLSQMTERSRTGKRVRANSDAGPYLY"
FT   CDS_pept        join(complement(762817..762913),complement(762452..762744),
FT                   complement(761763..762386))
FT                   /codon_start=1
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267198"
FT                   /orf_name="AFUA_2G02980"
FT                   /product="Protein-ER retention receptor, putative "
FT                   /function="ER retention sequence binding"
FT                   /function="receptor activity"
FT                   /biological_process="protein retention in ER lumen "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87395.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0006621"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046923"
FT                   /db_xref="HOGENOM:HBG052563"
FT                   /db_xref="HOGENOM:HBG332839"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniParc:UPI000051E3AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI60"
FT                   /transl_table=1
FT                   /translation="MSMNVFRLLGDLSHISSKCILMWAIHRNKSAEGVSLLTQMLYAVV
FT                   FVTRYLDLFRGSGWRSIYLVFFKFFYILSSFYIIFLMMKVYPRTRERERAWKMALGSVV
FT                   LSLVLAPIVTPILDDKEFFKIHWFTETMWSFSIILESVCVLPQLLLLRQTTVPTVIDSY
FT                   YLLALGSYRAFYILNWFVRGFGPEKHWDPIAMIFGIVQTAFYVDFAWVYYSRQRVKLRN
FT                   GGVVDSEDYSKSWIVNKVFNIRRRRESLDEEQNLTGEGMEGESGDGGDRPRNNRWGARG
FT                   ISISADDMLDEHTRRKPGDADNEGLEGFLEDEDNSMDDQTGGRSPLHHTSVTSNRD"
FT   CDS_pept        join(766873..767118,767193..767233,767296..767368)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267199"
FT                   /orf_name="AFUA_2G02990"
FT                   /product="MYB DNA-binding domain protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87396.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG052565"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000051FDD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI59"
FT                   /transl_table=1
FT                   /translation="MPSAQVAPQNSRKRRASPQSSAAAAMAAPVTSASADATQTPQSAP
FT                   EAAPKKKGRTNTPWTAEEEQRLKTMRDAGRSWSEIAKTFPTRTEGSVKKHWICIMLSSQ
FT                   KKRYCLNDYCMIFAR"
FT   misc_structure  768755..768847
FT                   /gene_name="TPP"
FT                   /db_xref="Rfam:RF00059"
FT   CDS_pept        join(768896..769354,769417..769570,769637..769694,
FT                   769744..769857,769914..770619,770671..770754)
FT                   /codon_start=1
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267200"
FT                   /orf_name="AFUA_2G03000"
FT                   /product="Nucleoside transporter, putative "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87397.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123924"
FT                   /db_xref="HOGENOM:HBG330524"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI0000520259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI58"
FT                   /transl_table=1
FT                   /translation="MSSEIANPSLGMHSEKEPSGFRSEEQPTPRPHKTGETNSESPSGR
FT                   VIPSRVGMYLRRFEQQLVEYNFEARGIERVHEGERMKKLTWVSYTQAFLLWVSINLAAN
FT                   NITLGMLGPVVYGLSFLDSALCSVLGALLGSIVSSWMATRGPLSGIRTMAFGRYAMGWW
FT                   PSKIVVILNLIQMLGYCLIDCVVGGQILSAVSPNGNLSVAVALISWVVATFGIDAFHYY
FT                   ERYAFLPQMIVVCILFGVSSTKYDLSTPSMGDTRTIIGNRLSFFSICVSAAITYAPLAA
FT                   DFFVYYPEGTSKLAIFSLSLSGLMVSFTLAFLAGIGLASGIPSHLEYSAAYAKGAGALI
FT                   VEGFGPLHGFGKFCSVVVALGLIANTVAPTYSAGVDFQILGRYAEMVPRAIWNTIGVVI
FT                   YIVCGLAGRSHLSEIFTNFLALMGYWVAIWFAIILEERCIFRLRSGYNWYAWNDPSKLP
FT                   MGIAAFIAFLVGWAGAVLCMAQLWYIGPLAKLVGEYGADMGNYVGFTWAGLVYPPLRYI
FT                   ELRWLKR"
FT   CDS_pept        join(complement(772628..772718),complement(772431..772481),
FT                   complement(772036..772194),complement(771848..771948),
FT                   complement(771680..771770),complement(771517..771599))
FT                   /codon_start=1
FT                   /gene_family="HOG000184129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267201"
FT                   /orf_name="AFUA_2G03010"
FT                   /product="Cytochrome c subunit Vb, putative "
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="EAL87398.2"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="HOGENOM:HBG052566"
FT                   /db_xref="HOGENOM:HBG324015"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="UniParc:UPI0000F5181A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI57"
FT                   /transl_table=1
FT                   /translation="MFLQRTAFALARRAPVRAVAARPFSSSVVRCQKKYEVKKEGKILP
FT                   FEEIKTEDDLIAPGAKPGTVPTDVEQATGLERLELIGKMQGIDIFDMRPLDASRKGTLD
FT                   NPIIVKSAGDEQYAGCTGYPADSHHTVWLTVSRDRPIERCGECGNVVKLEYIGPDEDPH
FT                   AHEHHSHHPPHEEPKTFADYVKPEYWYR"
FT   CDS_pept        join(complement(773432..774337),complement(773237..773356))
FT                   /codon_start=1
FT                   /gene_family="HOG000216921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267202"
FT                   /orf_name="AFUA_2G03020"
FT                   /product="MYB DNA-binding domain protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL87399.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG023133"
FT                   /db_xref="HOGENOM:HBG052567"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000051F440"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI56"
FT                   /transl_table=1
FT                   /translation="MSVTLADPYRDYALDYAQHAKPEGHENALAYQTQHSHLQRHKEAN
FT                   PPFPQGSPHNTAYEQHHASTTVLPAANPDISQSVVLTAAHMLPRQLPMQYTPTTFEIPP
FT                   VQRGKKRPHSEAEGEGDYGDHGVRPRLSALPTQASTETAQSPGMLFSVQGDSSQQQAHH
FT                   QQQQRPPQQHHHHQPMPSHGFGPPESMALPQQHHHHRLPPQASLHSAERHGTNAETSPI
FT                   PSGLPSVVGQPGMPDPAPRPRGPKLKFTQEEDALLVELKENKNLTWKQIADFFPGRTSG
FT                   TLQVRYCTKLKAKDVTWTDEMVQRLQRAIQEYENDRWRIVAGKVGNGFTPAACREKASQ
FT                   L"
FT   CDS_pept        join(complement(780141..787177),complement(777614..780089))
FT                   /codon_start=1
FT                   /gene_family="HOG000184103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751788"
FT                   /orf_name="AFUA_2G03030"
FT                   /product="Pre-mRNA splicing factor (Prp8), putative "
FT                   /function="endonuclease activity"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL87400.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG023411"
FT                   /db_xref="HOGENOM:HBG398200"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR007869"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="UniParc:UPI000051F1CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI55"
FT                   /transl_table=1
FT                   /translation="MASLPPPPPPGWGAAPPSMPLAPPPPGYQPPADPNVAKFAQKKNE
FT                   WLRTQRNRFGEKRKGGFVETQKADMPPEHLRKIVRDIGDVSQKKFSNEKRSYLGALKFM
FT                   PHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNETPRVIEPVFHAQWATMWVCMRRE
FT                   KCDRRHFKRMRFPPFDDEEPPLSWSENIEDVEPLEPVQMELDESEDAPVYEWFYDHRPL
FT                   LDTPHVNGPSYKSWNLTLPQMATLYRLSHQLLSDVVDQNYFHMFDLNSFLTAKALNVAI
FT                   PGGPRFEPLYKDIDPNDEDFSEFNAIDRIIFRAPIRTEYRVAFPFLYNTLPRSVKVSWY
FT                   SHPQVVYVRADPNLPAFYFDPVINPISSRSVAPKNITVSHEDEIFGPGNNEDDFELPPE
FT                   VKPFFADEELYTPDTASAIALWWAPHPFNKRSGKMVRAQDVPLVKQWYLEHCPQGQPVK
FT                   VRVSYQKLLKTYVLNELHKKKPKAQNKQNLLRTLKSTKFFQQTTIDWVEAGLQVCRQGF
FT                   NMLNLLIHRKNLTYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRLTKLIVDA
FT                   QVQYRLGNIDAFQLADGILYAFNHVGQLTGMYRYKYKLMHQIRSCKDLKHLIYYRFNSG
FT                   PVGKGPGCGFWAPAWRVWLFFMRGIIPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVE
FT                   SHFDLELRASVMADLMDMMPEGIKQNKVNTVLQHLSEAWRCWKSNIPWKVPGLPAPIEN
FT                   IILRYVKSKADWWISVAHYNRERIRRGATVDKTVAKKNLGRLTRLWLKAEQERQHNYLK
FT                   DGPYVSSEEAVAIYTTMVHWLESRKFSPIPFPSVSYKHDTKILILALERLREAYSVKGR
FT                   LNQSQREELALIEQAYDSPGTTLARIKRFLLTQRAFKEVGIDMNDNYSHINPVYDVEPI
FT                   EKITDAYLDQYLWYQAEQRHLFPAWIKPSDSEVPPLLTYKWAQGINNLSNVWETADGET
FT                   NVMIETELSKVYEKIDLTLLNRLLRLIMDHNLADYITSKNNVQLSYKDMNHTNSYGLIR
FT                   GLQFSGFVFQYYGLMIDLLLLGLQRASEMAGPPQSPNDFLQFRDRATETRHPIRLYTRY
FT                   VDKIWVFFRFTADESRDLIQRFLTENPDPNFENVIGYKNKKCWPRDCRMRLMRHDVNLG
FT                   RAAFWDLKNRLPRSITTIEWDDTFASVYSKDNPNLLFSMCGFEVRILPKIRNQNEEFSV
FT                   KDSVWSLVDNATKERTAHAFLQVTEEDIQKFNNRIRQILMSSGSTTFTKIANKWNTALI
FT                   ALFTYYREAAVSTVNLLDTIVKCETKIQTRVKIGLNSKMPSRFPPAVFYTPKELGGLGM
FT                   ISGSHILIPASDKRWSKQTDTGITHFRAGMSHDEETLIPNIFRYIIPWEAEFIDSQRVW
FT                   MEYSQKRMEAQQQNRRLTLEDLEDSWDRGLPRINTLFQKDRSTLSFDKGFRLRAEFKQY
FT                   QLMKSNPFWWTSQRHDGKLWNLNAYRTDVIQALGGVETILEHTLFKATAFPSWEGLFWE
FT                   RACLAKGTRLLRYDGSEIEVQDVKEGDLLLGPDGGPRRAFNIVNGKDRLYRIKIGGSKE
FT                   DLVVTPNHILVLHREKRARNVYTGPSVQGHIQRSENGHGNLPMLSSSPAAAHHPNNLVK
FT                   NRGDFWSALKSAIAWVLHAERSSTGANMVRNVLNGTVGLTAHKESYTVTNPQQKGVYYT
FT                   YVWGNPQRTSIKGHRDHPPVFLPTKEDAFSAAIAKSRELYSQSEVTLATLRQRFLAKSA
FT                   DGKGGEILVDANLPNIFLLWDKNRSNLKFRVLCSRNFKTYGRVYTFESMPSTNAEEPGY
FT                   GDDDELPQVSAEERYDTVEMTAAEFASLSTEERSRYRVFRCPGFELPEQPVPVNPYFLG
FT                   LWLGDDNHEKTTNHNIHEENVREFLVNHAAELDMYLAWQGLIDYATVANPAPMMVRLPP
FT                   TNPDTIEHRPVVCQARQSIRKLRLAAKNIAQPEVVLSTSPRPESQMQPKRELPSNTETA
FT                   LRSEAEASSISAILDSKAGHSSLDTGDPNSDVVPESIPNDVADFGLDGVPELTSSGFSE
FT                   LTSDSELMRLIEQVERSSQGSTEEPSQASVVEQEADLNLLETDSEDEEADSADDDEFGD
FT                   PEASEFRPEPESQLSQSHFSNRRRNHRLRTGRRVYGDLNGEEEGILLDQIVEQSEGSRV
FT                   NSLLRALDALGIIAQKGTGPETNRKHIPSIYMKNSRSVRLAVLAGLIDSDGWYVYPENV
FT                   LGFAQSERWHSKLFWDVVALARSLGLSVLTKRRMMWNPARTERYPQLFAQISGNVAEVP
FT                   CLIARKKGVERLIPQTHSFMIKDISLEPEATEWAGFRVDKDQLYLRHDYLVLHNSGFEE
FT                   SMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFLHGKIPTLK
FT                   ISLIQIFRAHLWQKIHESVVMDLCQVFDQELEQLGIEAVQKETIHPRKSYKMNSSCADI
FT                   LLFATNKWNVTRPSILFDTKDVYEPTTTNKFWLDVQLRYGDYDSHDIERYVRAKYLDYT
FT                   TDSMSIYPSATGLMIGIDLAYNLYSAYGQYFPGLKTLIQQAMAKIMKANPALYVLRERI
FT                   RKGLQLYASESNQEFLNSQNYSELFSPQIQLFIDDTNVYRVTIHKTFEGNLTTKPINGA
FT                   IFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQLIVTR
FT                   KGLLDPLEVHLLDFPNISIRASELQLPFQAAMKVEKLADMILRATEPQMVLFNLYDEWL
FT                   KSISPYTAFSRLILILRALHVNIDKAKIILRPDKTVITQEHHIWPTLSDEDWIKVEVQL
FT                   RDLILNDYGKKNNVNVQSLTSSEVRDIILGMEISAPSLQRQQAAEIEKQQEEAKQLTAV
FT                   TTKTQNVRGEEIIVTTTSQYEQQSFASKTEWRTRAIATSNLRTRANNIYISSDDVSEEG
FT                   YTYIMPKNILRRFITIADLRVQVAGYLYGSSPPDNDQVKEIRTIVMIPQVGNTRDVQLP
FT                   QQLPQHEYLNGLEPLGIIHTISGNEPHYMTAMDVTQHARLMNAHPSWDKKTVTMTVSFT
FT                   PGSVSLAAWGLTPQGYKWGAENKDTTSDQPQGFSTSMGQKCQLLLSDKIRGYFLVPEDN
FT                   VWNYSFMGSSFSSVEKRPVYVKIDTPLRFYDDQHRPLHFQNFAELEDIWVDRSDNFA"
FT   CDS_pept        join(787407..787459,787542..787688,787756..787769,
FT                   787896..788068,788246..788437)
FT                   /codon_start=1
FT                   /gene_family="HOG000184082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057140"
FT                   /orf_name="AFUA_2G03040"
FT                   /product="Ribosomal protein L34 protein, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87401.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG052568"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="UniParc:UPI000051FB7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI54"
FT                   /transl_table=1
FT                   /translation="MEDAVLAPFLVMGKLEQRAPSETHTNPDDFENSTRTTTTTDDAAA
FT                   NLLITVLEVQGQSKWRTTDCNTGDGTLSSLPLEHDIDRFLFYRYNTRSNKVRIIKTPGG
FT                   ELRYLHIKKKGTAPKCGDCGIKLPGIPALRPREYSQISRPKKTVSRAYGGSRCAGCVKD
FT                   RIVRAFLIEEQKIVKKVLKESQEKAAGKR"
FT   CDS_pept        join(complement(793209..794015),complement(792627..793118))
FT                   /codon_start=1
FT                   /gene_family="HOG000184071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903888"
FT                   /orf_name="AFUA_2G03050"
FT                   /product="Forkhead domain protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87402.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG052569"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI000051FB77"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI53"
FT                   /transl_table=1
FT                   /translation="MVHSNPSYDLPANYSDYQAYHHYSSQLSQSSSPSSDGSSAENPDN
FT                   STPCSIVWVNTLETAFTFLDPWALSTTQVYPLGASTSLLEAPKDGKLDLFSYCDEGTSH
FT                   TTAPNTRPDHVEISLGYPRATESSSGWIHGVEGYGRNGPDFQIYLTPSPAAEHFPQPSE
FT                   AMHNTPSPATTSTTSSDSSQHVNWGRTEVEREIERNDAEKNSIPDDSGPTDLPYSHLIA
FT                   EALKAAPDRKRTLQEIYSWFEQNTSKGRDQRSKGWQNSIRHNLSMNAGFEAVRVESPNG
FT                   KKAVNYWRLTDEAYRKGIQSTTRYRKQANHKRPLGSDPPAPQRQRSGAKGGKATKIATK
FT                   YRGQMVLMTGDQQDAAPRERLYLHPAPLHLQQQLPSQMVNRPPYLRAATSVATVSPTRA
FT                   SGPATLMHRPSVEQYNSGSIIGCTEAPLYPYVL"
FT   CDS_pept        join(complement(796999..797514),complement(796459..796935),
FT                   complement(795687..796400))
FT                   /codon_start=1
FT                   /gene_family="HOG000184070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267203"
FT                   /orf_name="AFUA_2G03060"
FT                   /product="Cactin, putative"
FT                   /protein_id="EAL87403.1"
FT                   /db_xref="HOGENOM:HBG052570"
FT                   /db_xref="HOGENOM:HBG618072"
FT                   /db_xref="InterPro:IPR018816"
FT                   /db_xref="InterPro:IPR019134"
FT                   /db_xref="UniParc:UPI000051E3A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI52"
FT                   /transl_table=1
FT                   /translation="MSSRLPDRTGSKRSRSRSPSSMRQPQKYHRKYDERDRHRDGGKWE
FT                   DGNSRSSQPPVRNMRDQVRLNQLQEDEQVREWVAQEDMFVLKQAKKKAEIRVKEGRAKP
FT                   IDWLTVTLRVIDPTRNPLDDEIADSELDLVDPDGVFEGLSQSQLLELEKDIDTFLSLEK
FT                   NSKNRDFWKTMKVICRDRQKATAPEGRALSSVAADINRLLTPKTYEQLETLEVQVRKKL
FT                   DSNEPIDTDYWEELLRSLTVWKARAKVKKVHRAVIDERVRGLRKQQYEEAESIRTKLAP
FT                   LAPVIQTYQERPQQLCEKEIRDLDPEPLLQIRPEDKGLEILDEGAFLNQVARERQKILK
FT                   MGFVPLRQRQTERPSAASASQSTNISAATASTRFSSITNEDFSQATKALYERELAKGVS
FT                   ENEEIFTGEESVSTGAQPQWASKYRPRKPRYFNRVQMGYEWNKYNQTHYDHDNPPPKVV
FT                   QGYKFNIFYPDLIDKTKAPTYRIEREHGRKRGQSFAAAGEEDTCLIRFMAGPPYEDIAF
FT                   RIVDKEWDYSAKRERGFKSTFDKVYPGPPPIVFTSIDILRESYNFIFSSSE"
FT   CDS_pept        join(797786..798700,798753..799511)
FT                   /codon_start=1
FT                   /gene_family="HOG000184049" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267204"
FT                   /orf_name="AFUA_2G03070"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87404.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG052571"
FT                   /db_xref="InterPro:IPR009089"
FT                   /db_xref="InterPro:IPR015381"
FT                   /db_xref="UniParc:UPI000051F441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI51"
FT                   /transl_table=1
FT                   /translation="MMSSKWRRLHLPKQDGLPPLLLRYSRTLDSYNVYMTDLSNVWTEH
FT                   MSRQDILNRADEDATTIDPSEDPEQFEVLLRKIGEALSGESGCTASLENGLREDSMKLT
FT                   VSTKLPAPLRPLIWTIYLSKEPQSSTSQHLILPLLRAEAGWESRQRTLLDHLSKKDWVL
FT                   GKLFDKIESMGIDLSTIFPGVAGLRKAHGDTLLSHAANYVKGVAPFDEQEWLDGVAKSS
FT                   PDSVVAANIVAEVSGSVETREIERLGPPPDSWWVKLSATRVSIRAPSKRGEVTKTAAEK
FT                   PTKPVSNMDTDKDNDDDDDDDEFERQQTPPRLKKAKKPERHSPPTAAGTDSEIDHEHVP
FT                   TKRRSPSPQKPPAKKSGGLGIIGGKKQIKQKSQTPPPPSPPRDFASHEHKATDSGTDRD
FT                   TQPLPSPPRPPAALKPSASVTTASKPRGLGVIGGKKKEQSPQQIPQPSLSPEAQEVLTS
FT                   EPKQKHGGKLGMIGDKARKTTEVFPAASPKNRAETTTSPPPAKSESGEFSRRGAVKRSS
FT                   SPVKPPPQETEQERADRKREELKRQLEAKSRAPAKKKRRF"
FT   CDS_pept        join(complement(803784..804028),complement(799770..803604))
FT                   /codon_start=1
FT                   /gene_family="HOG000184038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208467"
FT                   /orf_name="AFUA_2G03080"
FT                   /product="WD repeat protein"
FT                   /protein_id="EAL87405.1"
FT                   /db_xref="HOGENOM:HBG052572"
FT                   /db_xref="HOGENOM:HBG332846"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000052049F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI50"
FT                   /transl_table=1
FT                   /translation="MTDVPRLPTRGNTSTSHQSPAPPPPPPPAPVHQGQKYSHRAANAL
FT                   ARFAQPFFSGSRPPSPQTSTGRADLSAGPRSTRSKSLPGASQTVTHKTGIPIAALDISP
FT                   QRTHAVIGGKEILKTIRVSPDRLSEEFNLRNAIISYSSTHHGGSGLSARHKDQLTVRDV
FT                   KWSHGNYDRTIATAVANGRIVVYDLNRTGLEFCRFQGHSRQVHRLAFNPYAPALLLSGS
FT                   QDSTIRMWDLRTASAERGVSMCGSKEQYVGNSDAVRDIRWSPSDRFVFATATDSGAIQL
FT                   WDSRKNCAPLMRITAHDRPCFSVDWHPDGQHVVSGGTDRQVKVWDFSSTAERRQKPTFQ
FT                   FRTPQAVLNVRWRPPSTDKESGDWQSCQVVTSYDKEDPRVHLWDLRRPHIPFREFDRYD
FT                   AHASDLLWHSKDLLWTVGETGAFTQTDIRYAPHVIHQRPTCAAAWSPTGEVLAFVQKRA
FT                   RRSISGLSATDFTDRLEMEHSSGELLGQSPTEEVLDEPSFISVRARPSKPSSTRPPKSL
FT                   SSTPPGPPENPPVLPLGETLSKIPPPGPRQLGVVGSVSGATSDPVVFRFLARHYSPLLE
FT                   APEDSCKHADLLRALLDSLTQNSERAEDVSLPKLAQTWRIVKFAVIQELESRARSQRQA
FT                   PERGSRNVKKKLSKEGQHAERPPALEDGRTDRLRNRLFRGVMETDASKHSTTEIESTSN
FT                   ITTPLARPLPDSPVESLHSPHSQMTSVNDDAADIEPLPPSVLSSNQGTMNTMNSNGWSS
FT                   MSDVEPHSIPQFEKSHSDAGESSLSSFESPPRDLAGTSAIQSPESDQRSAPRAINRQAD
FT                   WRLRNHPDYVKGASEDEFDQKMEDKRAAIRDYKLFPKKVLSLESHIEPPRPPPFHRHES
FT                   SESFPMFSESTGSSHPSKSLATSFSSAARLYDSSKIAEADESVIEDYPREHENLELAHT
FT                   PVLNEQAVQDDGLFQESVIDASRVHLERPSSPPQLLTESSPLQIPKDSSTSAKNAPDLR
FT                   SVPESTEDLSDIVIPLSPNLSGNKPWSPEILLKEAIRYNHSSTHVDIQSAAHLLQKLCI
FT                   LFGECEKLLPREECELIFKTYHEHLVRQSMYLEAAELRLLCVPSYPAVYEYAQTNTFIN
FT                   VFCFTCKRPYENPKQDNRSCYQCNTPQEPCAICMSVDPPADWITEQISSFADTEEHSEA
FT                   TSHLLSSSRSSLKTEQIPLSELQRLDGALLGDYTAPRPMGSTLWTWCQGCGHGGHMACI
FT                   TTWLSDPSLSEGGCATPGCMHDCGPGPRREFNRAVLQDVSRKRDAASRKAGLGFVKRDP
FT                   WAKGESKAVEKVRGMLGVATSGGSTVAPVSANIGAASSSGTMSPKKVRLVTPIEQGKRR
FT                   SGPSRASTGGSSGINI"
FT   CDS_pept        join(807812..807976,808050..809185,809242..810562)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267205"
FT                   /orf_name="AFUA_2G03090"
FT                   /product="Vacuolar ABC heavy metal transporter (Hmt1),
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87406.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000051FDDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI49"
FT                   /transl_table=1
FT                   /translation="MVVVKETQKFSQSAKLLFKWLSAGVLVTLVADAAINVAHVMVARS
FT                   EHWWCGQAVVIYVVGSFFVYAVILVSLLDSKPSPSSTQLIPWIVAIPIELAIVGASLSI
FT                   YSTVHHEPVVGNPSGGRLRQGMTGWESMEVVSNCIRVLILASLVMIYLFCSISARTSAR
FT                   KPARDQTDGPTESTGLLDPAHAETGTNGTAYGTTHTSQGNQQPSRPTDPWVRPTTVPST
FT                   SWWEYLSGYSLFFPYLWPSKSRRLQFIVVICFVLIVLQCVVNVLVPYQVGVITNILSKT
FT                   DGDFRVPWFEICLYILYRWLQGNQGLIGSLRSSLWIPVSQYSYMELSTAAFEHVHGLSL
FT                   DFHLGKKTGEVLSALSKGSSINTFLEQVTFQVVPMLVDLCVAIGYLLIALDAYYALVVT
FT                   IVTFCYLYVTVRMAQWRAEIRRQMVNASRQEDAVKNDSMVSYETVKYFNAEEYEFNRYR
FT                   GAVSDYQKAEYHVLFSLTLMNTSQNTVFMLGLLIACFIAAYQVSLGQRDVGQFVSLLTY
FT                   MAQLQGPLNFFGTFYRSIQSALINSERMLELFREQPTVVDKPGAMPLAVCKGDIKFEDV
FT                   EFAYDTRKPALNGLTFHCEPGTSTALVGESGGGKSTVFRLLFRFYNARNGHIRIDGHDV
FT                   EDITIDSLRRHIGVVPQDTVLFNETLMYNLKYANQNATDEEVYEACRAASIHDKIMSFP
FT                   DGYNTKVGERGLRLSGGEKQRVAIARTILKNPRIILLDEATAALDTETEEHIQGALSTL
FT                   SRGRTMLVIAHRLSTITTADRILVLHEGRVAESGTHEQLLAMKGRYASMWRKQIRAQRA
FT                   AAEAQVLQDRAQRLRSASTAAVGDDSSSQSDEDRNGKDHPTTTRPAQGQFSSKSLEDSQ
FT                   KG"
FT   CDS_pept        join(811282..811789,811863..812059)
FT                   /codon_start=1
FT                   /gene_family="HOG000184027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267206"
FT                   /orf_name="AFUA_2G03100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87407.1"
FT                   /db_xref="HOGENOM:HBG052575"
FT                   /db_xref="HOGENOM:HBG332849"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="UniParc:UPI000051F1CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI48"
FT                   /transl_table=1
FT                   /translation="MMQPPSTQLLRALRTSISGVNTGSLCSAIPRSRCAIRQTALSGPS
FT                   RRYSNNNARPTRMIPRSHTPKPTSHDRGPPSKEDTQTDFAALNVLGNIPAPTTAIDACL
FT                   DTGFHLNSGVKVTGGDGVLLVGGEAFAWRPWKVNAGMKSDMLNKKGQFEVDEQAWGLLG
FT                   LVWPRPDLLLIGMGASVFPLSPETRRLINSLGIRVEVLDTRNAAAQFNLLATERGVSEI
FT                   AAAMIPIGWNGK"
FT   CDS_pept        join(812513..814016,814070..814389)
FT                   /codon_start=1
FT                   /gene_family="HOG000099116" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057141"
FT                   /orf_name="AFUA_2G03110"
FT                   /product="Alkaline phosphatase Pho8 "
FT                   /EC_number="3.1.3.1"
FT                   /function="alkaline phosphatase activity"
FT                   /protein_id="EAL87408.1"
FT                   /db_xref="GO:0004035"
FT                   /db_xref="HOGENOM:HBG237270"
FT                   /db_xref="HOGENOM:HBG617166"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniParc:UPI000051ECD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI47"
FT                   /transl_table=1
FT                   /translation="MARDEPLLAPRPSSENNSIRNAEEEDALLTGERTGRGQERRGWTF
FT                   WREVGLFSWALLATIAVIVLAVVYQHETSNPNGGSRPPWGPGGKPTGKRNLIFMVSDGM
FT                   GPTSLTMTRSYRQFVEGLPIDDILVLDGHIIGTSRTRSSSSLVTDSAAGATAFSCGFKS
FT                   YNGAISVLPDHSPCGTVLEAASLAGYKTGLVVTTRITDATPACFASHVNLRQYEDRIAE
FT                   QEIGEHPLGRVVDLIFGGGRCHFLPNSTEGSCRADDRDLVSVAKKRGFSYLDDRKGFDS
FT                   LNGGSEAKLPLLGLFAEKDIPFEIDRRNQNDVYPSLEEMARTALKILSDATADSEQGFF
FT                   LMIEGSRIDHAGHGNDPAAQVHEVIAYDKAFAAVLDFLGKDSTPGVVVSTSDHETGGLA
FT                   AARQLHTSYPEYKWLPGVLANASHSTEYIDNKLREFLSTETEKNKQQHYVRELLEKGLG
FT                   ITDATDEEIDSILDPNSPVSSQYQLADMISRRAQIGWSTHGHSGVDVNIYASSSKDAWP
FT                   LVGNHENTEIGQFISDYLDLDVENITKHLQSSSAWSFAGGDVERPFAWLGNPLGADVRT
FT                   EGFDTYHGEFRKRSMDVDGMEKRECGCGGMH"
FT   rRNA            complement(814673..814788)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(817078..817201),complement(816581..817021),
FT                   complement(815743..816509))
FT                   /codon_start=1
FT                   /gene_family="HOG000184016" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16267207"
FT                   /gene_name="crf1"
FT                   /gene_synonym="utr2"
FT                   /orf_name="AFUA_2G03120"
FT                   /product="Probable glycosidase crf2 "
FT                   /EC_number="3.2.-.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="cell wall"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL87409.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG058731"
FT                   /db_xref="HOGENOM:HBG736732"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniParc:UPI000051FDDE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI46"
FT                   /transl_table=1
FT                   /translation="MVRIGSSLLLATLAATTVSAASDPPKCSQDSHCPEEWPCCSLYGQ
FT                   CGTGAYCLGGCDPLMSFSLDSCTPEPICQGKTYKDWSNLDNLASNTKYLGDASKSDWVY
FT                   SGYPKVEDGNLLLTMPKNSVGTLIANNHYIWYGKITAKIKSSRGAGVVTGFILLSDTKD
FT                   EIDYEFVGADLTNVQTNYYFQGVLDYNHGGNASVSGGNTFGDWHEYTIDWKPDAITWSV
FT                   DGEVKRTLKKESTYNETSKQYMYPQTPSRMQLSLWPAGQASNAPGTIAWAGGEIDWDSE
FT                   DIKDPGYYYATFGEITVECYDPPSGADIKGTKAYIFKDKAGLESSVQITNNKTVLASFG
FT                   ATGLDMDVGASSSASGSANKTSSSANTVPSGNGGSGNEPGNSHSGSSGSGTSTSDGSGS
FT                   STGFSQGSETSASSNKNAAPSQNERVLNGSFFAVLVAVVALVTL"
FT   pro_peptide     complement(815746..815826)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI46 "
FT   mat_peptide     join(complement(817078..817141),complement(816581..817021),
FT                   complement(815827..816509))
FT                   /product="Probable glycosidase crf2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI46 "
FT   sig_peptide     complement(817142..817201)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI46 "
FT   CDS_pept        join(complement(820588..821320),complement(820329..820531))
FT                   /codon_start=1
FT                   /gene_family="HOG000183916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208468"
FT                   /orf_name="AFUA_2G03130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87410.1"
FT                   /db_xref="HOGENOM:HBG052576"
FT                   /db_xref="HOGENOM:HBG332852"
FT                   /db_xref="UniParc:UPI000051ECD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI45"
FT                   /transl_table=1
FT                   /translation="MGAENQQIMRYDIIQKQAVAALMNEVEKENKEPVKGHGNRAGSWA
FT                   QIAGSMTKVQCQPKETLHYLSPMSMSSVSGSKQSHSIDGENGARAMNFSGAPLSPEIAE
FT                   AKAGVVRIYGRVTREAIRFVTTRIHEGPLQEIRIETNERTRVTFQYASHALAFVKSNQD
FT                   MEEMLGYGRFGTGYTVEMAEIINWNDEHRRMNQPIRERRRLSFARKRLFADNMSPEKWK
FT                   SDVRAVAGLGNIDFLWVFNSGNATAVFTSTAVARRVLEAFNKWKDTRAVYSGVSVTYSS
FT                   DPCEKELVLVNDTARSGFAKNLNFAKKSMR"
FT   CDS_pept        join(complement(823380..823554),complement(822985..823307))
FT                   /codon_start=1
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057142"
FT                   /orf_name="AFUA_2G03140"
FT                   /product="Peptide methionine sulfoxide reductase "
FT                   /EC_number="1.8.4.11"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein modification process "
FT                   /protein_id="EAL87411.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG173408"
FT                   /db_xref="HOGENOM:HBG748152"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI000051EAA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI44"
FT                   /transl_table=1
FT                   /translation="MSEITQTATLAAGCFWGVEHLFRKHFGNGKGLLEAKVGYCGGSTS
FT                   SPSYRAVCTGTTGHAEAVQLTFDPSVVSYGSLLEFFYRMHDPTTKDRQGPDVGTQYRSA
FT                   IFTHGEEQHKIAEEITDKVSKQWYKQPVSTQIIPAGQWWDAEEYHQLYLTKNPSGYECP
FT                   AQ"
FT   CDS_pept        join(complement(827241..827440),complement(824354..827183))
FT                   /codon_start=1
FT                   /gene_family="HOG000183905" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903889"
FT                   /orf_name="AFUA_2G03150"
FT                   /product="Kinesin family protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="EAL87412.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG052577"
FT                   /db_xref="HOGENOM:HBG332853"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000051F439"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI43"
FT                   /transl_table=1
FT                   /translation="MAAEGGSSSITVTVRVRPFTIREAAQLPKCEDGPLFLGDGSLAGA
FT                   PTPKLNQKGIRSIIKVIDDRCLVFDPPEDNPVQKFSRSVVPNGKRVKDQTFAFDRIFDQ
FT                   NATQGEVYEATTRTLLDSVLDGYNATVFAYGATGCGKTHTITGTAQQPGIIFLTMQELF
FT                   ERIEERKGEKHTEVSLSYLEIYNETIRDLLVPGGSKGGLMLREDSNKSVSVSGLSSHHP
FT                   QNVQQVMDMIMRGNECRTMSPTEANATSSRSHAVLQINIAQKDRNADVNEPHTMATLSI
FT                   IDLAGSERASATKNRGERLLEGANINKSLLALGSCINALCDPRKRNHVPYRNSKLTRLL
FT                   KFSLGGNCRTVMIVCVSPSSQHFDETQNTLRYANRAKNIQTKVTRNVFNVNRHVKDFLV
FT                   KIDEQMNLINELKAQQKESEKLAFAKFKKQTEKKDAAIREGVSRIRNAYDHSLLERQEK
FT                   INTMIKLKQVNRRIGMLSSWIAAFDAVCANSGNDEPLSNLQAIRKTAQGILLELEGSRQ
FT                   HYHQRLAKNNWDRAMNSAVENAIRQLRDFEISDNSDFANFDREAELLRANAEREALSAM
FT                   ADQDKAGEVATIQVLLQAQFEIIASIEQIMRLSEEEAVEMGKKILLKMLNSSANVATNV
FT                   VKPDGTLLSAQPFSPLKHSSPKQKRRSSVAHLPTVKGLGAPISFTPAAPASPTKGSPRR
FT                   RKVGAGRKSVSFSPKKTQAKTTKRSVRWKDDEQDGALTEYQKTPQKPLTETIPEEPPSE
FT                   EPQLPRASPIPRGIPVPSRNISPSGSSPIPPPSNEPTLHVQKNNRFKAGFLSKKAGSSP
FT                   VGPPPTSTLPLSDNENSPLRDIENSSFLNRSSMDRPSRIAVRTSSGSYSSSPLPDSRDS
FT                   WKASKDDAIKITSAMRRISGGQFGSAASTNSLRINRRRSPTSATYGSSPSENTMFTASQ
FT                   ARRMVKSEKELDPKPRVLSPRTLPIMKSTSHRRTTFGGDIRPRDISLTSRDAIRLSTMA
FT                   APSIERPPETLYPSSGAGWR"
FT   CDS_pept        join(complement(829155..829188),complement(829057..829088),
FT                   complement(828521..828988))
FT                   /codon_start=1
FT                   /gene_family="HOG000183894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267208"
FT                   /orf_name="AFUA_2G03155"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27313.1"
FT                   /db_xref="HOGENOM:HBG324016"
FT                   /db_xref="UniParc:UPI0000F5181B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U5"
FT                   /transl_table=1
FT                   /translation="MKDALDYSEVPNAHHQKSKATMSQVDPLSLTLLFKKHKTTVLLML
FT                   PPHETIATAQEMLLTALRSRGIREINGDPVPDDFSDIEFGVTVDKNDLEKGWSKLEIAM
FT                   PELENSGTSKRGARKQTSLKAADIRNGQVIAFRFRKPREESEKDGDLDIDLELEDPGWD
FT                   VVVPSLDDEEGEPN"
FT   CDS_pept        join(829331..829787,829854..830014)
FT                   /codon_start=1
FT                   /gene_family="HOG000183883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903890"
FT                   /orf_name="AFUA_2G03160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87413.1"
FT                   /db_xref="HOGENOM:HBG052578"
FT                   /db_xref="HOGENOM:HBG332855"
FT                   /db_xref="UniParc:UPI000051EAAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI42"
FT                   /transl_table=1
FT                   /translation="MDTDSPTETRSTEPSTLLKILHWDKLFESDTPPRLGIEVGKRLPF
FT                   TALSAFSVGMAIGSSHGSKKAAYRFRAENAHRFPTTSTGWFQYHKTKNYIAIVGGVKEG
FT                   MKMGFKLSAGALAFCIFEETVDYARHDRRDFLSTVTAGLSFSGIYSLLARHDVYTAART
FT                   TKLGLKLSMAYGLMQDALETLKGNRPAYVDFILGNRVSKSED"
FT   CDS_pept        join(832060..834477,834592..834876)
FT                   /codon_start=1
FT                   /gene_family="HOG000183871" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267209"
FT                   /orf_name="AFUA_2G03170"
FT                   /product="Cyclic nucleotide-binding domain protein "
FT                   /protein_id="EAL87414.1"
FT                   /db_xref="HOGENOM:HBG190020"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000520708"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI41"
FT                   /transl_table=1
FT                   /translation="MRRHGRAGGGTKAVTPVSDTVSLIHSFDSVTNPNRPARPSPLASS
FT                   HIQALPLDLIDRLRSFPLFQSTPESFLVEVAQHLRPQLSAPNDYILTEGDEAKAIYWLV
FT                   RGAVSATSRDGESIYADLEPGAFFGEIGVLMDRPRTATIIARTRCLLVVLSKEDFRNIL
FT                   PRFPEVEQAIRDEAQERLMILEKKKKETSTPSADLTSPVRRGSKRLRDSSSGDLSPIER
FT                   EGTSLKAGNKKRKSPSPGVGVADASSSALATGSVNVRLLLKELPLFSSLPPDILHFLGL
FT                   NAQPRSYPPFTDIIRQDSQGREIYFIVRGEVEVLTERTDAQDRHSLAASIENPPFEVKA
FT                   RLKQGQYFGEVVSLSLAPRRTATVRSVTAVECLMLSGDVLAEFWDKLPQTVRQQVENTA
FT                   KERLQSASDGDVVMSDAGSADQPTDGEFKIRAARRQSMPLLTLTETELDSPRAPGAMED
FT                   QNVLKPSDPDPFLNVGLDKVRLRSRRGSVAPLTPDEVSGEQQRQSPPSGTRSTRSSLHS
FT                   LSDTSTLSTTQKAHRESRGDNVGILPDNILVRIFQHLELHELMRLRAVSLHWSEILTKS
FT                   SELVRYLDLSIYNRKLSDDVLVKIICPFVGERPRHVNISNCFHITDEGFSNLAATCGAN
FT                   VVSWKMKSVWDVTATAILEMTGKATGLQEVDLSNCRKVGDTLLARIIGWVAPGQHKPNG
FT                   ETGKMGKAALKPTMQTEAGTVYGCPQLKKLTLSYCKHVTDRSMHHIASHAASRIEQMDL
FT                   TRCTTITDQGFQYWGNAQFINLRKLTLADCTYLTDNAIVYLTNAAKQLQELDLLTYLNM
FT                   SFCGSAISDPSLRSIGLHLLNLKRLSVRGCVRVTGVGVEAVAEGCNQLESFDVSQCKNL
FT                   LPWLEDGGPLRYKGKIDFETVAQNGRVFR"
FT   CDS_pept        join(836235..836720,836785..836805,836914..837207,
FT                   837262..838326)
FT                   /codon_start=1
FT                   /gene_family="HOG000216923" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057143"
FT                   /orf_name="AFUA_2G03180"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87415.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052579"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F5180A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI40"
FT                   /transl_table=1
FT                   /translation="MSGRKRRIDDVDNSDNDNRKKQARASNLGSGANSGQSSSALNAEA
FT                   VAKTPNTTAAVPSQIVSGEALSTTTAPAEAEQSRDKGKQRLEQVEEAKEATKEAAGGIS
FT                   VDNKESTAGPSTEPSKQARVKKQRRKKTDPVPDPVATTLNRIEKNPPKRTDRACDNCRM
FT                   STQTDTIQKLKCDNQPNGCAQCLKKGMRCTLTLATQKTYVRGTPKETGQARDGLNLEVE
FT                   RLHADVDFLLQDVHLLRRDVQQLQLENMQLRNALAGLQASFPNRNQFPWNPPPAGQVHA
FT                   QAQAAGQGAGRMPLPANLPPVGQGTLYFTFPPDPPQAGQGPGQMPLPANLPPTQQRTFP
FT                   PDPFLVGQGAGQMQLPASIPPPGQEVGNLAPPPDVRLAGPGPLNFPPGPNLPPVIQEPA
FT                   NFIPAPRTPSPEQGSSSDQSSGGNPYRTSSEASADNDSTNYGATNNGPAFANQVFPPMT
FT                   EQGGSQPALEAQQPGYHDTIADDTAMVLDDDDLEGFIAQPANLNDLDEFINAIGGDNSD
FT                   NGDNGDNGDNGDNGDNGDNGWNPIDLLMLPADRNRLTAFTNQPSYPSAANTADPATDPF
FT                   TIDPAQLIPQPGDYPQVARPTTTLATADVPGDSQNGGDNDGFQQN"
FT   CDS_pept        join(839441..839524,839590..839655,839726..839761)
FT                   /codon_start=1
FT                   /gene_family="HOG000183860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903891"
FT                   /orf_name="AFUA_2G03190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87416.1"
FT                   /db_xref="HOGENOM:HBG052581"
FT                   /db_xref="InterPro:IPR009101"
FT                   /db_xref="UniParc:UPI000051ECC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI39"
FT                   /transl_table=1
FT                   /translation="MRFTFFAALALLGTAFAAPTAPTTSTATIPAGQTCKKDGSMGVCQ
FT                   SGYCMQDEKASSGVCK"
FT   CDS_pept        join(complement(841800..842603),complement(840114..841745))
FT                   /codon_start=1
FT                   /gene_family="HOG000183849" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903892"
FT                   /gene_name="slx4"
FT                   /orf_name="AFUA_2G03200"
FT                   /product="Structure-specific endonuclease subunit slx4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87417.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG052582"
FT                   /db_xref="HOGENOM:HBG324018"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI0000F5180C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI38"
FT                   /transl_table=1
FT                   /translation="MCTTTDVVVLSSSPDQIRSCSLANPKCGAEKAFVLSPVSSSPSFL
FT                   PSSSDLFQPPTRSRFFKPGGGNEGSSRTAREESETGTKQNDLAASRKKAAVRGGRQKRT
FT                   KEQPPNESQTLFDNPEPPIPKHNGCTSKKGTGSRKKRIDAASKCTKSGSKKITGKVTKP
FT                   GITETTKFENKTKNVTSDVSPGKSPANKLELEKDGLQIEVAMKRRLDWTPTKDTGKQAV
FT                   ALDDTGDNKTRFGELLSEYGFLKAAAVSQTDSKLSDGAPTKCRRLELVDTHNPSTSKRT
FT                   SPDADSDRSNVRSTRSSRAPAAEGKSKKRSRKITTLTGRVTALYTKDCTDHLDAANTMI
FT                   RASEDVSSKLLSKSLDLDSCVLAPGDAVDYLQDQDLIFGTCSQLEREDSPTMLRDMQKE
FT                   ICASKNSMIENRKPSSTTRAGSGLYSHTTVSRFQTQRDLWSVAARDMDGSLAEIEVLDM
FT                   VDITDVSELPPKPNGELPDRSEKNDEDTVSQGESSRPIEITDDFGVEVDVRMEYLATSE
FT                   TKPEETAYAASEIRPMPRFADWKDSDLSRQVRLYGFKPMKNRRKMIEVLERCWKAQHSS
FT                   TRTGVQYAPGKPDDGSTGKAGTIGSQMNKQSSKMDAAEKMRRESACLKEKAKSSTALED
FT                   KLSHATDRSSQMLTKSSFAHMEEIEDSEDEVIPSPSQLQSLYKRHISESRSSHPLPVSD
FT                   TPSTPSSRTRTNADSDTKPSPSDSATESSLPDLASQITKAVRLQPRSFSVDCKRPSWHE
FT                   KILMYDPIILEDFATWLNIEGLGLVHEDREVSAEFVRQWCESNGICCGFRKNSRRSER"
FT   CDS_pept        join(complement(843865..844023),complement(843688..843810),
FT                   complement(843336..843623))
FT                   /codon_start=1
FT                   /gene_family="HOG000272647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057144"
FT                   /gene_name="cgi121"
FT                   /orf_name="AFUA_2G03210"
FT                   /product="Protein cgi121"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87418.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191460"
FT                   /db_xref="HOGENOM:HBG332860"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniParc:UPI000051FB78"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI37"
FT                   /transl_table=1
FT                   /translation="MTLPLETIRLPHLPSALPVHIALYRDVNNSPFLRQQLLSGNADFE
FT                   YAFIDASMVFSRSHILSAIFRAVNDHLNGRLKSRNVHSEIVFSLSPANNIADSFRKFGI
FT                   TDSTTDLLVVKVSVTPDVTHASVATHLQQYIEGSPVPFADETLSEISDISKIKKAYKLG
FT                   TLGSRDDEKRRLELSLIGAIALRGAT"
FT   CDS_pept        join(844404..844933,844988..845471)
FT                   /codon_start=1
FT                   /gene_family="HOG000183838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267210"
FT                   /orf_name="AFUA_2G03220"
FT                   /product="Bax Inhibitor family protein "
FT                   /protein_id="EAL87419.1"
FT                   /db_xref="HOGENOM:HBG052583"
FT                   /db_xref="HOGENOM:HBG735363"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniParc:UPI0000520483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI36"
FT                   /transl_table=1
FT                   /translation="MAFFLRRPFAVPTALRQAPKAANTARFIHNSPIKPVQSKPLGPCS
FT                   SSIFAQSKQTIQNAFRRTYMQQSYGTAQRGDLTQRLLYGAAIVGGTVMATNFIFNRETR
FT                   EDGGMPHYERSYLNETFMHTGLGVGIIGIAARALHMNGWSYRLMATNPWLVAGVGLAAS
FT                   MGTMFATYYTSPDNYVMKYGLWAAFNVTQAALLSPLMFMHPALLARAGLYTVGMMGSIA
FT                   FVGATAKQEKYLYLGGPLLAGVTIVALSGLAPLVIPATAARALMWSEKIWLYGGLAVFG
FT                   GFTLYDVQKILHHARLAERGLVRRDVVNESISLELDFINIFVRMVQILAMQRNNRK"
FT   CDS_pept        complement(845968..847674)
FT                   /codon_start=1
FT                   /gene_family="HOG000165530" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267211"
FT                   /orf_name="AFUA_2G03230"
FT                   /product="Alpha-amylase AmyA"
FT                   /EC_number="3.2.1.41"
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /function="pullulanase activity"
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL87420.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0051060"
FT                   /db_xref="HOGENOM:HBG324773"
FT                   /db_xref="HOGENOM:HBG434453"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000520492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI35"
FT                   /transl_table=1
FT                   /translation="MIYSLRILQWLCITAGLDLLVPSLAADTSAWKSRSIYQTMTDRFA
FT                   RTDGSTTHPCNTTEGLRCGGSWRGTIQHLDYIQGMGFDAIMISPIVQNVEGRVQYGEAY
FT                   HGYWVQDMYALNPHFGTHQDLLDLSKAVHDRGMYLMVDTVINNLAYITDGRNPATSIDY
FT                   SALRPFNDSMFFHPYCKITDYDNYPLAQTCWTGDDVVPLPDLKTEDSQVQSMLMDWIRK
FT                   MMATYSIDGLRLDAAKHITPSFLPLFQNASGAFITGEVFEPSVKTICGYQKDLPSVPNY
FT                   PIYYSILEAFTKGNTSSLTNQVEVMKQTCSDVTALTSFSENHDVARFASFKDDIAVRQR
FT                   TPVTLKVSTDDRLTPAQLAKNVLTFTMLFDGIPMIYQGQEQHFSGASDPENREALWLSG
FT                   YNTNAPLYQLATRLNRIRKHAAQIDPAFVDSQTFPIYTGSSEMGFRKGVEGRQLVMVLS
FT                   TQGMDSGKYELDMPIGYQPGFVVTDVLNCANYSVNDMGLLKVSMDKGEPRVLFPADMME
FT                   GSGLCGYGRSNGTTYLNLKKNSTQFSGGGLSNRPTVPLLLICCLTCLILWC"
FT   CDS_pept        join(849238..849713,849786..849885)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903893"
FT                   /orf_name="AFUA_2G03240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87421.1"
FT                   /db_xref="HOGENOM:HBG052584"
FT                   /db_xref="UniParc:UPI000051FDCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI34"
FT                   /transl_table=1
FT                   /translation="MGILNGESHHMLRISNGLNHHILRILNHLNGAVSPHGSPASTASM
FT                   TWLYLKPHEIISVSHLTTCLSQISRRAAREPTMSKNTVGKNTEKDKNKKWEVAYTARMR
FT                   QIVPGLFLGNVEASYKWEMLQKVESTHLSLLLMPGGCGGTLLQERQASQHIVTNGWHLP
FT                   FFRRCPPWSSSTNTTRMMSHAEHLRRPY"
FT   CDS_pept        complement(851698..852294)
FT                   /codon_start=1
FT                   /gene_family="HOG000183827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751789"
FT                   /orf_name="AFUA_2G03250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87422.1"
FT                   /db_xref="HOGENOM:HBG052585"
FT                   /db_xref="UniParc:UPI000051F690"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI33"
FT                   /transl_table=1
FT                   /translation="MFLRGSKSEQTRELHEPDSELDVFFDLILHTMIIREITKDPKTRK
FT                   TFRVTYLKIDAQSVHFINMHGLADNSLLLSLRVRESLCAVKGHKMQMRVKHFGFRPMED
FT                   SKLYTDVYCCDWSEQNIEILLPGKRIHEWKTVALILATFHRISKEQWCLLVNMAGAPGI
FT                   VGLNWKVIESELWPEKSEPDDIEAAEAKSVDTVLS"
FT   CDS_pept        join(853600..853845,853948..854178)
FT                   /codon_start=1
FT                   /gene_family="HOG000183826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267212"
FT                   /orf_name="AFUA_2G03260"
FT                   /product="RNA binding protein (Rbm8A), putative "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87423.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051E5FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI32"
FT                   /transl_table=1
FT                   /translation="MSTEMEVDVPQEEVPQGQSGGGGSDPRTQAGAVAVRSIEGWIIIA
FT                   TNIHEEASEEDVTDLFAEYGEIKNFSLNLDRRTGYVKGYALIEYSTLPEASDAIKALNG
FT                   AKLLDQTIHVDYAFVRPPPSNKGKGGPPKGGRGGRGRSRSRDRSRSPEADNARD"
FT   CDS_pept        855395..857257
FT                   /codon_start=1
FT                   /gene_family="HOG000183805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267213"
FT                   /orf_name="AFUA_2G03270"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87424.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052586"
FT                   /db_xref="HOGENOM:HBG332862"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="UniParc:UPI000051E845"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI31"
FT                   /transl_table=1
FT                   /translation="MILPISSFLYLCVLFIQSGAIALAQVPQDVLSPKRPFPQESTVPG
FT                   ISSEEWPLTPPGLIGETEDSIRSTLRDLVDALKVMQEEYFELWQGKWPTAIDWTAAVLG
FT                   THVSATLSSLTSTVGDVLLSSLSADTENAEGECQSAIHRSLAFENFINHFFGQSVSFYY
FT                   GEDAISLRGQAYDDMLWVVLEWLENIKFQVLHSELHYDRSNASTEHRWHGVQFQIPAAH
FT                   RARLFYELASSGWDRSLCGGGMIWSPYLGPYKNAITNELYISASIGMYLYHPGDVINSP
FT                   FASPSRTSEVASDGYPHNPAHLQAAIEGYEWLKSSNMIGIGGLYADGFHISGWRSVTQP
FT                   GTRRCDVLNPMVYTYNQGVILSGLRGLWLATASQDYLQDGHDLVRKVIRATGWPNKDAR
FT                   EWAGLGRGGVLEDACDSSGSCSQNGQTFKGIFFHHLTEFCRPIYPQEEGFLAAANRTSE
FT                   GEDDDWKHVYKWHLARCRAYRPWIEHNANAALLTRNNDGKFGTWWGRRYRVLDDAIIDQ
FT                   SPLPPGAVDYKNYDNRGDGWSKEQTGALRGRASWTASSAGTPESSDQRTGSRETWIWTN
FT                   RPTLAEVRLMDYNDRGRGRTVETQSGGIAVLRALYQWKTTASLS"
FT   CDS_pept        join(864037..864203,864270..864456)
FT                   /codon_start=1
FT                   /gene_family="HOG000183794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208469"
FT                   /orf_name="AFUA_2G03280"
FT                   /product="BZIP transcription factor, putative "
FT                   /protein_id="EAL87425.1"
FT                   /db_xref="HOGENOM:HBG052587"
FT                   /db_xref="HOGENOM:HBG332866"
FT                   /db_xref="InterPro:IPR019357"
FT                   /db_xref="UniParc:UPI000051EA9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI30"
FT                   /transl_table=1
FT                   /translation="MASRKPSASILVPRDHPEIEIEEEEFPPDDARAMSPRRNSADLER
FT                   LGKEARQTLQEQAKALQSSLQALAERIEAVKSDHDKLESENKFLQDYIGGLTRNMTKAE
FT                   LTRSSTKVKRSHK"
FT   CDS_pept        join(complement(868190..868250),complement(867822..868128),
FT                   complement(867498..867739),complement(867364..867434),
FT                   complement(867203..867307))
FT                   /codon_start=1
FT                   /gene_family="HOG000240379" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751790"
FT                   /orf_name="AFUA_2G03290"
FT                   /product="14-3-3 family protein ArtA, putative "
FT                   /function="protein domain specific binding"
FT                   /protein_id="EAL87426.1"
FT                   /db_xref="GO:0019904"
FT                   /db_xref="HOGENOM:HBG020767"
FT                   /db_xref="HOGENOM:HBG611720"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="UniParc:UPI000051FB79"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI29"
FT                   /transl_table=1
FT                   /translation="MGHEDAVYLAKLAEQAERYEEMVENMKVVASSDVELTVEERNLLS
FT                   VAYKNVIGARRASWRIVTSIEQKEESKGNESQVALIKEYRQKIEAELAKICDDILDVLD
FT                   KHLIPSAASGESKVFYHKMKGDYHRYLAEFAVGDRRKAAADASLEAYKNATEVAQTDLA
FT                   PTHPIRLGLALNFSVFYYEILNSPDQACHLAKLAFDDAIAELDTLSEESYKDSTLIMQL
FT                   LRDNLTLWTSSEAEPAAESNTPAEKKEEAPAAEGEKPAE"
FT   CDS_pept        870531..870698
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057145"
FT                   /orf_name="AFUA_2G03300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87427.1"
FT                   /db_xref="HOGENOM:HBG052589"
FT                   /db_xref="UniParc:UPI0000520493"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI28"
FT                   /transl_table=1
FT                   /translation="MLRQSVRPLTTANRALTRSFSALAPRMGEGDTGAPRPGGIQSGYV
FT                   SFLCISLPSS"
FT   CDS_pept        join(complement(872021..873798),complement(871838..871961),
FT                   complement(871550..871759))
FT                   /codon_start=1
FT                   /gene_family="HOG000183759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751791"
FT                   /orf_name="AFUA_2G03310"
FT                   /product="Nucleoporin Nsp1, putative "
FT                   /function="structural constituent of nuclear pore "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="EAL87428.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="HOGENOM:HBG205267"
FT                   /db_xref="HOGENOM:HBG332871"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="UniParc:UPI000051E851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI27"
FT                   /transl_table=1
FT                   /translation="MSNTFSFGAPASSGASSGSLFGTAGNAFGSNQNSSNTTTGGGLFG
FT                   NVGASSSGTSTPSLFGSAPATGKSGNTLFGGGTSATSSSTPTGSTPAFSFGTQTKSGST
FT                   PQSPSLFGGGSQTPKPGESSASGQTGGNALFGNAAKPAGNIFGSAAATPAPSGGSLFGN
FT                   TSTTPAGPPPQGTAAGQGQSLFGQAAQKPGGLFGGLNATTTSSSTASPTATTAPATGGT
FT                   STLFGGAQQSQSSGGGLFGSNAQQKPMFGTTPSAPSGGGLFGNAAKDKPAESTTPTTTA
FT                   DGAAKPLFGAAPSAPAGQAQGSSLFKMPSSSADSGSKPAFPSLGTTTTTTTSQPSTALT
FT                   TSSDTPQKSLFPSLGGTTSATPSTTPAAAPAGGGLFGGLGASKPAETGAATTTTAPASQ
FT                   PAAATGGLFGKPAETTSSTQAPSTAAGATATTAGAKPSLTATSGPATSATPTTTGTAAG
FT                   TTTAAGGTALGASTVGPTPPAQSRLKNKTMDEIITRWATDLTKYQKEFREQAEKVAEWD
FT                   RMLVENTAKVQKLYGSTVDADRATQEIERQLASVEGQQEELSSWLDRYEREVDEMMSKQ
FT                   VGPGEALQGPDQERERTYKLAERLSEQLDEMGKDLTSMIEEVNGASATLSKTNKADEPI
FT                   SQIVRILNSHLSQLQLIDQGTSELQAKVSAAQKSGHILSSRFGHGFSSSGLGGGSAADD
FT                   FYRSYMGRR"
FT   CDS_pept        join(874373..874463,874517..875140,875240..875502,
FT                   875629..876315)
FT                   /codon_start=1
FT                   /gene_family="HOG000183748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751792"
FT                   /orf_name="AFUA_2G03320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87429.1"
FT                   /db_xref="HOGENOM:HBG052590"
FT                   /db_xref="HOGENOM:HBG332872"
FT                   /db_xref="UniParc:UPI000051F691"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI26"
FT                   /transl_table=1
FT                   /translation="MSERLSRPSSPYLEPPRRSTELEDSGAQDSVNAVSSAVPNSDDEH
FT                   FSDASEGHERSRSHPLSGRTSPIPLTRVERVDDRPAHGEVPGTVAYEKREQDAVPDEIE
FT                   IIPTGSHSRSSSTVGSQNRPLTPGGSPIPRTIVEKVDVNQPSHGDVPGTLAYEKRRADA
FT                   VPDLVIKASEPDIDSPAGDAESNEPGSVTGMQVPATVVSQVDSTAIEDSTYSLQAHRRR
FT                   PSDAAPDVIEKISDAPDHTSLRGSLTSQSLIRDSVEDDRDYEDNATPETPQDHAAADDF
FT                   DDFAEEQDLADDDFGDFDDGFQEPDGETAEPELIEPQQPLPHPLASFPDLHAALDQYLD
FT                   KLYPTSKNVESLPPLEPIQDASSIFSTERSLSLWSQLVAPPPLQPQNWVKSRIRRLFLV
FT                   SLGVPVDLDEILPASKQKKLVLPSINLSGSDTTGSAVHSRSHSQARKSGSQDGIDSPTT
FT                   SAPTGRHRTSRRRDRSPPPQLDLSAVRRLCATTDAALDGLTDAELRTHVKELEQVTLRA
FT                   SSVLEYWLKRRDGLVSEREAFEGVIENLVNHARRVRK"
FT   CDS_pept        876741..877697
FT                   /codon_start=1
FT                   /gene_family="HOG000216924" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903894"
FT                   /orf_name="AFUA_2G03330"
FT                   /product="Phytanoyl-CoA dioxygenase family protein "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL87430.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG052591"
FT                   /db_xref="HOGENOM:HBG327118"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000052025A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI25"
FT                   /transl_table=1
FT                   /translation="MASKPLPHHSKEIPSIHLTDTEICSRQINSHNLQRAIEALHQDGV
FT                   VIVQNAIPPFYLDQLNTLMTPDAYTLYEKRSTHRNFGPETGNIQQEVPVQKAIDRFREQ
FT                   IPDVEDGEPKAHDPLSMIIANPFATAIIECMLGPKPQLRFLSANTAFRTKEAGRQPPHI
FT                   DVAFDFPRVPFGFCVNVNLVGTTATNGATELWPGTHTDTDVSVLMPDNDGVIRKELVEA
FT                   RRKLCPPVQPLLPKGSIIIRDFRLWHAGMPNRTDEPRVMLVTVLFARWYRSELRMRLPE
FT                   SCKGEIEWGDLEPFVDWMGEDYDYLQGSHDHDFVLLP"
FT   CDS_pept        join(878093..878128,878191..878426,878499..878664,
FT                   878736..878876)
FT                   /codon_start=1
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267214"
FT                   /orf_name="AFUA_2G03340"
FT                   /product="DUF652 domain protein"
FT                   /protein_id="EAL87431.1"
FT                   /db_xref="HOGENOM:HBG296796"
FT                   /db_xref="HOGENOM:HBG499799"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI000051ECDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI24"
FT                   /transl_table=1
FT                   /translation="MGIAKKTRKFAQVKRAISQRDNRVKQPLNGKKEEKKPQGEELVRH
FT                   IPVAPSNMFFAANTALGPPYTVLVDTNFVSHTIRAKLDMLPAMMDLLYAKCIPTFTDCT
FT                   IAELEKLGPKFRLALRVAKDPRWNRLHCDHAGTYADDCIVDRVMKHRIYTVATNDKDLV
FT                   RRIRKIPGVPIMKVARGKYVIERLPDSFD"
FT   CDS_pept        complement(879623..883066)
FT                   /codon_start=1
FT                   /gene_family="HOG000183726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267215"
FT                   /orf_name="AFUA_2G03350"
FT                   /product="MIZ zinc finger domain protein "
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL87432.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="HOGENOM:HBG052592"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="UniParc:UPI000051E861"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI23"
FT                   /transl_table=1
FT                   /translation="MSPSTTKNRPHLPNNPHHQLEWSNSTANLFLGGVGVRRSWMLGAS
FT                   PSVSISSASGAPTIPLDSSCQSSLAVVSAPSSAFASAIANQPKSRPQGIQDPPSSSVTI
FT                   VPRSQKSQKDNNEVAFTANGNFINAPTASPPSVLMSPVTPGGILPQNREILPPCPGVPP
FT                   SLPVSTITATPNVSAPPVINESTVFVHATQPLQQSQSSSLPSPDSSSASHPSPASAGDR
FT                   NDRCLSHGVPPSPPPVSGPMQIHRQLENPRQINQRNLMPATAAPTTVGGERMAEETSAP
FT                   STIRGGQRHQEIESPQQFIAPAPPEAQQQSRPSMTSAPPDWNHIPSSPVGLGPSTSFIN
FT                   QTFWTQSQEALDAFVARADSAMLLSETVELPRTRLLRDACNEKDLFYLTLHQIYTLRTF
FT                   APSEFARLPYVSGQNETGMEVVQQLLVDNHRLSGDFLRWSVNFPRPLGVMCQTREFPIV
FT                   LHRIARSLGLFAEKWTAFDRHIRERGYPPLIDELVVQFGITSTVLLSIVFLALSRRIFG
FT                   TQHEDQLRSIYSKNKRNYVERFGSRHTPQQIHRENEHLIQAYKALSRAQISPVGQQTSP
FT                   VAQEHAAEPQRSLQPVGPTGQITYVAIPSPQMPSAQVPVHSSQSQTLPIAVYAPDAMNR
FT                   AAPMFLNGQRPQHPPPARPNLVHPRGLDISSQVPAGQMTGTAAQSPVPAPGGHQAQVVS
FT                   HSPSQDVRQIPPQPSLQAMSFTTPVHRITTQTRHVQGLVQQPQQNPPIPQPLLPPPGPL
FT                   PSTTTRPHPLRHALHQAHLRDPIVKWTFSGTGGETTDKETNLFHYLKSFAVPPTPLGQT
FT                   ESAFEWQFPLSRADFDRLPRIVPGDIGQRLVRSLVDGSLIYRLRCIRISPSAKEVSQHT
FT                   WCLTESVWPSVIYIFVNGVELYVRRKFHNGKDIPLDISGHLKEGLNTISLHFLRSAAES
FT                   RDVVYALAVEVMDILSFAQVKKLAQTLPAPQSRERICRRLSLSAADDELSIISDYLAVN
FT                   LVDPFMARIFNIPARGITCEHVECFDLETYILTRASKAGKAVLKENWRCPICGADARPQ
FT                   HLIIDGFLSEVRAELVRTGCLEGARAIRIKADGSWELKSDGDVTSSERELARVQESSSL
FT                   KRKREGVVSPLATQRPKTEGAGRESLASRESSASLVIELD"
FT   CDS_pept        join(885699..885756,885875..886018,886084..888869)
FT                   /codon_start=1
FT                   /gene_family="HOG000183715" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057146"
FT                   /orf_name="AFUA_2G03360"
FT                   /product="Polarized growth protein (Boi2), putative "
FT                   /protein_id="EAL87433.1"
FT                   /db_xref="HOGENOM:HBG052593"
FT                   /db_xref="HOGENOM:HBG332874"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI000051FB80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI22"
FT                   /transl_table=1
FT                   /translation="MALSTPPRGVRPGDFLLVVHDFDARGTDELTLRRGEKIELIELDE
FT                   GFGDGWYLGKDVRTGTTGLFPGVYTTAAPKIPIRPPREDMIVSDDPKPAAEDQLSSELV
FT                   ASPKSGESTPQASRHASISETQPPEVATDLSSMKSSPNQQHRSSSSPLPTSRLAVDIQQ
FT                   SIRQTLDGQLKGQDSPVMNETLSVIDEHITDLSTPRHSVANHENKASNDSSSEYSSHLE
FT                   HRVSYIRGHETDEEEENQPTEEQVRSWDAAETARHLRELGVEAKHCDIFEDQEITGDVL
FT                   LDMDQEFLFMKEFDFGVMGRRLKTWHKVKAFQEEVKGLKQQQQQRGSASSYPAPPEDRS
FT                   FSRASHTGPFLPRIPHLTRGSAGSIQHPRLVSSGISSTTSSPMTPQTPVFMDHQRRPSA
FT                   ASIREINHHRRHSSIDTGHRVDTSPHTGHFKQSSFDRNWTLASGSQRVPSRSGTYPIYP
FT                   EGVLPQHTLRRPDTNESDSAVSVTDRYDELERGYFSGPEGDTTKNRRLLQKRSSVTGSA
FT                   THSRQPSYADDKLKVNKRHSRISSVDSIRDTAKQAPAAVVDVQSTAAPKSRFRSLSTRV
FT                   IDRRGPTSQSSTPTSTEKPSSGFFSSFAPLAPFVGKSDAEGSGRASSLSISQSKSAGPK
FT                   TRRTGGLRIISDVVGKGIDTSVAPASPVRDTDPASVRTGSTTPSTSKSSERHSTESSIK
FT                   NAEGGISLPRPRASVKAGPKSKKDTSAYMRGLEKKTPQEQMDGCDYSGWMKKRSSNLMT
FT                   TWKPRLFVLRGRRLSYYYSENDTEERGLIDITAHRVLRADNDPIVALHATITGATASPT
FT                   SPSPSNGADTSPADKSSTSPSARNSKLDPEGPFFFKLVPPKTSRTVQFTKPAVHYFQVD
FT                   SVREGRLWMAALMKATIERDMSRPVETTNKQKTVSLKQARMMNQRPPALMTESELQETK
FT                   EEEKRNRASTETEERNNGLRIHGLNVDKAPVTGESKEDEPASPDSLDGLDTGPSCLLPE
FT                   TLLKSD"
FT   CDS_pept        889497..891227
FT                   /codon_start=1
FT                   /gene_family="HOG000183704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751793"
FT                   /orf_name="AFUA_2G03370"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87434.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052594"
FT                   /db_xref="HOGENOM:HBG332875"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0000520009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI21"
FT                   /transl_table=1
FT                   /translation="MSLLRLLLSRALVVLVPLAVTSSLYLYLYPIFQGCAFPLPVNKNG
FT                   RTPDAFSPAHSPLFHTLTQHIGQQPASEPAVFRLLVLADPQLEGDSSLPSPDKELSARI
FT                   KQHWTSIRSSVTDSGSPFHRDVLRNVTAALRTLAHEDVPRSIQAARKRLDLVGNDFYLA
FT                   HIYRTLHWWSRPTHVTVLGDLIGSQWVTDEEFERRADRYWNRVFRGGERVSDDITVTGS
FT                   AGYGAGSGDVSALEELNATDSAWTRRIINIAGNHDIGYAGDASEDRIERFERIFGRANW
FT                   DIRFQHTLGNQAGGTADATVKPTLHLINLNTLTLDGPALSEQVQSNSYAFINDLITHRT
FT                   YPVEDRTTFTLLLTHLPLHKKEGICTDGPFFTYHESDDEDGPDGIPRFKEGGLREQNHL
FT                   SEQLSAIGVLQGIYGMSGDKGVPGGGWGRNGLILNGHDHTGCDVVHFINRSTTTDSGDN
FT                   TNQQTWKWDARRYNEFPEDRSDTPSLREVTLRAMMGDYGGNAGLLSVWFDTNPAVNEWK
FT                   YEITMCKAGVQHIWWAIHGIDIVTILILLVYPLLPRTVGFERQRQTTKPVSTKGPQVKS
FT                   "
FT   CDS_pept        join(complement(892596..892615),complement(892136..892382),
FT                   complement(891880..891996))
FT                   /codon_start=1
FT                   /gene_family="HOG000183703" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267216"
FT                   /orf_name="AFUA_2G03380"
FT                   /product="Alkaline serine protease "
FT                   /function="peptidase activity"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87435.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG384371"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI00005206F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI20"
FT                   /transl_table=1
FT                   /translation="MTLGLPCGAVMNCCDNSGARNLYIISVKGVGARLNRLPAAGVGDM
FT                   VMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAGVIVNAKGEMKGSAITG
FT                   PVGKEAAELWPVSSLLFSNTSSG"
FT   CDS_pept        join(complement(895664..895852),complement(895301..895601),
FT                   complement(894698..895239),complement(893605..894639))
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208470"
FT                   /orf_name="AFUA_2G03390"
FT                   /product="Histone deacetylase RpdA/Rpd3 "
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="EAL87436.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="HOGENOM:HBG460465"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI000051E85D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI19"
FT                   /transl_table=1
FT                   /translation="MAAPPIDLNLNGSGDRSRKVAYFYDSDVGNYAYVSGHPMKPHRIR
FT                   MTHSLVMNYGLYKKMEIYRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDQFSKEQGKYN
FT                   VGDDCPVFDGLFEFCGISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVN
FT                   DIVLGILELLRFKQRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRD
FT                   IGVGQGKHYAVNFPLRDGIDDISYKSIFEPVIRSVMEWYRPEAVVLQCGGDSLSGDRLG
FT                   CFNLSMRGHANCVNFVKSFNLPTMILGGGGYTMRNVARTWAFETGILLGENLGPELPYN
FT                   DYYEYFAPDYELDVRPSNMDNANTKDYLDKIRAQVVENLKRTAFAPSVQMTDVPREPLV
FT                   EGMDDEADAILDDLDEDENKDKRFTKRRFDQYIEKPGELSDSEDEEENAANGVLRKPQS
FT                   LKRRNQINYRNVDLDSGLDSGVATPQEASSVPDDEMDTTADTKTVEAPLPESDVPPSPS
FT                   ATGSTSRRDEKAAAEPTEMAVDGPEEASASAAVSHQQSPKPQDEDTTMEDAAVSVPETG
FT                   QSEKPALPVEGQEEEKKPETPALEKAAPEASPAVQASPIPGEKDVLDKPETNDATEPVE
FT                   VKAKEKTPEAPTDQQAVKTEQGTSEEASENKSSSAPTEVRTNQQPEEPEKGGE"
FT   CDS_pept        join(896513..896581,896739..896992,897056..897591,
FT                   897644..897792)
FT                   /codon_start=1
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903895"
FT                   /orf_name="AFUA_2G03400"
FT                   /product="Proteasome regulatory particle subunit (RpnK),
FT                   putative"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="EAL87437.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG346862"
FT                   /db_xref="HOGENOM:HBG499867"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI000051E3B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI18"
FT                   /transl_table=1
FT                   /translation="MDRLNRMLQAAQGMGMGSAAPGGDTPNLIDNSETVHISSLALLKM
FT                   LRHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDPVFQTKMMEMLR
FT                   QTGRPETVVGWYHSHPGFGCWLSSVDINTQQSFEQLTPRAVAVVVDPIQSVKGKVVIDA
FT                   FRLIQPQTVVMGQEPRQTTSNLGHLNKPSIQALIHGLNRHYYSIAINYRKTGLEENMLM
FT                   NLHKHVWTEALQMNDFREEGQHNVERMKQLVSLAEGYEKRVKEETELTKEQLKTRYVGK
FT                   VDPKKHIEDVSQQLIEDNIVAVSRQMIDKEASVARLSNGKGAQEGTGMDVDEEL"
FT   CDS_pept        complement(898146..898985)
FT                   /codon_start=1
FT                   /gene_family="HOG000183669" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267217"
FT                   /orf_name="AFUA_2G03410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87438.1"
FT                   /db_xref="HOGENOM:HBG052596"
FT                   /db_xref="HOGENOM:HBG332876"
FT                   /db_xref="UniParc:UPI000051EF35"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI17"
FT                   /transl_table=1
FT                   /translation="MDSLSDAFGKVKIEGPSPDTSENQEDEDILEEESFPPTLFRFLDL
FT                   PSEIRLRIYDLVLFTPYRLKPRRANGSVGASARNPPIAPFQVRVALFLVCRRIHDEATD
FT                   YFYSALTFRVFPIQDWSRTPTVRALPARHKASVRTIELILGSSWTSPPREWVVNNRLGL
FT                   EKMVRVRTLKVFLECDPSHPVFEGFRISPGFYTDFAGKILKQVLERLPHVVQVEFDGYP
FT                   SVSKSGSLMKRLVYEARAAQKKILWGPERGWTDWDSEGEQKPNQVEFEDTDCQNSMQ"
FT   CDS_pept        join(899213..899444,899722..899918,899977..900681,
FT                   900739..901323)
FT                   /codon_start=1
FT                   /gene_family="HOG000183658" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267218"
FT                   /gene_name="tim50"
FT                   /orf_name="AFUA_2G03420"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit tim50"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL87439.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058716"
FT                   /db_xref="HOGENOM:HBG737458"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051F442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI16"
FT                   /transl_table=1
FT                   /translation="METFAAALGSGIEENLQSSQLIQPGMHDMRACRVKLIWVESTFKT
FT                   EEEKKKRSTKIGGRWRILRPVERAALMDSAARPVSFPKSRWYAKSSKPKAPYKLPESVK
FT                   PPQSEQPSSTPKPEYSAEQTEFDTKADPAGNAAPEASEATESKPQQPLPDLTQGIPSTL
FT                   AAELEGRTKKSGQTSLNLTEDPSRFEDYTDDGRGDIPKDGYVSSLDRRRARMANLMYAF
FT                   FLLAGAGGVAYLGRNWETEEEAKAHPDIPSGWSFSSWYNRMKARLSDITSYYKDPAFPK
FT                   LLPDEDPNLRQPYTLVLSLEDLLVHSEWSREHGWRIAKRPGVDYFLRYLNQYYELVLFT
FT                   SVPSMMADQVLRKLDPYRIIRWPLFREATRYKDGEYIKDLSYLNRDLSKVILIDTKEEH
FT                   ARLQPENAIILDKWLGDPKDKNLVALIPFLEYIAGMGVEDVRPVLKSFEGTSIPVEFAK
FT                   RERIMREKFEKELEEERKRRPKRGVGSLASALGLKSTRTLDGEQSPSEGLAQGKMLWDQ
FT                   IRERGQKNYEMIEKEIRENGEKWLAEMAAEEEKARQEQMKMMKGSFTSMFGAGKQ"
FT   CDS_pept        join(complement(903401..904095),complement(902904..903341),
FT                   complement(902464..902848),complement(902264..902399),
FT                   complement(901753..902189))
FT                   /codon_start=1
FT                   /gene_family="HOG000183646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267219"
FT                   /orf_name="AFUA_2G03430"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87440.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052597"
FT                   /db_xref="HOGENOM:HBG331345"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000052024B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI15"
FT                   /transl_table=1
FT                   /translation="MPPATTQNSSTQKHSSPGFNAGARPYRSHKVRACDLCRKRKSRCT
FT                   VDIPGQSCLLCRVQGADCHYQEEPLPDASVSNGSDSKRWSVDQVSESLGTGQKRKRTLD
FT                   TTISSPNPSRRRESFSRPRAYSDSRGTDRRRNGTEDPHNESVFIVGPVVADDAQVIEKF
FT                   MPPEERSSKSVEPKSHPYNVYSSDPRKPILYTTVSRRRQGMRVGVPPGENQKEILEQIL
FT                   GPFKHDLVRLFLDRFNVAFPIFDGESFWEAYISESPGEPPASLLCQVYSMSLVYWKHTP
FT                   KLACHPKPDVRYAVNMTVAALHEEFSAPGLSTISAALVDLTGRPIFSMTGNAISCGRLV
FT                   ALAHCLGLNRDPSNWKLSPQEKDNRIRLWWGVVIHDRWGSFGHGVPPQIAKNQYDVPLP
FT                   TIDVLVPPTHRTTERVRAAHCHICLCRLTEILGELLPLVYGLQHNLPRETTKKLRQIRT
FT                   DLDMWEDSLPDWLRTPVHHSSESRVSGISSLQLSFLAVKMLVSRVELKEVNNAETDNPE
FT                   ARRYFQTECRKSAEEIVQFISSLRKQNFQEFWLPYSAFHLTSTATLLVRCALETTDSEV
FT                   ARSCLANVETFRSILRRVREEEDWDVADMCLDHCERILNRLAANGGTADPTLNPSTGQY
FT                   DNRIVNPAAISLPVSLPETQTNNDIVDDMMSISGTFGTMDGFPFDMTGIWDVSVFQDVN
FT                   LT"
FT   CDS_pept        join(905406..905557,905659..908415,908557..908572)
FT                   /codon_start=1
FT                   /gene_family="HOG000183635" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057147"
FT                   /orf_name="AFUA_2G03440"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL87441.1"
FT                   /db_xref="HOGENOM:HBG052598"
FT                   /db_xref="HOGENOM:HBG332879"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051FDCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI14"
FT                   /transl_table=1
FT                   /translation="MDQDVRMPSGEQVEGSCLVQEECQLCIGSEKEARGQTSVPFGLLP
FT                   RSVIEQILYLVDANTFASLALLNRKWRRISDCAALYAHHLSRCSSFSATGEPISSAANP
FT                   ENLAYLKRRFLSEIRRNAFEVFLRPRQTLIKLISTSMSSSTAFPQGEAFRFAFSPNAQM
FT                   ILCISSSRIVVLDVTSDSAAVKHELKIWRRPLNATILDDGSLLAVVSSDHQINIYSLTN
FT                   EEASLIQDLKLTEVPRALALSPSGGVLAVAYSDKIEMYAIREGALTTERRAVRCDGVDA
FT                   ISFSSDGVMLIGSSSQSASSSLVTITVPFYTAPDTESSPREVQVRMWTTQILFPDLISG
FT                   YSHACLLPLRAEGEGSWILGYDRRIRAFRAFGVTNANSGTTYFVGPISANTLQEALPTM
FT                   LPSADGQGELVALGFQDSGLWVYGVPSQLDIARSAGETQASPSPPQRHSMRNLGTLPHN
FT                   NALRLEWTIDKPKTIVSGHKMSDLPGMTAARWVRYAHSMVGQRRLVAVAPGGVSPPTIG
FT                   DEDVPVDGGRVLLLDFERSTTNGQITEVSIEIGEAEPKLLSEPNSSLDTEVELERRRTL
FT                   LHRSDAVSQQIRAAARETRTSINRDNHHILSFSPRRHSSFFSSSSNDNEMPLIPDSPYD
FT                   NTQPRSQDTLRRAATAASSSRGRYNPLYRDRWSRIQNERQIPQVPEAFQIPHESDADNW
FT                   VPPPPPYSSEPDAPLPEYLRRTLLPTRPDSSLRVGVAPTSIRRSQTTRWDNVSQEETSA
FT                   TPPQRLNTVTGSLWARRRRDSETRHQRLRPDDIFRRRDRSASRSRQTESPVARPRSPTN
FT                   VEAPSAGVDGTHSPTHSPLPISPAPAPLQAQPMIDQPFLHHDWQFDASAALIIPQGMNS
FT                   YPFSVSSPNLQVSGSEFIDPATVRNSSRPHGVHRSATRRSQSHDIRLPSTGIQPLNRRV
FT                   STDPTLSSTSANELWRRRIEEWNEQTIYERSKRRSRCVLIASEF"
FT   CDS_pept        join(complement(910651..911146),complement(908788..910574))
FT                   /codon_start=1
FT                   /gene_family="HOG000183624" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267220"
FT                   /orf_name="AFUA_2G03450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87442.1"
FT                   /db_xref="HOGENOM:HBG052599"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000051EA92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI13"
FT                   /transl_table=1
FT                   /translation="MTITQELVKDKTAEDSDRPSAEQPPGYDQIDEQPSTIPPLDLSHN
FT                   AGPPASTTVTRDQCVAHLKFIAALADLRDSVAGNDGLFGLHDPPPTEFPDHINEVRARM
FT                   REKRWAVYTARAVDRYTKWWVKCVPNDRPRARLTDLMDESYDHITQDIRLISWSKDSLP
FT                   PLGADVLMVWHAHMLNPRAFLEDCIRSGKMCCWASGFPWETINDCIDNRTLEYDAGDRA
FT                   RVHFNRMTRFAWENLDDPLNKLIECPACENTVSVPWTQGRISLPLQTAFDKFNGYADKN
FT                   FHVKCPKCGSTVDHELLRVRKFRRDVANWLKEKMPMPGTLYNMRGIPQSTRSQTRQHSM
FT                   FPNRLVEILGSDLLDYTDARQARCTTVSQLRDQLEIKLKDRRIVHQANGRRLSFADGVV
FT                   FRRMMSHYWNNTGPFALDLVGAVIRQGTFVQKMDHIDWLHSPTVMATMDRLIRKYHVFF
FT                   YIMASNQLRMAVPTLDVDLAWHTHQLAPQRYFEYSVYQTKSHTSTRTATFIDHDDKVDE
FT                   NRLSDGFEWTSKMYRRLTGGEIYSECTCWYCEAIRAPDLRGGPFVSSTTAKARETAANL
FT                   HDRQDISSDPERNPHISAHNAVRAETKDKLRGIDPRRVQALRLRHNYEKARRRAEKRNR
FT                   KLGKADDPKRRSSSSAADANMYPVPVVWGVPVVVPYYGPYMCDPGVTPDAYASNPTCMS
FT                   TIAGDHGNCCTGTCGGGVAAGSCCGLGESSSTGCGGGGGGGGGYDGGGGAGCGGGGGGG
FT                   GCGGGGN"
FT   CDS_pept        join(911927..912220,912232..912313,912358..912692,
FT                   912773..913221,913277..914034,914087..914620,9
FT                   14683..914993)
FT                   /codon_start=1
FT                   /gene_family="HOG000183613" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267221"
FT                   /orf_name="AFUA_2G03460"
FT                   /product="C6 transcription factor (Leu3), putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87443.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052600"
FT                   /db_xref="HOGENOM:HBG326475"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E3A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI12"
FT                   /transl_table=1
FT                   /translation="MNHTNNHRRHQRRIAQYNQFKVRRASSTHIQLFDGVHKWWEALSH
FT                   VDPARERVRDRTVARLSPACYSSIAEGSIESHEESTGWVLGFSDRNYLLQKALIFSCIS
FT                   SWRWIPRFGQKDRRVTAGLGKIIVNVPSLASIGGSSSGIGGGGAQGDILEPTSARNTNN
FT                   ASAAAGPVMGGTGQSSTSPAVGPDGLGQVKKRTVAMAGLESSPGSVDDVEDNDQREEKK
FT                   RQPVKRACNECRQQKLRCDVIQDPWTDCSRCRRLKLECKIESNFKRVGKRSRNAEMERE
FT                   IIELRKQIASVQANPAAMTPQQHAPSLHSAHVTPKQESSHVSPAGVYHTPSAISSDQYM
FT                   GSHEAVASLLDLRSGFEGSNYMRNGNLFKRIEDVVVAPEKVTELFDLFFMFYHPFLPFL
FT                   DRQRAPDDYYSVSPLLFWTIISVGARRYQTDTHLLNSLAGPVTRLVWSTLADIPQSYHV
FT                   VKALCLLCSWPFPTSSTSTDPTFMLCGMMMQVAMQLGLHRPSHTQDFSKFRVELIEEEL
FT                   RDKVRTWAICNVVAQRYVRILLLSWTSALTDSSVATGYGQPPSTLYDWTLSASGSVDPN
FT                   FKLPEDIRRRLDVEIFCDKVTKTLYTNRRDPVGLCSDQERSTLISFLSRDFDDLEDQVK
FT                   SRTDAITDLFLRAANLHLHLSAFFDDPRAKDYRERLLSLYVATTSFLEAAMSLETDVGP
FT                   VLSYTPYYVYQMMVAGACTLLKLCKSFFSAHIDMDYTKTLFNRTIWAIRGVSVSSNDLP
FT                   ERLAEVLAQMWRMGSTPQQKASATSAEVDDTLMLKVRCRMSMSLLFDSVWRWREDAQTK
FT                   GRNIEAYLKNPTNPDSNSESSASSTAGPAGRTSSSTPGLPADPSLASATMIPQGSLGVA
FT                   PASGVTNLPSGFLEPNYEVFDPLNWLLDGLVDLPYSYSAMSGMEPQTIA"
FT   CDS_pept        915393..915866
FT                   /codon_start=1
FT                   /gene_family="HOG000048353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267222"
FT                   /orf_name="AFUA_2G03470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87444.1"
FT                   /db_xref="HOGENOM:HBG052601"
FT                   /db_xref="UniParc:UPI000051E5F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI11"
FT                   /transl_table=1
FT                   /translation="MSAESRKTTTRIGTGTTTASYQTHRPASSLLIASKRLLVKPSPVP
FT                   QTITPNVHPASITIKPSLSSIATPTRPTDRSKAHTVEMDLSQPPQPFLDPGVWERMKAA
FT                   GRDASRGPSAEREEGEEERRRRREREAEFGQMAVRGRMGGLGRQEMIHRRRLH"
FT   CDS_pept        complement(916189..918801)
FT                   /codon_start=1
FT                   /gene_family="HOG000183602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903896"
FT                   /orf_name="AFUA_2G03480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87445.1"
FT                   /db_xref="HOGENOM:HBG052602"
FT                   /db_xref="HOGENOM:HBG332881"
FT                   /db_xref="UniParc:UPI0000520484"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI10"
FT                   /transl_table=1
FT                   /translation="MPGVETTGASVNSPKSVLERPLFRSGKPLPRGAEVPWDPDLAHSA
FT                   SSNNGGHISGAIPIATAPALPLTPPSAGHEEASSNDASGMQTTTSSHSANYIHGAMTPT
FT                   KPSRPPTPETTPPRITSSTYRPSLSQFGHTSASSRAESFQTAREMISDGETVTPRRSTQ
FT                   SLHHQKQRRPYKQKSSQNESPPGSSDASFGDDRSTPAQSDETLRPTNVESYDGCDKERA
FT                   PSGDRRPRIRTEKSPSRSAVDGNDEDLPPLRGRKLRDRVKDAQIRMASPSLEQFREEIG
FT                   WPPAEEEFRRYSGVSTSSTIEAMIIDAPRPANRKLRHTGKRQSLRSTSSPVTKSARTSL
FT                   VSNPDSQHRLVHKDARITEQVRKSIASETSVPASATADGPPRNIEVVPVVVIPERRSSL
FT                   RSSHSDSRNPSKAGSRRRSSQRPESARKDRPPSLDLTRQRKRTFSDSIATATPASRPRG
FT                   RSLGRPVIPPRSSSLSAPTSRDSSRRPSFASERLPNQDLLMDREMDKIPIEQLEPRLDN
FT                   QTSNAGRWDATDAPKTQSIWIGIEDMTHLRPPSILFTPASVASSSPGLIEIKEAKTVAF
FT                   FPHNNESLLLVDQPVRAALDHPASQPDDCQRQRDSRTPENLLPQDSSHVHSPLRNPRPP
FT                   PNPPVPNVIPPTPEDEADRQLRVSDERDESNGINLRRFGSLRRRVVRPRSDSFDRFVRS
FT                   LSVASAKNRKAGRDIDSRLHPFWRPRRFWDDSPESEEPPQQAARTESDHIISNSLGMPQ
FT                   PRVVFDGPSLARRSPFQGTNPRRHPKRSSALIGSTMLSPEALRSQTSLHRRRMLSLSWW
FT                   RLRLQLGPVRNFRRRLRRSLQQWEEAKREARREKLKQKIGEAVLVGSSMQARDLLNRP"
FT   CDS_pept        join(921519..921980,922116..922166,922329..922573,
FT                   922648..923827)
FT                   /codon_start=1
FT                   /gene_family="HOG000183591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267223"
FT                   /orf_name="AFUA_2G03490"
FT                   /product="Calcium/calmodulin-dependent protein kinase,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL87446.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG738506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020650"
FT                   /db_xref="UniParc:UPI000051E3A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI09"
FT                   /transl_table=1
FT                   /translation="MSTIQNLKNFIRHGKQARLVTPHAEPTTDVSPVHAEQQRQPQGSY
FT                   PPAADNLDAIDSKMGHAHTHQQQSEPPQSQPQKSPENKQVRTAKIEQIVAEERSSRTKM
FT                   PKYPGLERYILLEKMGDGAFSNVYRAKDTTGEHDEVAIKVVRKFEMNSHQHDAHLHPNF
FT                   RKKPKAAERANILKEVQIMRQLDHPNIVKLIEFSESRQYYYIVLELCPGGELFHQIVRL
FT                   TYFSEDLSRHVIVQVAKAIEYLHETSGVVHRDIKPENLLFYPIPFVPSKNPRPVQPGDE
FT                   EKVDEGEFIPGVGSGGIGTIKIADFGLSKVIWDSQTMTPCGTVGYTAPEIVKDERYSKS
FT                   VDMWALGCVLYTLLCGFPPFYDESIQVLTEKVARGQYTFLSPWWDDISKSAQDLISHLL
FT                   TVDPEKRYSIKEFLAHPWIRQTDEATEAADDAPPLATPLASRQTKQQPLDAQAADQAPY
FT                   APVSARLLGPASAGLDRPMDFRSPGAINLREVFDVGYAVHRQEEEGKRRKNFRQGYRGA
FT                   NPTTGFQSALNPLNEDNDDDEEDDVTLQHVQNDAYPPAKIPKASQDAGDVAAMEAKLRS
FT                   TNLGAPSHAAQARQAPQSRQQGYGTHSANVVAAAKQSINRHSRQPFELSLSNATLLEKR
FT                   GRRQQGQAVV"
FT   CDS_pept        join(complement(926660..926942),complement(926426..926525),
FT                   complement(925864..926013),complement(925371..925804),
FT                   complement(924729..925294))
FT                   /codon_start=1
FT                   /gene_family="HOG000183590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267224"
FT                   /orf_name="AFUA_2G03500"
FT                   /product="Sugar transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="carbohydrate transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87447.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG052603"
FT                   /db_xref="HOGENOM:HBG397669"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000520485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI08"
FT                   /transl_table=1
FT                   /translation="MPFFNPFRKHDQTTFHGVVIPLSSAPSHARPESPALEKKGSPKEK
FT                   PDDSSLDKAPSQENGSAASIPERSHLTIESLRAEIESDVAASGHDTAYDRKSKVINRAI
FT                   QDIGMGRYQWELFCLCGFGWLADNVCALFACLGLGVGGNLPVDGALFLEFLPFASGNLL
FT                   TMLSVWWPVGQLIASLIAWGLIPSYSCADDLPSCKAVGDGVACCGKDNNMGWRYFVLTM
FT                   GSLTIVMFICRFFLFHLYESPKFLLARGRQDEAVAAVHGIAYKNKTKTWLTVDILNEIG
FT                   GYPEENAPQTLSTKEIVQRNLSKFSLQRVRPLFATKKLGFTTVILWFCWTTIGMGYPLF
FT                   NAFLPQYIKNAGGSTEASTYVTYRNYAITSIVGVPGSILACYTVDIKYIGRKGTMVIST
FT                   LITGVLLFCFTASTNSNVQLVCSCLEAFFQNIMYGVLYAYTPEVFPAPSRGTGTGISSC
FT                   LNRIAGLCAPLVAIYGGSSNPNSPIYASGGLILASFVAMCCLPIETMGKQSL"
FT   CDS_pept        join(complement(932303..932504),complement(931956..932238),
FT                   complement(931656..931882),complement(930704..931596))
FT                   /codon_start=1
FT                   /gene_family="HOG000183569" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903897"
FT                   /orf_name="AFUA_2G03510"
FT                   /product="Carboxypeptidase 5"
FT                   /EC_number="3.4.16.-"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL87448.1"
FT                   /db_xref="EMBL:AAR96057.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG052604"
FT                   /db_xref="HOGENOM:HBG327432"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI0000453BFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5VJG7"
FT                   /transl_table=1
FT                   /translation="MLFGSVASTALLALSLCLDSASAAKHGRFGQKARDSLAKRSSSSL
FT                   VTHEPETRSRHKDFRFLNKDTKPYLVKSLPDVKFDIGEMYSGSVPIDKGNKSRELFFIF
FT                   QPTIGEPVDEVTIWLNGGPGCSSLEGFFQENGRFTWQPGTLAPVENPYSWVNLTNMLWV
FT                   DQPVGTGFATGKPTATSQEEIAEDFIKFFKNFQEIFGIKNYKIYVTGESYAGRYVPYIS
FT                   AAMLDQNDTEYYDLKGALVYDPCIGQFDYVQEEVPAVPFVQQNANLFNFNASFMAELER
FT                   LHQTCGYQDFIDKYLVFPPSGVQPPKMFNYTSDAECDVFDMIKTAAMAVNPCFDIYEIN
FT                   LMCPLAWDVLAFPTELVYQPAGATVYFDREDVKRALHAPSIKWAECADEAVFVGGSGGP
FT                   EQEGDFSANPIEHVLPQVIEATNRVLVSNGDYDMIILTNGTLLAIQNMTWHGQLGFQSA
FT                   PSTPITITLPDLHYADVYAENQMTGVDGAQGVMGVQHYERGLMWAETYQSGHMQPQYQP
FT                   RVTYRHLQWLLGHIESL"
FT   tRNA            complement(933971..934042)
FT                   /gene_name="tRNA-Ala"
FT   tRNA            935026..935097
FT                   /gene_name="tRNA-Ala"
FT   tRNA            complement(936945..937016)
FT                   /gene_name="tRNA-Ala"
FT   tRNA            937478..937549
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        join(938464..939860,939935..940100)
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751794"
FT                   /orf_name="AFUA_2G03520"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87449.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG052605"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E39C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI06"
FT                   /transl_table=1
FT                   /translation="MLTNTKTFGIANVDERDHHTSKESQPVSQETSPLSHSEKQQSTAA
FT                   PRAASENPLVGGTGKLESLTQHNSQDGLPSTGETNRALEEGGYGQCINGTSSDTSEYRI
FT                   PVSRVTTDAEGNTYPEGGLEAWLVVIGSFMGLFASLGLVNTIGTFQAYLQDHQLKEYSP
FT                   GNVGWIFGVYSFLTFFCGVQIGPVFDAKGPRFLVLAGSILVMVMMIALGFCTKYWHFML
FT                   VIGIAGGTGTSLIFTPAISAVGHFFNEKRGVATGLAATGGSVGGIVFPLVLETLFPKIG
FT                   WAWATRVIALICLILLIGSCLLVKSRLPKKPASKENVLPDFWIFRDAKFAFTTAGIFFI
FT                   EWGLFVPISYISSYALAHGVSTKLSYQMVAFLNVGSVLGRAIPGFIADFLGRFNALIVT
FT                   VALCLLCNACLWLPAGGNVPLMIVYCVIFGFASGSNISLTPVCIGQLCKIENYGRYYAT
FT                   AYTIVSFGTLTGIPIAGEILSRCNGEYWGLIVFTTCCYALGLACVTAAKLIHVGWRQPW
FT                   DVY"
FT   CDS_pept        940954..942954
FT                   /codon_start=1
FT                   /gene_family="HOG000216925" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267225"
FT                   /orf_name="AFUA_2G03540"
FT                   /product="Extracellular threonine rich protein, putative "
FT                   /protein_id="EAL87450.1"
FT                   /db_xref="HOGENOM:HBG052606"
FT                   /db_xref="UniParc:UPI000051F1B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI05"
FT                   /transl_table=1
FT                   /translation="MHTGRQALPLAAAAWMLLHGAIAAPKPGGLGHLPPPEALRSAGLA
FT                   SAALSSSLAAIMESGIPPATHTVTVSFGGTATESLPTPAPPGGATHSPITTAPTGGTAP
FT                   PGGAAESPITTVPPGGTVPPGGATHSPITTAPTGGAATGSRPGTSSAGGIASTVPPVSS
FT                   PTGGGVPTSEGPGFSPAGGGVPASASNPFTAFVPPSESPVAPKVGTQACPPCPTPAAPT
FT                   CAPCPAPGTSTTTFTVTITETVCTGQVTQGGGGSTASPGVPAISPLFSATGPGALTSTA
FT                   AGPGGPQGPTATETHLSSAPHAPGGAAGATAGPSTQPTTSATGVPSVPQIPGGGGGGAA
FT                   AGPATSLPVTSATGVPNIPHGPGGGPSGFPNTTSSQVVATTTETIVSTVPLSTHGGGAA
FT                   TSGAVQTSRLSVTTGISFANVTRTPSGGQTGLPSVTLTPAIPTGPGISNVTGTVGGGVS
FT                   VSTPTSATISATPTRPGGTAPPGGGVPISTPIIATSPATPTRPGTVSTPIIATSFATPS
FT                   GPEVAPPAGTVVPGTAATPSGIVAPGGGVAGGGTAAPREGVASRGAPAPGGAAPGGGVP
FT                   TVVISGGSTTAISTTTIQVQTLSVLPSRPPLPQSQGNTATRPVTTSTVTGVRPPQSTPA
FT                   IDPKKRTVAEKTDIGRPDKLKANPIVFRRRT"
FT   CDS_pept        complement(944109..948122)
FT                   /codon_start=1
FT                   /gene_family="HOG000183568" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267226"
FT                   /orf_name="AFUA_2G03560"
FT                   /product="Two-component osmosensing histidine kinase
FT                   (Bos1), putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87451.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG220979"
FT                   /db_xref="HOGENOM:HBG309709"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000051EA93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI04"
FT                   /transl_table=1
FT                   /translation="MTGADETLTAASAILQTLARGPDASISDPNSSHKTTNGCDTKFAK
FT                   LPGEPSQAKAAFEFELEALIRRVRHLEFQVVSHQPYPRPAPELPLSSTKNSDFLWLFGL
FT                   SRLSSHEGAASNSSCGMQQETSRRRQRTRRIRREAEDNEADEALDDDDSDDDVDSRTRL
FT                   VREEDISYLRNHVQKQAEEISFQKDIIAQVRDELLQQEEHTRRALTKVENEDVVLLERE
FT                   LRKHQQANEAFQKALREIGGIITQVANGDLSMKVQIHPLEMDPEIATFKRTINTMMDQL
FT                   QVFGSEVSRVAREVGTEGILGGQAQITGVHGIWKELTENVNIMAKNLTDQVREIAAVTT
FT                   AVAHGDLSQKIESRAQGEILELQQTINTMVDQLRTFATEVTRVARDVGTEGVLGGQAQI
FT                   EGVQGMWNELTVNVNAMANNLTTQVRDIATVTKAVAKGDLTQKVQANCKGEIAELKNII
FT                   NSMVDQLRQFAQEVTKIAKEVGTDGVLGGQATVNDVEGTWKDLTENVNRMANNLTTQVR
FT                   EIADVTTAVAKGDLTKKVTANVQGEILDLKSTINGMVDRLNTFAFEVSKVAREVGTDGT
FT                   LGGQAKVDNVEGKWKDLTDNVNTMAQNLTSQVRSISDVTQAIAKGDLSKKIEVHAQGEI
FT                   LTLKVTINHMVDRLAKFATELKKVARDVGVDGKMGGQANVEGIAGTWKEITEDVNTMAE
FT                   NLTSQVRAFGEITDAATDGDFTKLITVNASGEMDELKRKINKMVSNLRDSIQRNTAARE
FT                   AAELANRTKSEFLANMSHEIRTPMNGIIGMTQLTLDTDDLKPYTREMLNVVHNLANSLL
FT                   TIIDDILDISKIEANRMVIESIPFTVRGTVFNALKTLAVKANEKFLSLTYQVDNTVPDY
FT                   VIGDPFRLRQIILNLVGNAIKFTEHGEVKLTIRKSDREQCAPNEYAFEFSVSDTGIGIE
FT                   EDKLDLIFDTFQQADGSTTRRFGGTGLGLSISKRLVNLMGGDVWVTSEYGHGSTFHFTC
FT                   VVKLADQSLNVIASQLMPYKHHRVLFIDKGQNGLQAENIIKMLKQLELEPIVVRDEDHV
FT                   PPPEIQDPSGKESGHAYDVIIVDSVDTARLLRTYDDFKYVPIVLVCPLVCVSLKSALDL
FT                   GISSYMTTPCQPIDLGNGMLPALEGRSTPITTDHSRSFDILLAEDNDVNQKLAVKILEK
FT                   HNHNVSVVGNGLEAVEAVKKRRYDVILMDVQMPVMGGFEATGKIREYEREAGLSRTPII
FT                   ALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILKCATLGGSLLEKSKESRLSSSG
FT                   EIHHHSEGKRPGMETRSITASGSIDRGFSSPAAAKDDEIAMERVSDYRSPKAV"
FT   mobile_element  complement(950087..951610)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(953968..955430,955487..955580)
FT                   /codon_start=1
FT                   /gene_family="HOG000230294" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751795"
FT                   /orf_name="AFUA_2G03580"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain
FT                   cytoplasmic"
FT                   /EC_number="6.1.1.20"
FT                   /function="ATP binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87453.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="HOGENOM:HBG236716"
FT                   /db_xref="HOGENOM:HBG497668"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI000051F44D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI02"
FT                   /transl_table=1
FT                   /translation="MASDLTNSILDALSASDGPILSDKAFPSTPSLDLKSALDRLASRS
FT                   MIEYERMEREAIALTKEGEEIAANGSHEAKVFQAVLAAMDGLKIGDLPGIVGKENAKVG
FT                   QGNAFKKGWIKKDKDVLRPNTESIVDETREQLLTVKNTQTLSDQKAVADLKRRKLIALQ
FT                   KVFTFRISKGPKFAKEFVKEETDLTPEMLANGSWKTVTLKPYNFKAKGAPTPAGAFHPL
FT                   NKVRQEFRNIFFEMGFEEMPTNRFVETGFWNFDALYVPQQHPARDLQDTFYISDPATAD
FT                   PPREDPLNDPHRLKSVHPASVVSSEKPLDYKEYWENVRQVHENGKYGSIGYRYPWNADE
FT                   ALRLVLRTHTTSVSTYVLHKLAANPRPARYFSIDRVFRNEAVDATHLAEFHQIEGVIAD
FT                   FGLTLGGLIGFMEVFFAKMGIHQLRFKPAYNPYTEPSMEIFGYHKGLGKWVEIGNSGMF
FT                   RPEMLEPMGIPRDMRVYGWGLSLERPTMIKYGVSNIRELLGHKVDLNFIETNPVVRLEK
FT                   D"
FT   CDS_pept        join(complement(956852..956883),complement(956337..956571))
FT                   /codon_start=1
FT                   /gene_family="HOG000183557" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267227"
FT                   /gene_name="rps21"
FT                   /orf_name="AFUA_2G03590"
FT                   /product="40S ribosomal protein S21 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87454.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG499967"
FT                   /db_xref="HOGENOM:HBG524262"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR018279"
FT                   /db_xref="UniParc:UPI0000520494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WI01"
FT                   /transl_table=1
FT                   /translation="MENEKGEIVDLYVPRKCSATNRIIKANDHASVQISIAKVDENGRY
FT                   TGENQSYALCGFIRARGESDDSLNRLCQRDGYIRNVWSASRQR"
FT   CDS_pept        join(complement(958389..958404),complement(958343..958374),
FT                   complement(957863..958229),complement(957200..957819))
FT                   /codon_start=1
FT                   /gene_family="HOG000183534" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267228"
FT                   /orf_name="AFUA_2G03600"
FT                   /product="NUDIX family hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87455.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052607"
FT                   /db_xref="HOGENOM:HBG332896"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000051F69B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WI00"
FT                   /transl_table=1
FT                   /translation="MAAKKGATGDTQAELKLTCNSVILISPKNEVLLLHRVKTSTSFAS
FT                   AHVFPGGNLSAEDGECPAAEDPKRHEDAQWYRNAAVRELFEESGILLARDKNTGVMLAV
FT                   SEAEREKGRRAIHQHEVTFVDWLKKQNAAAVPDIADGATEPLIPFTRWITPTNVPKRYS
FT                   TQMYLYFLPLPAESDQSVLNEIPAEGEREEIQVPTSDGGVEITEAMFLPAAEWLRKAQS
FT                   GEIIMFPPQFLLLHLVSQFLDKEPRATASPEELRNRRAELVEFVHSGTPPWTEKCISPK
FT                   MLKMSSDGRTVLALDHPGPEFDGTTRAGEPDRVVYVQFKQGAARKLDVRWKKDVFAEQA
FT                   KSSL"
FT   CDS_pept        join(complement(960834..961023),complement(960466..960774),
FT                   complement(959122..960263))
FT                   /codon_start=1
FT                   /gene_family="HOG000165752" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267229"
FT                   /orf_name="AFUA_2G03610"
FT                   /product="IMP dehydrogenase, putative "
FT                   /EC_number="1.1.1.205"
FT                   /function="IMP dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87456.1"
FT                   /db_xref="GO:0003938"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG022073"
FT                   /db_xref="HOGENOM:HBG298985"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="InterPro:IPR018529"
FT                   /db_xref="UniParc:UPI000051E3AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ9"
FT                   /transl_table=1
FT                   /translation="MPIANGDSLGCAMKADIQDYTKALEILEKEYTTRDGLDVDTLLDS
FT                   DKHGALTYNDFLILPGYIGFPASDVTLDTPVTKRVSLKVPLLSSPMDTVTEHNMAIHMA
FT                   LLGGLGVIHHNCSPEDQAEMVRKVKRYENGFILDPVVLSPKATVGEAKALKAKWGFGGF
FT                   PVTENGTLRSKLVGMVTSRDIQFHTNLDDPVTAIMSTDLVTAPAGTTLAEANDVLRSSK
FT                   KGKLPIVDADGNLVSLLSRSDLMKNLHYPLASKLPDSKQLICAAAIGTREEDKHRLKLL
FT                   VEAGLDIVVLDSSQGNSIYQIEMIKWVKKTFPEIDVIAGNVVTREQAAALIAAGADGLR
FT                   IGMGSGSACITQEVMAVGRPQAVAVRSVASFAARFGVPCIADGGIQNVGHIVKGLAMGA
FT                   STVMMGGLLAGTTESPGEYFVSNEGQLVKAYRGMGSIAAMEDKKAGAGSKDSKASNAGT
FT                   ARYFSEKDRVLVAQGVAGSVLDRGSVTKFVPYLVAGVQHSLQDIGVKSLDELHDGVNKG
FT                   IVRFEMRSASAMAEGNVHGLHSYDKKLYS"
FT   CDS_pept        join(961034..961186,961900..962249,962306..962506,
FT                   962563..962727,962785..962928,962988..963264)
FT                   /codon_start=1
FT                   /gene_family="HOG000048354" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267230"
FT                   /orf_name="AFUA_2G03620"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87457.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051E5FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ8"
FT                   /transl_table=1
FT                   /translation="MRERLYGFYRNAQRRVSDQDNQQIDDRNVLLMEKVFLSQRKERKK
FT                   KREKLEYLRNRKGPTQPSDVEAQTKTSLVYSNLAISSKWRLRWVRKVLFNRLRHRRVNK
FT                   NRGQCSVPTGVTLNDSGTKDLIIRLEKHMVPPSEATKLESKGHFVEYVGSGKLKDKKVL
FT                   ITGGDSGIGRAVAILMAREGADITIVHLPEEIDDAEETKRAIEHEKRSCLLVAGDLRAH
FT                   NMCRRAVEEHMNKFQRLNVLINNASKQYMNKNFADIDLNKVEDIFRTNIIQMMALTKYA
FT                   LPFLSKGDSIINTTSVVTFRGSSSMVDYAATKGAVVGFTRSLASQLLPKGIRVNAVAPG
FT                   AIYTPIQVDTRDAEQMANWGSRTPLGRPGEPSEVATTFVFLASADASLYCKCTICFCLQ
FT                   FWMRTSQLRIVQTGRSCIVIPWVIDQGVSE"
FT   CDS_pept        join(complement(963544..963828),complement(963319..963435))
FT                   /codon_start=1
FT                   /gene_family="HOG000183523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057148"
FT                   /orf_name="AFUA_2G03630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87458.1"
FT                   /db_xref="HOGENOM:HBG052609"
FT                   /db_xref="HOGENOM:HBG332898"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniParc:UPI00005206FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ7"
FT                   /transl_table=1
FT                   /translation="MTQSLPFYLYKLVPSTSPVREPLPERLPVSELDQESGFIHLSTAL
FT                   QVPNTLKYFFKDEPLVYVLRIESERVIDDIRWESPDAKICGPRPDEGLFPHLYNGLRLG
FT                   KNEVESIAVWTNEAGWDKAISQAKPWLLY"
FT   CDS_pept        join(965519..969602,969663..969941,970004..970893)
FT                   /codon_start=1
FT                   /gene_family="HOG000183512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267231"
FT                   /orf_name="AFUA_2G03640"
FT                   /product="Ras GTPase activating protein, putative "
FT                   /function="Ras GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87459.1"
FT                   /db_xref="GO:0005099"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG052610"
FT                   /db_xref="HOGENOM:HBG332899"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00005206F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ6"
FT                   /transl_table=1
FT                   /translation="MASQPISPRRTQTDHPQHTSSPLRHGSTASTSSSIYSLSSNSQAP
FT                   SRTSTISSNASMGSAPRIGHRRGKSELNSITLGAMAKDTSGGESWTSAATTYENVRRSL
FT                   RPLPQAPNADPPASKTSIYRHTRSQTVDNPHYWKENRPGTPDSRHPHSLETGGLSERQS
FT                   LNSQTPPKKNSIQPGSLHAVSPHSRPHIRPHHSHSLSSPLPPPLTTTLSTPELETFKKS
FT                   STGHLRTLSKFAKSGETEEFALEAYSPSVVGLQGRRRLKRAGSVAGAQGSRVARKQNAS
FT                   AWAAGNWMDKQRQFLQAYEYLCHIGEAKEWIEEVIQKQIPPIVQLEEALRDGVTLAEVV
FT                   QAMYPNRTFRIFRHPKLQYRHSDNIALFFRFLDEVELPELFRFELIDLYEKKNIPKVIH
FT                   CVHALSWLLFKKGLVDFRMGNLVGQLEFEHHELEQTQKGLDKSGVSMPSFSGMAANFGA
FT                   EPEPEPEPEPETEEERIERELHENETSIAEFQAQIKGAMLRLKLGNVMNELWDFEPFLI
FT                   DLQSRLRGDWARQVIQYRLNMRSFAVNLQAACRGFIVRSRQQGDREWCRAQELDVLRLQ
FT                   ALIRGAKARTQVQYLRRQSRKEESGIKQFQAAIRGALQRKTVYAVYEDTRAIEPQVIVL
FT                   QAAVRGALCRRMISEQHEETQCAEDGITQLQSLIRGAHFRRQLSAQQDDIKNTGNNVQQ
FT                   LQAAIRGTLTRKAVIQLKSSLAEATPTVISIQAGVRALATRERYFQLIDGLAKKKNECI
FT                   SLQAFVRGGAVRGHLNSLRQALEEHTLSIIGLQSILREKAVRVALDAQRAALVQEERSI
FT                   LQLQSAARAVILRRRLEADAEALRAQEHIIVDLQALSRAAILRIKVGAVLDELEDCEDE
FT                   VSQLQAHIRAMIVRVDVGQDLADLAAEEELITDLQSRMRGHIIRSKFEEKRQYYRANME
FT                   KVIKAQSIVRGRIQGQAYKSLTTGKNPPVNTVKGFVHLLNDSEFDFDEEIEFERLRKLV
FT                   VQQVRQNELAEQYISQLDIKIALLVKNKITLDEVVKHQKHFGGHVGSLLSNADISSKDP
FT                   FDLKALNKTSRKKLEHYQVLFFLLQTQSQYLAKLFRRLRELNTPEKEYERIRHLMMGLF
FT                   GYSQKRREEYYLIKLLSRSAKEEIESFDSLHEYLRCNSFWNKLFASYIKSPRDRKFMRD
FT                   VLGPLIKENVVENPELDLESDPIQIYRSAINNEELRTGRRSRRPLDLPREEAIRDPETR
FT                   ATFIQNLQDLRDIADQFFTALKELLYRMPFGIRYISQQMYECLLSRFPGEDPGFILQAV
FT                   GHWVWRNYFQPAMVEPEKFGVIERGLTQEQKRNLSEIAKVVAQVASGRLFGAENVYLQP
FT                   LNSYVADSIQRLGRIWGDMVSVQDAETYFDIDEFNDLYAKTKPTLYIKMSDIFSIHQLV
FT                   ASEINYICPHPDDILREIIRDLGNVKTNENELMSVNSSEINLTLNPKLAQVEDPEADVK
FT                   ALFMETKRCVLYIIRVQTGANLMEIMVKPPTEEDEERWMTLVRDELTTNTSQRSAYSEA
FT                   STLVDIASMTYSELKRTALENILQLERTGKIRRDNHYQDLLNAIAIDIRTKHRRRIQRQ
FT                   RELESARLTLGRLNDQAAWLEQQLKTYNDYIEQAMVTLQNKKGKKRFLMPFTKQWDHQR
FT                   ELQKSGKVFKFGSYKYSARNLADKGVLVYWKGYSERQWDRVDLTISSNEVGVFTLDGSS
FT                   GPMMVPGANAQVPLDDLLQAQFNNMQFMDFFDGHLRVNVNLFLHLIMRKFYNE"
FT   CDS_pept        join(971652..971733,971848..971879,971983..972062,
FT                   972147..972228,972296..973672)
FT                   /codon_start=1
FT                   /gene_family="HOG000183501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267232"
FT                   /orf_name="AFUA_2G03650"
FT                   /product="Golgi to endosome transport protein (Ent3),
FT                   putative"
FT                   /protein_id="EAL87460.1"
FT                   /db_xref="HOGENOM:HBG332900"
FT                   /db_xref="HOGENOM:HBG527255"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI0000520486"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ5"
FT                   /transl_table=1
FT                   /translation="MDFSSLKEQVSNLTLYDIKAGVRKVQNAVMNYTEMESKVREATNN
FT                   EPWGASTTLMQEIANGTHSYQLLNEIMPMIYKRFTDKSAEEWRQIYKSLQLLEFLIKNG
FT                   SERVVDDARSHLSLIRMLRQFHYIDQNGKDQGVNVRNRSSELVKLLSDVDLIRAERKKA
FT                   RANRNKFGGFEGGIGSGGMGGMGGGFSGSSGRYGGFGSDSLSFGGYSGGVYGDGGGFGG
FT                   ASSEFQDAGRRGNRFEEYDEYDEDDASPARRRGSSPPRPKQEAKKPEPPKEPEQDLFDF
FT                   GEEEPVTAASTSTAAGKKPASSNGLDILESKPIDDDDEFDEFQSATPAPQPAANQFTIP
FT                   APASTVSTTSSTQFAAPRPVSGVQGPNLNGLVGFTSMTPTPTSSTVASPTLSQNSMVPP
FT                   SQQAKPSQPKPTGFQAATPNYFTSVTTATTQQPTATTPGHRPGMPSTSSFTSARGTSSV
FT                   GGKPAASKSSGDAFGSLWSTASASAGIQKSSANASKGPNLASMAKEKASAGIWGAPASS
FT                   SSFTPTSPSPSMSSSTQQQGAKTGSSGLDDLLG"
FT   CDS_pept        975224..975832
FT                   /codon_start=1
FT                   /gene_family="HOG000216927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267233"
FT                   /orf_name="AFUA_2G03670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87461.1"
FT                   /db_xref="HOGENOM:HBG052611"
FT                   /db_xref="UniParc:UPI000051FDDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ4"
FT                   /transl_table=1
FT                   /translation="MTNRTSTSSTRASTGTATLPISSTPMSTPPHTSAGSDSTQPPTST
FT                   PTAQSQSGNGLSGSQIGGIVGGVLAAAVLGGLIALIFWFRRRRRRLAAAQEAGDQQPAR
FT                   QDGEDAAGGGGGGTAVSTVGSATREEDHDPEGKDAAEIDEKKIPMLGGRMMQEMDAQGG
FT                   AAVHKLAVPVGGSARKLSELPGSMGRMAELPGSEVDTKR"
FT   CDS_pept        complement(976601..977959)
FT                   /codon_start=1
FT                   /gene_family="HOG000183490" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267234"
FT                   /orf_name="AFUA_2G03680"
FT                   /product="High osmolarity glycerol pathway protein Nbp2,
FT                   putative"
FT                   /protein_id="EAL87462.1"
FT                   /db_xref="HOGENOM:HBG052612"
FT                   /db_xref="HOGENOM:HBG332901"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000051FDD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ3"
FT                   /transl_table=1
FT                   /translation="MTNLSVLPPIITDASGKTQIGQRTSLYAKDRLSTYSNVSTTSQNC
FT                   SRPGSHVFPIFHSSLPYALVRDFAYPPVHPLHYGPLPPRASGVSTPASEHRRLSDPPAP
FT                   WDNSRGQWSSGSWRADQSHGQQQLPAMSFGDGPPYSEDEDLHSPVFSASRHRKNKSTGM
FT                   NANGRRTRSPGRGHQSAYFSGDVDRGILVSMNADGSETYYVNDDDDGSDDGPGGEYVTY
FT                   PPSESQYSHMGNETYGDYEDREHDAGFESEDDYSGAGRYSGDFQFAVGCPDEEMHGKAV
FT                   ALFDFTREHENELPLTEGQVIFVSYRHGQGWLVAEDPKTGESGLVPEEFVRLLRDIEGG
FT                   LTSLSVDPSLDTEEDDSTYLSPDSTDSEQAITPTQNDQLPLTTERGSVHIPNGASNLES
FT                   SAVIPDGGGEIESNQSHFLHNGQEIGSTPPIEQQMPEKQKTERESQMGILAKT"
FT   CDS_pept        complement(979783..980706)
FT                   /codon_start=1
FT                   /gene_family="HOG000216928" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208471"
FT                   /orf_name="AFUA_2G03690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87463.1"
FT                   /db_xref="HOGENOM:HBG052613"
FT                   /db_xref="HOGENOM:HBG332902"
FT                   /db_xref="UniParc:UPI000051E846"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ2"
FT                   /transl_table=1
FT                   /translation="MTNLIPPDGRANLSQILPSDRLCKDTQQKQFQTDGSPRLQANPGA
FT                   AIALRFQENGHVTLPQNQPGKPRNRGTVYVYGTTEPKDDERLLDIHNVWNKEGTGGDGR
FT                   GVLLSTQNFDDGRCYQINSGQISKHRQAMYPHEANQLMGADLWCQQDIALPPEAPTGKP
FT                   YTLYWVWDWPTAPGVDPSLPNGKQEIYTTCIDVDVIDSPPTQERVPANYVEDQSLNNAA
FT                   IPSQFAEIFGMKLPSFSAPVSSTSRLIPTPTAVPKQPTPATVTSFIILTKTVQPDAWQT
FT                   SLGSSIPSYSTPSFSSPAWNWFRRPI"
FT   CDS_pept        join(984934..985275,985339..985704,985755..988099,
FT                   988164..988503)
FT                   /codon_start=1
FT                   /gene_family="HOG000183489" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267235"
FT                   /orf_name="AFUA_2G03700"
FT                   /product="HMG-CoA reductase"
FT                   /function="NADP or NADPH binding"
FT                   /function="hydroxymethylglutaryl-CoA reductase (NADPH)
FT                   activity"
FT                   /biological_process="coenzyme A metabolic process "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87464.1"
FT                   /db_xref="GO:0004420"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0015936"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177172"
FT                   /db_xref="HOGENOM:HBG355150"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniParc:UPI000051ECD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ1"
FT                   /transl_table=1
FT                   /translation="MATSLITRKLRSAEATNDVEPGWLKRQVTGVLQSISSHACQHPIH
FT                   TIVVIALLASTTYVGLLEGSLFDSVRNSRNIAGQVDVDTLLQGSRNLRLGESTSWKWQV
FT                   EDSLASQDYTGVNHLALTTFIFSDSLSKSSSIAPAATELPIPSNASAQPVPFTPNLFSP
FT                   FSHDSSLAFTLPFDQVPQFLKAVQEIPDTSSDEDDGEQKKWIMRAARGSAYGSGGAIKL
FT                   WLADAWGSFVDLIKHAETIDIVIMTLGYLSMHLSFVSLFFSMRRLGSNFWLAATVLFSG
FT                   VFAFLFGLLVTTKLGVPINVLLLSEGLPFLVVTIGFEKPIILTRAVLTAAADNRGRAGQ
FT                   ASSSTTKSIQDSIQTAIKEQGFEIIRDYCIEIAILIAGAASGVQGGLRQFCFLAAWILF
FT                   FDCVLLFTFYTTILCIKLEINRIKRHITLRKALEEDGITHRVAENVASSNDWPLTESES
FT                   SNKTSIFGRKLRSSSVRRFKILMVGGFVLVNVVNLSTIPFRDSSQGAGLPLLSRVSNVF
FT                   APTPIDPFKVAENGLDSIYVSAKSQMMETVVTVIPPIKYKLEYPSVYYAALGESRTFDI
FT                   EYTDQFLDAVGGRVIESLLKSIEDPIISKWIIAALTLSIILNGYLFNAARWSIKEPEVA
FT                   PVPAAPTVAVVEAKKEYPKIDLNPDTPKRSLEECEAFLKEKRAAYLSDEELIELSLRGK
FT                   IPGYALEKTMENEDLMSRVDAFTRAVKIRRAVVARTPATSAITGSLECSKLPYKDYNYT
FT                   LVHGACCENVIGYLPLPLGVAGPLTIDGQSYFIPMATTEGVLVASTSRGAKAINAGGGA
FT                   VTVLTGDGMTRGPCVGFPTLARAAAAKVWIDSEEGRSILTAAFNSTSRFARLQHLKTAL
FT                   AGTYLYIRFKTTTGDAMGMNMISKGVEKALHVMATECGFDDMATISVSGNFCTDKKAAA
FT                   INWIDGRGKSVVAEAIIPGDVVRSVLKSDVNALVELNTSKNLIGSAMAGSVGGFNAHAS
FT                   NIVTAVFLATGQDPAQNVESSSCITTMRNLNGNLQIAVSMPSIEVGTIGGGTILEAQSA
FT                   MLDMLGVRGSHPTNPGDNARQLARIVAAAVLAGELSLCSALAAGHLVRAHMAHNRSAAT
FT                   TRTSTPVSAAVSAARGLTMSSSE"
FT   CDS_pept        join(990629..991924,991988..993115,993172..993573)
FT                   /codon_start=1
FT                   /gene_family="HOG000183468" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267236"
FT                   /orf_name="AFUA_2G03710"
FT                   /product="Cell polarity protein, putative "
FT                   /protein_id="EAL87465.1"
FT                   /db_xref="HOGENOM:HBG052614"
FT                   /db_xref="HOGENOM:HBG332905"
FT                   /db_xref="InterPro:IPR013724"
FT                   /db_xref="UniParc:UPI0000520235"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHZ0"
FT                   /transl_table=1
FT                   /translation="MNPNPGTMSPVSVDGSDWSGINQYQKSDPPFSPTSSTRNNLATPP
FT                   TSGTPSGLGPNNAGAPNGSTNGVSDPGNPSPPSSVAARSSSGTLAEDRSKRTKQMEEVL
FT                   GQHYFALRRFLNASYRDERANSKSNKARDKLLRLSATQFQELSTDVYDELLRRQQAMPS
FT                   PGRPGPSRPDVPPFLPPREDFHEKRNQARQKLASLQHQRFRDLATDVFCELERRFPQFP
FT                   ARESRRASPAPSLRGRPSNGYPPNGFGPNGYPPPPGSRRSQSRGPPNRMGRGYPSGGPP
FT                   GSPMGGYPPRQGSLGGPPSVNGDVGPQAKSFQSNTIVPNKSIMVEDDDDAPGAEDDYDA
FT                   RSDAFALDGVLQSRRGTTTTLGESERKLLADAQSQASALQEKVHKLEEMLKQKDEELSR
FT                   YQEEQGKVDQLEELIRSKDEELSKFQEEQRRSQMTGAAKQEWDTLKMELESRISQAEEL
FT                   NTSLQLELEKVRTERDATERDLRSQLNEASQQSAGDAGLQSQFSELQIKYRDLQAELHQ
FT                   QQQVTEEVRREASTFLMEMKALSEQTQSRWEHEERLSGEVQRLEDELQQWKTRYAKVKT
FT                   QLRHLRASSGISETRPGLSTVIQDNGFMQDDGLVKDIHVTKFQISIDELLRVARSDEYQ
FT                   LVMHQIKGVILAVRHVLNDIESTQNPADGLAAMRTKATRKVSATANNMITAAKNFVRSN
FT                   GLSPVSLLDAAASHLSTAVIELIRLVKIRPTPEHELNENEEERDQFSQMKSPDYFSVAP
FT                   SQSRMSNNDSIYSAMSDPSNRTPNGTHSHLDAGSQNGALTGSQLKSEDHELQELKLYIE
FT                   DQTDGLVQSIQALVASVRAEDVLTTISTHVSAISSIVSKVSSSTEHFINRSNAGRVLRE
FT                   RSGPILETLNLHRTRLLETTAEGEDAVNIAEHREVIKKLPPIAFEIARETKELVHRLDL
FT                   TDDNDSEDDFR"
FT   CDS_pept        join(995026..995077,995166..995437,995541..995647,
FT                   995714..995900)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16267237"
FT                   /orf_name="AFUA_2G03720"
FT                   /product="Peptidyl-prolyl cis-trans isomerase "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL87466.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="PDB:2C3B"
FT                   /db_xref="UniParc:UPI000051EAAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY9"
FT                   /transl_table=1
FT                   /translation="MSQVFFDVEYAPVGTAETSARNCAQSGLDAFGLQSILSILFTDGI
FT                   LLRAVTAKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEGYRESTFHRIIPNFMIQGGDF
FT                   TRGNGTGGRSIYGDKFADENFSRKHDKKGILSMANAGPNTNGSQFFITTAVTSWLDGKH
FT                   VVFGEVADEKSYSVVKEIEALGSSSGSVRSNTRPKIVNCGEL"
FT   CDS_pept        join(complement(997347..997517),complement(997242..997272),
FT                   complement(996602..997173))
FT                   /codon_start=1
FT                   /gene_family="HOG000183457" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267238"
FT                   /orf_name="AFUA_2G03730"
FT                   /product="Ctr copper transporter family protein "
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87467.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052616"
FT                   /db_xref="HOGENOM:HBG736341"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI000052024D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY8"
FT                   /transl_table=1
FT                   /translation="MDHMSHNMDSMASMTSTMTMAMSASSTASAPMSTGSAHSMGGMDM
FT                   GGKDSMHSCKISMLWNWYTIDSCFLSSQWHNTSRGMFAGSCIGVICLVICLEFLRRVGR
FT                   EYDAFIVRRARLRNQYLSTTASSQGLTRATDADASAEDSPNSTRGVVRAASKGAGRTLC
FT                   SAFEDKTPVRPTLIEQLVRALLHMLQFAVAYFVMLLAMYFNGYIIICIFIGAFLGSFIF
FT                   SWEPLNLQKEYVIPLPLPYLPQMICKELGLTCVLV"
FT   CDS_pept        join(complement(998828..999126),complement(998252..998762))
FT                   /codon_start=1
FT                   /gene_family="HOG000229515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208472"
FT                   /orf_name="AFUA_2G03740"
FT                   /product="Exosome complex endonuclease 1/ribosomal RNA
FT                   processing protein, putative"
FT                   /EC_number="3.1.13.-"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="EAL87468.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000051FB7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY7"
FT                   /transl_table=1
FT                   /translation="MPLDTSTTYPLTKLRLDGRRWNELRLLQAQISTNPASSGSSFLSM
FT                   GNTSIMCSVHGPAEGKRGDATGGAAGSAGAVVEVDVNIAGFAGVDRRRRAGGSDRQSSR
FT                   IATILRSAFQSHLHTHLYPHSTISIHVSVLSADGSLLAAAVNACTLALVDAGIPMPGLL
FT                   SACTSGMSGSASTLRDPRNDFLDPLLDLSLPEEQELPFLTVGTTTAIPVGEDAMDDDDE
FT                   DMKVSMMVMDSKVHCTYLETMLAVGIDGCKQIREILEGVIKGTNRGV"
FT   CDS_pept        join(999533..999641,999700..1002617)
FT                   /codon_start=1
FT                   /gene_family="HOG000183446" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267239"
FT                   /orf_name="AFUA_2G03750"
FT                   /product="DNA excision repair protein (Rad26L), putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="EAL87469.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG052617"
FT                   /db_xref="HOGENOM:HBG332906"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051E847"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY6"
FT                   /transl_table=1
FT                   /translation="MGGDWELQDTDVSTVDNTEDDDLDATHSSKPSIPPRYRDREFKSD
FT                   PEPPQSTSDHERSKIKQLPSPSNRNTSVVHLADTESGDDSFNDGEAAYKQFKERRALKR
FT                   KRSSANLRKSKKTKVANPDSFVGKRPKKENEQSTRTRPILRTYGEELPSDDELMEYTLP
FT                   DYLQKRRTQFDRRMDHLKQSGLKLPPDFDDVEFSDDERLEFLKEKPAFRNIEPCGKYED
FT                   ITLPYSLGLIPAPIAQWLRPYQVEGAAFLHELFVYQKGGILGDDMGLGKTVQVITFLTA
FT                   AYGKTGDERDAKRMRKMRRSGRDGWYPRTLIVCPGTLIQNWISEFNRWGWWHVDTYHGD
FT                   NKELALQAARSGRLEILITTYGTYLHNKDAVNMVEWDCVVADECHIIKERSSETTKAMN
FT                   VVNALCRIGLTGTAIQNKYEELWTLLNWTNPGKLGPVTTWKRTISEPLKIGQSHDATLY
FT                   QLSKARKTAKKLVENLLPQFFLRRMKTLIADQLPKKSDRVVFCPLTETQASAYENILDS
FT                   DIVQYIKTSSDKCDCGSGKKAGWCCRQFLPSGGRWQNYVFPAIAILQKLSNHLATLIPQ
FT                   GADSLEKQEKDKEMLEIAVPDQWEQLYRTRDSIVNYANPEFCGKWKVLRKLLKWWHANG
FT                   DKVLVFSHSVRLLKMLQMLFHYTSYNVSYLDGSMTYEERTKVVDEFNSDPKQFVFLIST
FT                   RSGGVGLNITSANKVVVVDPNWNPSHDLQAQDRAYRIGQSRNVEVFRLISVGTIEEIVY
FT                   ARQIYKQQQANIGYNASSERRYFKGVQEKKDRKGEIFGLDNLFEFKTNNIVLRDIVNKT
FT                   NVAESKAGVQVMDLAIDESDTKTTTVDSSSENKNQDDQVMSQLAAMIRGDADDAALQAQ
FT                   AAVTAQKHDPIQAILAGAGVEYTHLNNEVIGSSKVEERLSRRAELADEKLGEVQVFGSS
FT                   QDRTEQGGILDKDGRPIRYKFHPPREVMKRQFCSMAKRFGFASATEFALVVEGMTQAQR
FT                   RACLERWYTERQEILLGRR"
FT   CDS_pept        complement(1002838..1003701)
FT                   /codon_start=1
FT                   /gene_family="HOG000183445" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751796"
FT                   /gene_name="ssu72"
FT                   /orf_name="AFUA_2G03760"
FT                   /product="RNA polymerase II subunit A C-terminal domain
FT                   phosphatase ssu72"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87470.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG022057"
FT                   /db_xref="HOGENOM:HBG381219"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniParc:UPI00005204A0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHY5"
FT                   /transl_table=1
FT                   /translation="MAHDPRLSSAGTATPNPPPPPPPPPPEPSTTGTGETQAAEPSAPA
FT                   QSSDSFKLKFCTVCASNQNRSMEAHLRLSTAPSPFPVISFGTGSLVRLPGPSITQPNVY
FT                   NFNTTSYSQMYDELLAKDERLYRNNGLLNMLDRNRNLKWGPERFQDWVPGMPRVDHVSK
FT                   GDKGALGTEGGTVDVIITCEERCWDAVVDDLMNKGAALNRPVHVFNVDIRDNHEEALVG
FT                   GKAILELATRLNDAATQERKIHGAEGWENGNGEARRSFDERVPEILASWQEKWPNLPAL
FT                   WTLAWL"
FT   CDS_pept        join(1004712..1004762,1004812..1005468)
FT                   /codon_start=1
FT                   /gene_family="HOG000078666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267240"
FT                   /orf_name="AFUA_2G03770"
FT                   /product="Isochorismatase family hydrolase, putative "
FT                   /EC_number="3.5.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87471.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG462377"
FT                   /db_xref="HOGENOM:HBG752434"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI0000520709"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY4"
FT                   /transl_table=1
FT                   /translation="MKAALIVVDMQEDFCPPDGSLAVQGARSIAPLINSLLANPGFVIR
FT                   VASQDYHPRDHVSFASNHPEPNNRPFESVIQMNNPAPGKESETKEQRLWPVHCVGGTKG
FT                   ATIIPEIDSSKIDLHVKKGMDSRVEMYSAFSDAFGNLDPAVHTQSVDVDLKAVLAERGI
FT                   THVFSAGIAGDYCVKYTAMDAARAGFKSFLVEDATRSVDSGAGWEEARRECEAAGVSII
FT                   QSDGPEIAALTAS"
FT   CDS_pept        join(1006379..1006643,1006705..1006887,1006943..1007127,
FT                   1007179..1007316)
FT                   /codon_start=1
FT                   /gene_family="HOG000166513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057149"
FT                   /orf_name="AFUA_2G03780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87472.1"
FT                   /db_xref="HOGENOM:HBG052618"
FT                   /db_xref="HOGENOM:HBG332908"
FT                   /db_xref="InterPro:IPR022036"
FT                   /db_xref="UniParc:UPI0000520012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY3"
FT                   /transl_table=1
FT                   /translation="MSTNMSISTQAATCTTTDENISASTTRLNQDKNLAEKLPYWLVNV
FT                   PPSQWPAECPPFLRDLPAKSISILSTPDAEYKKQDWETVKEIVRSNRIDLFQRVPSELR
FT                   RYLAFKAHIIANYGSIMRFMAKERLHWGDGDAEDLRPKGRPFEFDEDIRILYNDWPYGV
FT                   EEGIVHLVVWTKFELEDDPATDDLTPQARKEIDDYVTRTFRSRMPAEQVIWFKNWKSLK
FT                   SVHAVEHFHVMLYQPDMEFVKEVTQGDVPMTARF"
FT   CDS_pept        join(1008603..1008723,1008818..1008923,1008981..1009091,
FT                   1009162..1009440,1009520..1009769,1009819..1010132,
FT                   1010191..1010485)
FT                   /codon_start=1
FT                   /gene_family="HOG000233871" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057150"
FT                   /orf_name="AFUA_2G03790"
FT                   /product="Oxysterol binding protein (Osh7), putative "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="EAL87473.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG052619"
FT                   /db_xref="HOGENOM:HBG332907"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI0000520018"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY2"
FT                   /transl_table=1
FT                   /translation="MSADWGSFFHQSSGTRSSMDESKPEGGSGEDEVVEPDQGNVLSHI
FT                   ISQLRPGADLSRVVLPTFILEPRSMLERITNFMAHPETLLPMPTIDDPLERFVSVVKFY
FT                   LSGWHIKPPGVKKPLNPILGETFTCYWDYPDGTRGYYIAEQTSHHPPKSSYFFMAPEHH
FT                   IRIDGTLKPRSKFLGNSAASMMEGVAILRFLNRGQNPEKGERYILTQPNMYARGILFGK
FT                   MKYELGDHSYVRCPENNLVADIEFKTKGYFSGTYNAIGGTIKNEKTGEVYYELSGLWNG
FT                   EMFIKDVHTHKKDILFDATHAKHTPPSTRPIEQQGERESQRLWHSTVKALLARNHEAAT
FT                   DEKSKIEERQREEAAKRADEGVEWRPRLFRPVHGGPGGPDEGEEDLDWIISAHIDSQNP
FT                   ELAAKQILAIAPILDGQKDNRQFQIPPHVPKKEKEGKTAPSASDPVDAKHTGSDTGAGA
FT                   SEAPQPSSEGNNSVERKDSRTSEVDEYVDAEEK"
FT   CDS_pept        join(complement(1011088..1011157),
FT                   complement(1010798..1010954),complement(1010704..1010737))
FT                   /codon_start=1
FT                   /gene_family="HOG000048355" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267241"
FT                   /orf_name="AFUA_2G03800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87474.1"
FT                   /db_xref="HOGENOM:HBG052620"
FT                   /db_xref="UniParc:UPI000051F8FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY1"
FT                   /transl_table=1
FT                   /translation="MGGAPGVWVKSRFSIYDIPEDIYFRNSHIYETISPEPPISPIPRA
FT                   FRSPSAPRAVLSPRSLLKIKSGIQDGRAFDDQTIPSAPSVK"
FT   CDS_pept        complement(1011228..1012691)
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267242"
FT                   /orf_name="AFUA_2G03810"
FT                   /product="Histone deacetylase HosA "
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="EAL87475.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="HOGENOM:HBG460465"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI00005206F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHY0"
FT                   /transl_table=1
FT                   /translation="MARSAIVQEYNPPPPSNPTLSVDRKVSLERQKNGIPRPQGYRVSW
FT                   HANPAVEPHHFGQSHPMKPWRLTLTKQLVMAYGMHHAMDLYLARAATYEEMAEFHQTDY
FT                   LDFLRQVMPGDMENPEQSENIARFNFGDDCPIFNGLYNYCSLYAGGSIDAARKLCNNQS
FT                   EIAVNWSGGLHHAKKAEASGFCYVNDIVLGILQLLRHHPRVMYIDIDVHHGDGVEQAFW
FT                   STDRVLTVSFHKYDKDNFFPGTGPLDSTGPTHPLNPGAHHAVNVPLNDGIDDESYIQLF
FT                   RDIVGACVDTYRPGAIVLQCGADSLGCDRLGCFNLNVGAHGACVAFVKTFGLPLLVVGG
FT                   GGYTPRNVSRAWAHETSILIDAQDLIDPNIPDTVAFRNHFGPDYSLFPPLSEMRKLENK
FT                   NSRPYLAGLVQSVREQLRYIQGAPSVQMSFIPPDILGLREDTEKEIEEATARLEEEREE
FT                   REGPGSAAVKSNRRRELERGAGYRGELYS"
FT   CDS_pept        join(1013499..1013633,1013691..1014476)
FT                   /codon_start=1
FT                   /gene_family="HOG000220040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267243"
FT                   /orf_name="AFUA_2G03820"
FT                   /product="Carboxyphosphonoenolpyruvate phosphonomutase,
FT                   putative"
FT                   /EC_number="4.1.3.30"
FT                   /function="methylisocitrate lyase activity"
FT                   /protein_id="EAL87476.1"
FT                   /db_xref="GO:0046421"
FT                   /db_xref="HOGENOM:HBG421907"
FT                   /db_xref="HOGENOM:HBG728656"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI000051F43A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX9"
FT                   /transl_table=1
FT                   /translation="MPIVTAATALRRSLEDPKSFTVAPGVYDGLSARIALSVGFDALYM
FT                   TGAGTAASVHGQADLGICTLNDMRANAEMLANISPSTPVIADADTGYGGPIMVARTTEQ
FT                   YSRSGVAAFHIEDQVQTKRCGHLAGKILVDKETYVSRIRAAVQARKRMGSDIVVIARTD
FT                   ALQGYGYEESVARLRAARDAGADVGFLEGITSKEMARQVVQDLAPWPMLLNMVEHGATP
FT                   SISADEAKEMGFRIIIFPFAAIGPALTAIREGMEKLKRDGLPGLSKELTPQMLFRTCGL
FT                   DESLKVDAEAGGAAFQGGVDLEDTE"
FT   CDS_pept        1016683..1017651
FT                   /codon_start=1
FT                   /gene_family="HOG000178363" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19904134"
FT                   /orf_name="AFUA_2G03830"
FT                   /product="Allergen Asp f 4"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL87477.1"
FT                   /db_xref="EMBL:CAA04959.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="HOGENOM:HBG052621"
FT                   /db_xref="HOGENOM:HBG330001"
FT                   /db_xref="UniParc:UPI000051F1B0"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60024"
FT                   /transl_table=1
FT                   /translation="MQLKNSMLLLTALAAGSSVARLHGHERRHLHHAGEKREVGDTVYA
FT                   TINGVLVSWINEWSGEAKTSDAPVSQATPVSNAVAAAAAASTPEPSSSHSDSSSSSGVS
FT                   ADWTNTPAEGEYCTDGFGGRTEPSGSGIFYKGNVGKPWGSNIIEVSPENAKKYKHVAQF
FT                   VGSDTDPWTVVFWNKIGPDGGLTGWYGNSALTLHLEAGETKYVAFDENSQGAWGAAKGD
FT                   ELPKDQFGGYSCTWGEFDFDSKINQGWSGWDVSAIQAENAHHEVQGMKICNHAGELCSI
FT                   ISHGLSKVIDAYTADLAGVDGIGGKVVPGPTRLVVNLDYKE"
FT   sig_peptide     1016683..1016742
FT                   /db_xref="UniProtKB/Swiss-Prot:O60024 "
FT   mat_peptide     1016743..1017648
FT                   /product="Allergen Asp f 4"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60024 "
FT   CDS_pept        join(complement(1019794..1019944),
FT                   complement(1019593..1019731),complement(1018497..1019535))
FT                   /codon_start=1
FT                   /gene_family="HOG000183423" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268295"
FT                   /orf_name="AFUA_2G03840"
FT                   /product="Mitochondrial import receptor subunit (Tom37),
FT                   putative"
FT                   /function="receptor activity"
FT                   /biological_process="protein targeting to mitochondrion "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EAL87478.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006626"
FT                   /db_xref="HOGENOM:HBG052622"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="UniParc:UPI000051E852"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX7"
FT                   /transl_table=1
FT                   /translation="MVLELHVWGPAFSLPSIEAQCLAAIAYFSLAVPKDAWVLIASSDP
FT                   SVSPTNELPALKNGTTWVSRFRNIVDYLRQYSNGAWDLDRDLSGIDRADNIAFSSFVES
FT                   RGQPLLDLSLYVSSENYYNRTSPAYGAILQWPNQWIVPPRLRSAAKSRTEHLGLSSLDL
FT                   EAAEDQRKREHSAAVAAGQIPKTLAQRPRDTVSSLLGKSPQQNQFKLEALTAELFEPLE
FT                   EILGQKTYLVSDGDATSVDCLALGYLALILVPDLPYSFLRNAMRTKAPRISAYTERLRQ
FT                   RCYGTVGVEVAHAFDETRRSVTDATPLPWQPAQRANLTTVCSTLLNTLADATPILKDIR
FT                   SSERLRQAAQSPDSGLSGIESRALSEYATGQKKDILVSIAAVAGGVAALVGYMVHVGFI
FT                   EISFGGEEGHWEEEGHAGEEEGGSEFALPELPTSVSATEFLGI"
FT   CDS_pept        join(complement(1028385..1028613),
FT                   complement(1027826..1028355))
FT                   /codon_start=1
FT                   /gene_family="HOG000183412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904135"
FT                   /orf_name="AFUA_2G03850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87479.1"
FT                   /db_xref="HOGENOM:HBG052623"
FT                   /db_xref="HOGENOM:HBG332914"
FT                   /db_xref="UniParc:UPI000051F692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX6"
FT                   /transl_table=1
FT                   /translation="MAPVRRYLRISKFSVLECRIYLENPSDSRWLLDSRDPVLPRIFAA
FT                   IRPLVLPKLREENERLFARKKGKPVKDVIAEVDIQFIDYDADEFEVALFLRESRTRHSL
FT                   LTRHKTFEGARDTDIPVIRPERGGDKILVESDDEADTDLRVIPQSSTSDANCKRRRGTA
FT                   VESPGGERTSKRQKETDSPLEELSADGDDKKLGFRTQYEGFNIYGWVLCLLVTRKGNKA
FT                   RARPAAPDASRQALMEEWISTQAQEDLDED"
FT   CDS_pept        1030601..1031662
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904136"
FT                   /orf_name="AFUA_2G03860"
FT                   /product="Plasma membrane low affinity zinc ion
FT                   transporter, putative"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87480.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI000051F1CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX5"
FT                   /transl_table=1
FT                   /translation="MQSLHTLLVRDPETGATPSCDTGNEYDGRMGLRISSIFVIMVGSM
FT                   LGAVFPVFARSFSTSKFLRRAFFVAKYFGSGVIIATAFIHLLGPAEEALTNECLTGPIT
FT                   EYSWVEGIILMTIVVLFFVELMVMRYARFGHGHLDDLGHDDHTHPSLDAPPATVESKSH
FT                   MPGEDHLGHSREHRDTESGRKASLIEEYSAQLTSVFILEFGIIFHSIFIGLTLAVSGEE
FT                   FITLYIVLVFHQTFEGLGLGSRLATIPWPNSKRFTPYLLGFAYGLSTPLAIAIGLGVRN
FT                   SYPPEGYTTLVVNGVFDSISAGILIYTALVELMAHEFMFSPSMRKAPIRTVLAAFGLLC
FT                   LGALLMALLGKWA"
FT   CDS_pept        join(1032054..1032289,1032370..1032538)
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268296"
FT                   /gene_name="fpr2"
FT                   /orf_name="AFUA_2G03870"
FT                   /product="FK506-binding protein 2 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="EAL87481.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG430304"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI000052024E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHX4"
FT                   /transl_table=1
FT                   /translation="MRILLLSALFLSLTTLVLSADLGIEKTHVVECNRKTTKGDTVHMH
FT                   YRGTLAADGSEFDSSYGRNQPLKFKLGAGRVIKGWDEGLLDMCVGEKRTLTIPPEYGYG
FT                   ERGIGPIPGGATLIFETELVQIEGVNNDEL"
FT   sig_peptide     1032054..1032110
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHX4 "
FT   mat_peptide     join(1032111..1032289,1032370..1032535)
FT                   /product="FK506-binding protein 2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHX4 "
FT   CDS_pept        complement(1032737..1033966)
FT                   /codon_start=1
FT                   /gene_family="HOG000183401" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268297"
FT                   /orf_name="AFUA_2G03880"
FT                   /product="Heme/steroid binding protein, putative "
FT                   /function="heme binding"
FT                   /protein_id="EAL87482.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG052624"
FT                   /db_xref="HOGENOM:HBG330101"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000051FB81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX3"
FT                   /transl_table=1
FT                   /translation="MVMSIHTMIPHGVVSTIHYFVCHFLPFFPTPLLRHLPSSISADCS
FT                   RPPCSGMGWVGVVTLLVTACYLFYRYPPASWTQELPSAPSPQPPGSTSDEAETTNLPSE
FT                   NNDLRRNELTTPENENEAAEDPQTTPKASATKAPALDVPTLHLASDQADEAAGSSKRNN
FT                   EQQPRNWSAKSPLDLGSVTSSEMKTTPAAPPRQTESSTSSLMPPPPPPRLRPSTLQNQQ
FT                   PQQTSSLSPGRSLPHLSGGSALRPPPSAAASLRVPPSSRAASNNSLAPTQVTLKPSTTA
FT                   RKAILEPGYSPLDWAALTAKPKNNLRGANLPPTLIRVSPSMLKARNGRKGSDAWTSYQG
FT                   KVYNITPYLPFHPGGKGELLRGAGKDSGKLFMEIHPWVNWDAILGECLVGILVSENEAK
FT                   ANESSLDTMD"
FT   CDS_pept        join(1034404..1034469,1034541..1034650,1034707..1035001,
FT                   1035057..1035159,1035231..1035625)
FT                   /codon_start=1
FT                   /gene_family="HOG000177463" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268298"
FT                   /orf_name="AFUA_2G03890"
FT                   /product="Protein phosphatase 2C, putative "
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="EAL87483.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG052625"
FT                   /db_xref="HOGENOM:HBG331326"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000051F697"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX2"
FT                   /transl_table=1
FT                   /translation="MFRNTILSTSDALLLFDAGAGQVQGARPFQEDRCTFVLPDQFPSQ
FT                   TNDKLTYFAVYDGHGSELVSDHASRNLHLLLAKRPEFDQGDYEAAIRGALIDEDAVLLE
FT                   TFNNVTTEPAVSGSTVALCFVNLTKGDLVVANLGDSHVLLAERDNRTDHPSHIRRLSKS
FT                   HKPDTPDEKSRIEDAGGAVNTRRGTARLGSLNMSRALGDLQYKNPINNAGDEYSSSKTR
FT                   RASASTSAPETRGNFLSVEPHMTRMTLSPDRRYLVVVTSDGVSDNIDDATLIHHVMRLS
FT                   MRGMRAGDIAQEIATTAAAQKAKGGSDNASCIVALLDGQNT"
FT   CDS_pept        1036884..1037846
FT                   /codon_start=1
FT                   /gene_family="HOG000080363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268299"
FT                   /orf_name="AFUA_2G03900"
FT                   /product="Acetamidase/formamidase family protein "
FT                   /EC_number="3.5.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /protein_id="EAL87484.1"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="HOGENOM:HBG300311"
FT                   /db_xref="HOGENOM:HBG552286"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI0000520487"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX1"
FT                   /transl_table=1
FT                   /translation="MNSPPACQMCHIGRDSGHARWSRKIPPALVISSGEVVTFDTIDSS
FT                   NGRIERTSDASAISSLDIAATNPVFGPVYIQNAQPGDTLKVEVIALETADWGWTATIPG
FT                   FGLLADEFSDPSLHIWQINKERGYAVFKDNIRIPLRPFLGCIGLAPATDEDLSTVPPTN
FT                   AGGNLDCRDLTVGATLYLPVQTDGALFSCGDGHAAQGHGEVCGTAIETSIKATLRFELC
FT                   KDMPWVTSPQYETPPSLLTTRMPVFGEYATTGVGQTLHEASKTAVRNIIQWMVATKGLT
FT                   HCEAYMIASVAGDLQIIEAVNMPNYVVAMTIPLEIFGPS"
FT   CDS_pept        join(1038258..1038626,1038702..1041338)
FT                   /codon_start=1
FT                   /gene_family="HOG000183390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057400"
FT                   /orf_name="AFUA_2G03910"
FT                   /product="ATP-depentend DNA helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="EAL87485.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG052626"
FT                   /db_xref="HOGENOM:HBG332916"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniParc:UPI000051F8F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHX0"
FT                   /transl_table=1
FT                   /translation="MDSTLEGLNSAQKAAVTSPASVLQVLAPPGSGKTKTLTARVAYLL
FT                   SHYGYQPQDVICCTFTIKASREMRERLASLVGNEVQSRLILGTFHSICRRYLVSYGYLI
FT                   GLRKGFGIADSSDSLAIIKRIVKRLRCSIQPNTARARISHQKAHGVSPDEAAVKYSTGS
FT                   KSAEHHEFVQIYREYESYLATSNLLDYDDLLLRCADLLRRHPQCVSNVQAVLVDEFQDT
FT                   NHIQYELMNLFAVRNRRITVVGDPDQSIYGFRSAEIKNLGRMQQHYKDTSVILLEDNYR
FT                   SSGSILRSAQDVIEQDSSRPSRKLQPTHCPGTMPVLRKLPTAEAEAQWIVLEIKRSMAM
FT                   TGKLLNYSDFAILLRSAALSRHIESEMGKQGVPYRMVGGLRFFDRVEIKVLLDYLRVIS
FT                   NPGNSDALLRIINVPSRKIGEESVKTLMNGADTAKIPLWNFIKDVAQGRRSTDKSLSKL
FT                   TDQGLCTLVGIIESSRQKLLECTDGSAPRKLLEFVIKKLNFREYLTTTYCQNEENRWAN
FT                   VEELLAQAGDVAAPAAEKGQDDSLPEIQGLAQQQAHQGEEALSQFLANVALSTEVLSED
FT                   GDQPQEKVTISTIHAAKGLEWPVVFVPAVYNGIIPHSRAEDSDEERRLLYVAMTRAQAL
FT                   LYLSYPLRQSRNEEAATTVTSFLPLKIIENRFRPLGPSLQEKVVYGIADILRRPRPSFE
FT                   SMLAAYDSVPSLRDDQWTADGKEAPDAVIKWDGSRAWGEEPDPKRRRYNPNPSSSSTTT
FT                   YLSSSTYTVNNPQLSMSTNASLGFSTAREYISTTSASQAAQSSVPEVDCRSNRNSIGPA
FT                   GRNVAGHSQENISRFFGKSPTQAKDPCLPAAMASSQPQIGARCLPGQANHFPSPHSAFK
FT                   SVISSQFSSHRPQTQRIQPPRPVLEPSGSSEYNWLAASSRPTEKRILQNGGENQRPPNM
FT                   KETPISERGTGENKKSSGAVGGVRPVATFHTTTMTMVQQAGPTGRRTLGIRRTMNDGWA
FT                   DRWKKAGNGQSR"
FT   CDS_pept        join(complement(1048686..1048898),
FT                   complement(1047584..1048621))
FT                   /codon_start=1
FT                   /gene_family="HOG000183368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904137"
FT                   /orf_name="AFUA_2G03920"
FT                   /product="G1/S-specific cyclin Cln1, putative "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87486.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG052628"
FT                   /db_xref="HOGENOM:HBG332919"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI000051F458"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW9"
FT                   /transl_table=1
FT                   /translation="MAYHKRPTSSYQPCDSYFVESYDDFPAPRIDPKEHAKLVARERQY
FT                   AIADELSKAASDEFRDDILAHMLDMDAATLPDVESIDIQTEIQWFMRPYLLDFLIEAHT
FT                   AFQLLPATLFLTVNLLDRYCSKRVVYKRHYQLVGCAALLIAAKYGDKKDRVPTIKELKS
FT                   MCCSLYDDDMFIQMEWHVLQTLGWTVGHPTVDSFLQIAVLDTPHDPEVEHLALYILEIS
FT                   LFHREFVSKASADLARASLALARCILNRPQPRHTEWASQYDSMTLVGLSQQLHQPSQVL
FT                   SRKYSSSHYSRVAKTLEQFLARQASITSYTPPSPPSDVPSDSKPYYGEIGLATPQKVQS
FT                   SNLPNGYPTPPITPENEAFANAGNPNFVKEGPETNTCSPSPSPPPMQYVDSHAYNPEAA
FT                   YAHQPYEQPQMSFTSSF"
FT   CDS_pept        join(1060649..1061705,1061767..1061999,1062068..1063708)
FT                   /codon_start=1
FT                   /gene_family="HOG000183346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057401"
FT                   /orf_name="AFUA_2G03930"
FT                   /product="Small nucleolar ribonucleoprotein complex
FT                   subunit, putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL87487.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG052629"
FT                   /db_xref="HOGENOM:HBG332927"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000051E5F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW8"
FT                   /transl_table=1
FT                   /translation="MDIHRCRFVPYNPQAINALSFSHPPSAELAGRGVPTLRLAIGRAN
FT                   GDIEIWNPMRGAWFQETVMRGGKDRSIEGLAWTLDPPEAGPDGTKIPGKLRLFSIGYST
FT                   AVTEWNLEQGRPMRHSSGNYGEIWCIAAQPRWQATKRGKDGKPLPPAEGEYTGQHLAAG
FT                   CADGSIVILSTADGDLKFLRLMRPSTKRARVLSVTFQNRNTIVAGYADSSIRLFDLRSG
FT                   QLLRTISLGKGPAGGPKELLVWSVKCLPDGTIVSGDSAGEIRFWDAKNYSLIQRIQGHL
FT                   ADTLDVAVSANGDTVVSGGADQRTVVYRKSPGEKGEKKGRWAEVMHRRYHTHDVKTFAV
FT                   YETRDISIVVSGGPDASPVVLPLREFGKEHHRKLSSLPQIPQLASSPSSRLVMSFWDRE
FT                   VSIWRVSRGPISPHDNLEGQKHRLVGRVLIQGEENITSAMLSADGKILIVATVSAVKVF
FT                   SVRRRKSDERGTLRITKLDVPAAFSKDGARAVSISPDSRWLCVVRPDSAIYLARVMPAS
FT                   SPQDKPQILPQLVKLDRATRHTRHEKASHGSLGDYERTVRCVVFSENSRILATGDLSGC
FT                   IDTWLLKDVKDSSAVASNKRNGAADSDDESSDDEDERPVIDGERWQYANADSPIPRLKS
FT                   GVLLLSFRPQSPAEAKLLTNGADQSSQISLRGESRLMALTSEHQLVEFDTLEGKLSDWS
FT                   RRNPKAYLPEQFKGVKDRAMGCLWDLSESRDRLWLYGTSWLWMFDLNQDFPSSEEMKEA
FT                   ADGHEGDSSTQLVKTSSAHKRKREQMEEEEKRGKANSGAGDRMSLAQSDVHFGSKYRKI
FT                   EGHDDSKGEWVSLDKERPQAAGDEEAFEYDENSAAVHDTALARLRRGKLEEDGISTPRK
FT                   RVSLGPRDNLLSLNGSNDTPSRKPNDHDMPDTPQTRLVPPNGTQPARRWWYTYKYRDLL
FT                   GIVPLSPPSAEDGVEDDTAGNTLEVAIVERPMWDVELPGRYVRDYA"
FT   rRNA            complement(1064778..1064893)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(1064997..1065321,1065434..1065690)
FT                   /codon_start=1
FT                   /gene_family="HOG000048356" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268300"
FT                   /orf_name="AFUA_2G03940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87488.1"
FT                   /db_xref="HOGENOM:HBG052630"
FT                   /db_xref="UniParc:UPI000051E3B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW7"
FT                   /transl_table=1
FT                   /translation="MLLMDRALKPNWLVPVLIVDIDGVIDRTVGTKAKDQETATRSPRA
FT                   HPDACPLSQRRQCQAGFAQTLWPSRFDFHPERRICFEATDPSYSSIAEQRTETREFLWK
FT                   KQDYCLPSKAVDDLETLGGDFSAQPADRFPTVYNTERYMIRPSQSQHRSEASKSLSGIP
FT                   VNISGIRFILEGYQEVSPGYNVATSKKCST"
FT   CDS_pept        join(complement(1067380..1068717),
FT                   complement(1067019..1067303))
FT                   /codon_start=1
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057402"
FT                   /orf_name="AFUA_2G03950"
FT                   /product="Serine/threonine protein phosphatase, putative "
FT                   /EC_number="3.1.3.16"
FT                   /function="cofactor binding"
FT                   /function="magnesium-dependent protein serine/threonine
FT                   phosphatase activity"
FT                   /protein_id="EAL87489.1"
FT                   /db_xref="GO:0004724"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="UniParc:UPI000051F693"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW6"
FT                   /transl_table=1
FT                   /translation="MGQSHSKGNSGPGDSLQSYPSFSRSDTKESLRSLRGSIRSKIRSS
FT                   DSPRGSTAGLSDDKSDAASVKSTTSRRSSTNQSVQSPDDTPSQPDAPEPPPSPSLSSSL
FT                   KRGHKDVNAMQQSGEVDHVSDVPPTGAAPTGPSTQKVGESILIKRENQLNPILDFIMNA
FT                   PLETSGSPGMGMGALKSIDLDDMISRLLDAGYSTKVTKTVCLKNAEIMAICSAARELFL
FT                   SQPALLELSAPVKIVGDVHGQYTDLIRLFEMCGFPPASNYLFLGDYVDRGKQSLETILL
FT                   LLCYKLKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFIDTFNCLPIAATV
FT                   AGKIFCVHGGLSPSLSHMDDIRGIARPTDVPDYGLLNDLLWSDPADMEEDWEPNERGVS
FT                   YCFGKKVIMNFLQRHDFDLVCRAHMVVEDGYEFYQDRILVTVFSAPNYCGEFDNWGAIM
FT                   SVSGELLCSFELLKPLDSTALKNHIKKGRKERNSMLSSPVSPPLLRFVVAKEDHNLFVQ
FT                   HRRDACGLFLAYPSLVTSWGISR"
FT   mobile_element  complement(1072064..1073566)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(1076854..1077156,1077584..1077709,1078044..1078229)
FT                   /codon_start=1
FT                   /gene_family="HOG000048357" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268301"
FT                   /orf_name="AFUA_2G03960"
FT                   /product="Acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="EAL87490.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG052631"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="UniParc:UPI000051ECCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW5"
FT                   /transl_table=1
FT                   /translation="MQLRLAYGGPHGMTVSWNTYSQLPHPTVCFGRSPKLLNRCVSSSA
FT                   SIIYTTSMINSNHVSIAELEADTLYYYLPQHSNATSPYTFKTSRQAGDQTPHTVATALM
FT                   MAPLVGSTTSRTMLASACLARLTLPASETTSACPALSLVNCREVWEPLFWKYNVDLVLS
FT                   GHANYYERNAPIANFNVHPNELNNRMPHGPLPTELQVIIMD"
FT   CDS_pept        join(1078769..1079031,1079093..1079161,1079221..1080097)
FT                   /codon_start=1
FT                   /gene_family="HOG000225260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268302"
FT                   /orf_name="AFUA_2G03970"
FT                   /product="DUF52 domain protein"
FT                   /protein_id="EAL87491.1"
FT                   /db_xref="HOGENOM:HBG020808"
FT                   /db_xref="HOGENOM:HBG575564"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniParc:UPI000051FB89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW4"
FT                   /transl_table=1
FT                   /translation="MDDASPTCSTITEDVSTTASKIYAKIVNIKKGKADIMQSREPSHA
FT                   GSWYSDNRSTLTRQLDQWLAHVPNEIEGIGSLPVPGSRVIIAPHAGYAYSGPCAAYAYR
FT                   ALDLSKAKRIFILGPSHHHYLSTLALPQLTSYYTPLSDEPLPLDTELIAKLLSAKAVKP
FT                   NGSTVSFTTMTRSVDEDEHSIELHLPYIHRLLQLQHPTKRTSQYPPLVPILVGSTSAST
FT                   EQAFGALLASYLEDPSNVFVISSDFCHWGLRFSYTYYVPQAPKPGPKLPLSADALPQPS
FT                   NDLDEFEERIELVSAGHSLQRRDRINSREPAIHESISAFDIATMAAIATGETENFLDVI
FT                   QRTGNTVCGRHPIGVIMAAIEATRTQEDGKKGAFHFIRYERSSDAVNVTDSSVSYVSAF
FT                   AVL"
FT   CDS_pept        join(1081853..1081993,1082057..1082585,1082636..1082861,
FT                   1082914..1083508)
FT                   /codon_start=1
FT                   /gene_family="HOG000158769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208712"
FT                   /orf_name="AFUA_2G03980"
FT                   /product="Alpha-1,3-glucanase/mutanase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="EAL87492.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG051622"
FT                   /db_xref="HOGENOM:HBG332366"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI000051E3AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW3"
FT                   /transl_table=1
FT                   /translation="MILLKSLSFALAGLSALATAIPMPKPFSADVSTEVSSTDRLVFCH
FT                   FMIGITSNRQSAADYDDDMQRAKALGIDAFALNIGVDPYTDTQLNFAYESAARNDMKVF
FT                   ISFDFNWYNTGQATAVGQKIRQYASLPAQLKVDGKVFASSFAGDGLDIPALNSAAGTEV
FT                   FFAPNFHPGVGDFNAIQCALNWMAWPNNDNNKAPTPDHNVSVAEGDSKYIAALNGKPYI
FT                   APVSGWFSTHFGGEVPYSKNWVFPSDLLWYDRWQEILNLGPRFIEIVTWNDYGESHYIG
FT                   PLSSPHTDDGASKWVMDMPHNGWLEMSKPFIAAYKAGEKSANNYITEDKLIYWYRPTPK
FT                   DINCDSTDTTMQGNPNNSSGNFFRGRPNGYESMTDEVFVVSLLKSPATVQVTSGSSSKT
FT                   FQAQAGASAFSAPMGVGKQQFSLLRNGQTVMSDTSLKDIVDSCICGIYNFNAYVGTVPP
FT                   EKTIDKLQPAGLSMLYQGLTVPCPTNTLGLSSPTATAQ"
FT   CDS_pept        join(1084594..1084654,1084774..1085116,1085200..1085653)
FT                   /codon_start=1
FT                   /gene_family="HOG000183324" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904138"
FT                   /orf_name="AFUA_2G03990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87493.1"
FT                   /db_xref="HOGENOM:HBG052632"
FT                   /db_xref="HOGENOM:HBG332930"
FT                   /db_xref="UniParc:UPI000051EF36"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW2"
FT                   /transl_table=1
FT                   /translation="MARIKQGVFSWEDVLAQRYQSNKPAALPRSRRHSAISGRSQSQKQ
FT                   TDTRMDWTFQPNCSLLMKLAPELRLLIWEMVLGGMRIHIIQRPNRRMGHIVCSLAETCD
FT                   ICRGEIPQLAKDGADRRKTQLLSLALTCKLIYCESIHLLYTLNIFEFSNTWSLTYLLPT
FT                   IPAEFWDCIRAVELRWAFPGHWLPSKDPVKTVYFSAGRQQWVETCRALTRMKGLQSFTL
FT                   QLMGNWFCEPVEKIPVFLEPLRELNLKNRWKLQLPRQPYYIKEIRNIDRDLRQRGIDCS
FT                   VRAA"
FT   CDS_pept        join(complement(1088652..1089202),
FT                   complement(1088187..1088587),complement(1087711..1088126))
FT                   /codon_start=1
FT                   /gene_family="HOG000183313" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057403"
FT                   /gene_name="png1"
FT                   /orf_name="AFUA_2G04000"
FT                   /product="Protein png1"
FT                   /function="damaged DNA binding"
FT                   /function="metal ion binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87494.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG052633"
FT                   /db_xref="HOGENOM:HBG396333"
FT                   /db_xref="HSSP:2F4M"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="UniParc:UPI000051F8F3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHW1"
FT                   /transl_table=1
FT                   /translation="MTDGRQQHTRRAPTTDIYDATELTRAFEQLMRTKRFNSLQEQSRS
FT                   RSRTQSPSHAQPYHTPPHPSRAPPPPPTGAHYPSSQSPSQQHQQHQLPASSSLRNLPVF
FT                   PSPPRDQQSLKFRNLLHVLSVTPTKYENPGLLDEALSLIPLDRLYSEAEEESQIMQAQA
FT                   ASVGGKPEWGYQDCVIRALLRWFKNSFFQFVNNPPCSRCLMPTIAQGMTPPTPDETARG
FT                   ATRVELYRCSESTCGSYERFPRYSDVWQLLQSRRGRVGEWANCFSMFCRALGGRVRWVW
FT                   NSEDYVWTEVYSEHQRRWVHVDACEGAWDQPRLYTEGWGRKLSYCIAFSIDGATDVTRR
FT                   YVRSPVKHGAPRNRVPEEVLVWIIHEIRKKRRESMSKTDQRRLMKEDEREEKELRAYMA
FT                   SALAAEINNLIPREQTSGRPGEQKTPASMQDTPVDWVAAQQMGPGQSGPDRSQDGR"
FT   CDS_pept        join(complement(1094379..1094679),
FT                   complement(1093911..1094286),complement(1093482..1093852),
FT                   complement(1093079..1093418),complement(1092973..1093024))
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268303"
FT                   /orf_name="AFUA_2G04010"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase subunit,
FT                   putative"
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="EAL87495.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniParc:UPI000051F8FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHW0"
FT                   /transl_table=1
FT                   /translation="MSSTNGSEGDHRLLIVSNRLPITIRRSEGGKYEFSMSSGGLVTGL
FT                   SGLSKTTTFQWYGWPGLEVPEDELGSVKKRLKDEFNATPVFMDDKLADRHYNGFSNSIL
FT                   WPLLHYHPGEIVFDEGAWDAYREANLLFAKTIVKEAQDGDLIWVQDYHLMLLPELLRAE
FT                   LRAAGKKANKIGFFLHTPFPSSEIYRILPVRGQLLRGVLHCDLIGFHTYDYARHFLSSC
FT                   SHLLGLVTTPSSVKYEGRSVAVGAFPIGIDPDKFTDGLKSPKVQNRIASLENKFQGTKL
FT                   MVSVDRLDYIKGIPQKLHALEVFLQNHPEWVGKVVLVQVAVPSRQDVEEYQNLRAVVNE
FT                   LVGRINGKFGTVDYMPIHFMHKSVSFDELIALYAASDACVVSSTRDGMNLVSFEYIATQ
FT                   QKRKGVLILSEFAGAAQSLNGSLVVNPWNTEELARAYHEAVSMSDEQRARKFEKLYKYI
FT                   SKYTSAFWGKSFVAELLQCSS"
FT   CDS_pept        join(1096312..1096334,1096384..1097746,1097799..1099169)
FT                   /codon_start=1
FT                   /gene_family="HOG000179930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208713"
FT                   /orf_name="AFUA_2G04020"
FT                   /product="Alpha,alpha-trehalose phosphate synthase subunit,
FT                   putative"
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="EAL87496.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG325476"
FT                   /db_xref="HOGENOM:HBG434102"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051E5FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV9"
FT                   /transl_table=1
FT                   /translation="MTVYIASLGRDNLTCHISFLPYTIDFQATELRHARRKSSLSQTAI
FT                   DDRVIGRLAEARQRRHNKSLSLSLTPGATTDDEKIFKPYVSRSAGEIPQADDPNGPGLS
FT                   EPRTISWGQSRKFNQPQSTAQVHPEPSILRASGAGDDLNGQFCDSVLETPDSEEDHGSP
FT                   RALLSVDDWVVKAAEQGNGGLRNAVYAAAEAGILTNKMWVGTLGMPTDLLKDTTRASIS
FT                   ETLEDEYESLTVFVRDSEFDGHYTHFCRSVLWPAFHYQMQESPRHTEYDDYSWRQYVKV
FT                   NEAFANTIAARWRPGDSIWIHDYHLLLLPQMLRQRLPQAEIGFFMHAAFPSSEVFRCLN
FT                   SRDALLNGLLGSDFVGFQTEEYCHHFLQTCSRLLSLEVTVGGVQLKDRFVRVKSIPMGI
FT                   DANALDHLRQTNEVKDWIANISSRYSGKHLIVARDRLDVPGGIKQKLLAYELFLKKYPK
FT                   WRENVVLIQIASASEMPELESQISKIATRINSKYSTLTHQPLVLLSQDISYSQFLALMS
FT                   VAEIFMVTSLREGMNLTSQDYIHCQDGKVTPQYHGSLILSEFTGSASIFHGHEFLVNPW
FT                   DYREVADAINKALGMSPEQKQHNWEFLLKKKAPHTAVAWCNSFISALAEAHSAQLSREL
FT                   SLVATLSVPALKESYEKATKRLFFLEGEGAVASGSTPSLLEELLRDPKNLVYVTSNKSP
FT                   EQIESQFASFTDRIGYIAENGCFKREIGTTQWKPLVDMERAKDWRNGIRRVMQYYQERT
FT                   DGSVLEERRCLLTFWYNNAQDPEIASRQASDLADMINGSRGSEAIRVVLSDGSVSVEPL
FT                   DITKAKAAESILEQLPETPDFLFVTGGSRGDEALFRWANRLQGENMIPDVTTVTVGSHA
FT                   TEATAVLPTGMSIADVVNTLTSSSVNGANIANGHEPPVNGDNSALSS"
FT   CDS_pept        join(complement(1102424..1102527),
FT                   complement(1102223..1102236),complement(1101863..1102099),
FT                   complement(1101603..1101774),complement(1100696..1101448),
FT                   complement(1099986..1100640))
FT                   /codon_start=1
FT                   /gene_family="HOG000183312" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268304"
FT                   /orf_name="AFUA_2G04030"
FT                   /product="Chromatin assembly factor 1 subunit B, putative "
FT                   /function="chromatin binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87497.1"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG052635"
FT                   /db_xref="HOGENOM:HBG715018"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000520488"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV8"
FT                   /transl_table=1
FT                   /translation="MKATPLLIAWHNDNAPIYSVHFDPNGKGRLATAGKRRSKGEMLAS
FT                   AGDDGNVLLWVPSELQTQPGLGEDRSDDKETWRVKHMCRSSGAEIYDLAWSPDGVFIIT
FT                   GSMDNIARIYNAQTDCGAFALRSRSGLGSSERIRCYSVIGSICPYLQLEDKGWPIYVNV
FT                   SREVPQNGSSSQTRRSSFGSSPSIRRSASPAPSLPLPAVKPLEVASPNVLGGLTIKNAN
FT                   IYANETFTSFFRRLTFTPDGSLLFTPAGQYKTTHVPATDPTKTTDEIINTVYIYTRAGF
FT                   NKPPISHLPGHKKPSVAVKCSPILYTLRKAPQPARHITLDTSSGEESFASLPEPVVSTK
FT                   PTPDKPSMEPPSTPSASESSKTNTVSKNAENEGASAGQNPSPVFSLPYRIVYAVATQDA
FT                   VLVYDTQQQTPLCVVSNLHFATFTDLTWSDDGLTLIMSSSDGFCSTLSFAPGELGQPYT
FT                   PPAGTAQHPASASTTSANQAPQPSPANNPSPLKLSQPSLSSSPAQPAEVPPASPARSNS
FT                   VCSMTTQSPIQQVTAQQSGDFVVNNPTPTLGSVPLVTAANSAQPPILPFTTPPQTPMSA
FT                   VAQSGANSVSNSVLGKRDISESEKEDSKDQGSVPEVQQPKKRRVAPTLISAGTNSNPPS
FT                   SSSPNHEVS"
FT   CDS_pept        join(complement(1103932..1104435),
FT                   complement(1103406..1103867))
FT                   /codon_start=1
FT                   /gene_family="HOG000183291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208714"
FT                   /orf_name="AFUA_2G04040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87498.1"
FT                   /db_xref="HOGENOM:HBG052636"
FT                   /db_xref="HOGENOM:HBG332934"
FT                   /db_xref="UniParc:UPI000051E848"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV7"
FT                   /transl_table=1
FT                   /translation="MGWFWGSSNQDDPVKKLDPSLREYLENEAPAKYVPTTSIPPTQEP
FT                   SRKLDLETQAQNTCAATETSEPSKPSVPSASLFPDGRYAHLWKTYKPPQEEDGSVTKGA
FT                   ERVIEKYKKHNDTVHRAAMENCALEHEALTLCFKTGNWQKRLQARVTSCSEENATFSRC
FT                   FTTQSKFLQALGYAASFDWDEEKEERIQMHADKLYHQMLDYEKRVAECRAAGQEPPPLR
FT                   SLFNPQAKPQQLKSNDTLGNLEVPGVEQIPPGFKPSKPLEQLTPHERELEIRVHNAQIE
FT                   QQKMYVQEASPFIKTHEDARLKRREKAVSWFGETIGKWVT"
FT   CDS_pept        join(1104560..1104675,1104896..1105221,1105281..1107226)
FT                   /codon_start=1
FT                   /gene_family="HOG000183280" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057404"
FT                   /orf_name="AFUA_2G04050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87499.1"
FT                   /db_xref="HOGENOM:HBG052637"
FT                   /db_xref="UniParc:UPI0000520253"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV6"
FT                   /transl_table=1
FT                   /translation="MSLISVPRQTVLGQCSSLSQFHAAALQTTTKLEFELHLQTRKTKA
FT                   IDFGFSFGLASAPPESTSEPAPQPATTVTATEPAGSSQTTSVLGETAKSLVSAAQTPSS
FT                   RNLGSGQRTPGSARNGLPERPSMFDIPSDEELELGRSSKRRKIESPKVTQTSANSDVTA
FT                   QESSLAQSRPDSTTRSAQGGLHDEPQAAAPTRSTEQVSEDVAEPAVPSASNSLIDTLAK
FT                   VGENSEVHGAAEETTVKRSGLQLQNGSKSPPQDTINSERSRHESEPHNRFPPEASLMPQ
FT                   EAVAEQAVEEQVTPEQAKADEGTQQPTRTPEVPSEQHIASEMKELQPQRQKRARGRPPA
FT                   SSRKQSAIGEPSERNGGDELEKTAAPDDPSKRLRGRSIRNARGTPNAPDTENAVPNSSL
FT                   GRGQDTAQPDTDGGDTAARAQDVEQSVSVKQNEKKKGRRAGRVGMARHVETEQDKSDES
FT                   NERIPQEEQLQPGREQEHKPELQPEAEPAPEVASRAESPTTQEASPRPKKRRGRPSLAS
FT                   RRDDNTATQPEERQITQQEVDAEDSKPTRKRTRQPRSETVPVTVHRLVNVASLAPGPSG
FT                   PDSPVEDGDSADELAARGKTKLPRRGGVNPADVLSQICRETLEKTLTTLKNGIANETNP
FT                   ARRAEWTRKKKAVEAYETELEGRLFELSEMLDSNFVLGVQLKKAKREMMDLRGRLYQIR
FT                   KEREAVALRMDAVRSKHAEEESARMVSFGLVPKSISTFSMCVWLVADVSRPAFLSTIPC
FT                   IASSLLLNEVRIAHPPMLTTQNRQMLHPQLAWSLCSVALQKQ"
FT   CDS_pept        1108045..1109166
FT                   /codon_start=1
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268305"
FT                   /orf_name="AFUA_2G04060"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase family
FT                   protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL87500.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG255608"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00005204A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV5"
FT                   /transl_table=1
FT                   /translation="MQRTTMSKLFSPIQVGRMRLGHRLAMAPMTRFRVDDDHVPLPIVK
FT                   EHYEQRAVVPGTLLITEATLVSPRAGGYANVPGIWSEAQIAQWRQVTDAVHAKGSYIYM
FT                   QLWGLGRVANPEVLKREGGFDLVSSSDVPTNEKAPAPRALTEEEIHALIGDYAQAARNA
FT                   IAAGFDGVEIHGANGYLIDQFTQDTANKRTDAWGGSVEKRARFALEVTRAVVDAVGADR
FT                   TGIRFSPWSSFQGMRMADPVPQFSYLARKTAEMKLAYVHVVESRISGNADTESTDQLDF
FT                   FLEAYGHASPVIIAGGYKADSALEAVDSRYKDYDVVIGIGRPWTSNPDLPFKIKAGIPL
FT                   RPYEREFFYLPKDPKGYIDYEPSEEFKATQVAA"
FT   CDS_pept        join(complement(1110841..1111151),
FT                   complement(1109318..1110350))
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268306"
FT                   /orf_name="AFUA_2G04070"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL87501.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG052638"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000052025B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV4"
FT                   /transl_table=1
FT                   /translation="MLSATALITWAPKCSESHFYKKSSKDIVPSPCFTTKATTIGFLRT
FT                   VLETGDLSMDTEAKKLSSAASTEADAALGFLASEGTAAFTEIVEEKLVRKIDWTIVPLM
FT                   WYKRNGKVYLSWRGPLLTFAKQPKRIGFWYLGTGTATIIGALVAHGLLFYTGGCFRSWQ
FT                   IMFLIFELITIAVGICFMIFLPDNPMASRLAHEEKLFAIESLRENRTGIENKHFKMYQF
FT                   VEVFKDPPTYFIAVIVAAMNISNAAISSFSVLIIRSFGYTTKETELLTIPGGVVSVISI
FT                   VTGTYLAGRFDQRCLSLIGILACGLLGGCLMAFSHEETKAAELAGNYLTTCVGAALPLM
FT                   YSISGANVVGHTKKVTLNTIVLMSFCLGNILGPLTFRTEDEPDYMPAKIAIVATVSVAV
FT                   VFSVLLKCYYMYENRRRDIQAEGHGPENSDFFGSDGQGESGRLRYSMF"
FT   CDS_pept        join(1117895..1118301,1118378..1118552,1118612..1118935)
FT                   /codon_start=1
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057405"
FT                   /orf_name="AFUA_2G04080"
FT                   /product="GPR/FUN34 family protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL87502.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191130"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI000051F698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV3"
FT                   /transl_table=1
FT                   /translation="MSTEQNAALEKDVGPDNSINGTPENTNAPQLTSQMTHEEHEVAKA
FT                   AARFGYGPLAKPNPNEYNLPPFGGEFQPGLYKSVEKRKFANPAPLGLCAFALTTFVLSC
FT                   INMGARDITAPNIVVALAFGYGGLVQLLAGMWEMAIGNTFGATALSSYGGFWISFAIVL
FT                   TPGGFNIESALVKADNGSTSMFDNSFGLFLMGWFIFTTILLFCTLRSTVAFFLLFFFLD
FT                   LAFLLLGIGYIQRDSAGKPNPPVIKAGGFFGLLAAFTAWYNALAGIADSSNSFFVIPVA
FT                   HFPWSPTGQARRTKTERETV"
FT   CDS_pept        join(complement(1121414..1121466),
FT                   complement(1120603..1121356))
FT                   /codon_start=1
FT                   /gene_family="HOG000048358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268307"
FT                   /orf_name="AFUA_2G04090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87503.1"
FT                   /db_xref="HOGENOM:HBG052639"
FT                   /db_xref="UniParc:UPI000051F8FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV2"
FT                   /transl_table=1
FT                   /translation="MRNSFADVPPDVRFQISWTDIRVACMAFTKPIFPFVRYARPSGLT
FT                   LIPPSKDHARTASRLIQLFEIPGVFGEPMSKAIYDLTELIWYAEWIKGDPKSSQSFDDE
FT                   TEDYFNTEVLYVEYALHTDRYTPTGETKGDATIEGCVRLACLLFHNSTIWEFYPAMGPV
FT                   FSKPIVGLRVALETTIPAGYFNLCRELLIWVLFVGACSSRLLAREHTFFMTELTMAVRN
FT                   QGFHSWQDLRELLLGYFYVDRCYLTSLRELWDEIHIDADASRLNLC"
FT   CDS_pept        join(complement(1121960..1122932),
FT                   complement(1121578..1121723))
FT                   /codon_start=1
FT                   /gene_family="HOG000183269" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268308"
FT                   /orf_name="AFUA_2G04100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87504.1"
FT                   /db_xref="HOGENOM:HBG052640"
FT                   /db_xref="HOGENOM:HBG332940"
FT                   /db_xref="UniParc:UPI0000520013"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV1"
FT                   /transl_table=1
FT                   /translation="MDAKNPYTQPTACSPAGGHEQVLPMLGKPAAWDSAIPTTSNTSGG
FT                   TIFNNYNYPHHHHQQQQPQLVHHPFVAVSSAGTTTVPAVAPSSSSLSHNPDESVAAASR
FT                   SADSDSKNRQDVGKGALSKLRKTRKTTNASNGRSTLFWVHTDPQSVSEGTREETLKRIR
FT                   SHVMSEHNRKKRLENTKRYKSKTWKHLAFQPVETTSSNSSSATAASAPAPSSASSSPAF
FT                   EQNTTTSSPTIPSTQHDQRAEQEHDQGQLQIKEEEGQFELAVTKRNDNVESYGVGAPSQ
FT                   TQSVDPEQSKSSPPWDGLGQGGKDPFNTLHTPLSDRMYRHLQHSQTSPLILDTFHHRGE
FT                   TIRLVNESLSDPLKASSDELIAAVSILLTIEV"
FT   CDS_pept        join(complement(1127993..1128040),
FT                   complement(1127684..1127921),complement(1127413..1127603),
FT                   complement(1127243..1127354),complement(1125949..1127189))
FT                   /codon_start=1
FT                   /gene_family="HOG000183258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057406"
FT                   /orf_name="AFUA_2G04110"
FT                   /product="ENTH domain protein"
FT                   /function="1-phosphatidylinositol binding"
FT                   /function="clathrin binding"
FT                   /biological_process="clathrin coat assembly"
FT                   /cellular_component="clathrin coat"
FT                   /protein_id="EAL87505.1"
FT                   /db_xref="GO:0005545"
FT                   /db_xref="GO:0030118"
FT                   /db_xref="GO:0030276"
FT                   /db_xref="GO:0048268"
FT                   /db_xref="HOGENOM:HBG052641"
FT                   /db_xref="HOGENOM:HBG332941"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniParc:UPI000051FDD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHV0"
FT                   /transl_table=1
FT                   /translation="MSQNFEKSVKGATKVKLAAPKSKYIEHILVATHTGEAGVAEIFRT
FT                   LQFRLRDSTWTIVFKALIVVHLMIREGQLDATLQYMAENPTKLAISGYSEVQSQGHNIR
FT                   RYADYLMARAKAFEATKTDYVRSGQGRMKRLTVEKGLLRETEIVQKQIKALLRCDLLTD
FT                   EVENEITLTAFRLLTLDLLTLYSVMNEGTINVLEHYFEMSRPDSERALEIYKTFTAQTE
FT                   EVVKFLGVARHFQSATRLEIPKLKHASTDLTRLLEDDLNDPDFNIRRREYLARKGAKNG
FT                   GADTALKSSITGGPQNTSNMSSAPSRPQTEPNPQKKTNPADLIDFFEPIEPNPQPTAQP
FT                   TNFQHPYQAQQQQQTMPFQPTGFQPQQTGLYTQQTGFQQQPQGASFGQPTGFGEPFPQQ
FT                   NNNQFGQAQAPQPLQSMPTGAGFGGYSAQPQTYGFQTHLSPIPQSGVASFSQQQQPALG
FT                   VQQQPQQQSTNPFRQSMLMSTPTGTAVPASPLSRQNTNPFARRLSTVNPQVSSGPTEGT
FT                   QSPAQQPLRPHRTGTNPFARSSSVPPQQSQGLQPPAAAPLRPNPTGSTNPFRQSAFVNQ
FT                   QTGQGWHVGGQQGTMGGLEKLETVPVFPRPGMA"
FT   CDS_pept        join(1130166..1130725,1130786..1131296)
FT                   /codon_start=1
FT                   /gene_family="HOG000217560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904139"
FT                   /orf_name="AFUA_2G04120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87506.1"
FT                   /db_xref="HOGENOM:HBG052642"
FT                   /db_xref="UniParc:UPI000051E5E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU9"
FT                   /transl_table=1
FT                   /translation="MVVLNHVSIASHPSPFISTFQSILAPIHRALWGKEGAMVSIIDTR
FT                   KLTGPVYFAKSLVQQNKIRIRGYNGVGEYLIWGEIQTPAIICSFKITTLIQIAHKNEDI
FT                   GRILQLDKIASCKRVRGKLRTVLSNETDSMNLDHASGVSLGKLLRLINVPQAYYQMVGE
FT                   GILKSWQLQKHGDWQEFLQGLEVGPTGTALAKEIGRNHLVQHGTVVHEEEEERFEEIEE
FT                   DKDEDEDEDEDEEEKEEEDDDSDDFQSVIGTPCPVRLAHTVSSIPPPDPRPVNRIELYN
FT                   PATRNWSLAEESSTPTEIEAFSRESSVIFLDDFEEEIEELGDTIMGKDISDLSTPEHPP
FT                   KDQFASDRERIKRFLK"
FT   CDS_pept        join(complement(1132450..1132624),
FT                   complement(1131786..1132141))
FT                   /codon_start=1
FT                   /gene_family="HOG000231341" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268309"
FT                   /orf_name="AFUA_2G04130"
FT                   /product="40S ribosomal protein S11 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL87507.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232265"
FT                   /db_xref="HOGENOM:HBG750455"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="UniParc:UPI000051FB8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU8"
FT                   /transl_table=1
FT                   /translation="MATELTVQSERAFQKQPHIFLNSKTKAKSKKVGQTRRWYKDVGLG
FT                   FRTPKTAIEGSYIDKKCPFTGMVSIRGRILTGRVVSTKMHRTIIIRREYLHYVPKYNRY
FT                   EKRHKNLAAHVSPAFRVEEGDWVTVGQCRPLSKTVCGNPPRNGSARYFRQRLMLKWKLS
FT                   WSGRQSTLSINPV"
FT   CDS_pept        join(1133041..1133283,1133349..1136348,1136400..1137021,
FT                   1137083..1137897)
FT                   /codon_start=1
FT                   /gene_family="HOG000183247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208715"
FT                   /orf_name="AFUA_2G04140"
FT                   /product="Chromosome segregation protein Spc105, putative "
FT                   /protein_id="EAL87508.1"
FT                   /db_xref="HOGENOM:HBG023162"
FT                   /db_xref="HOGENOM:HBG052643"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="UniParc:UPI000051F6A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU7"
FT                   /transl_table=1
FT                   /translation="MVSRGDSAGSGRPRSRRSIAHVPRSRLTSGLDKENATADIGAAQS
FT                   QDGFAKRAGKDKKSRSKSLGPGGLDALQDSNGNRRKSTIAFPLKSILKPTIPVSPVRNI
FT                   PSFEETRKHTPARGAQQDGVHGDNKDKGKGDLLVDIETPAQPSASGPEDPANPFDSFNA
FT                   SSAIAAAREQEEKERRERERQIILEKREARRKSMGKSASSSEIIPLAKTCLRKANRRVS
FT                   FAPEATLHTWNVVEIPDDSTSSSASNSTRRASSLAENQAPTPAAIQREPPSTPDTVAES
FT                   DIAFSPVEYPDLQELRNRSFSAYDEHATSQDLSSSPFSGGSADGLEDTSLQDVPREGDD
FT                   DDDDDNSSGSGFDGESTAMSMDNMTVHSTASARSDRSSSSTSSSARLNEALRQAAKEAG
FT                   TRGIDYDEDGKMSMEIADQEITGAFQPWIKKGQRQSFEWEDISALHDQENINPSHNSIQ
FT                   SSTVPNDSADIADEDLSMEVTNAIGRIIQPSRRQSTVRRKSMSEETNYDEQTMEFTNVI
FT                   GGIKQSASPTRSAGGESNASDEEMTMEFTSVVGGVLNKPFQTQHSEEANTGGWNDEDDG
FT                   GSMEGEADMEMTGAVGGILSATGTRDGQDEDQTAGMELTTAMGRILPATVDQNQERRDA
FT                   NSESENEQPQSSPFQENVRQSPSKSPVSFHLAAIASESGSPSLASVRPRSTRQSLSRRM
FT                   SNTPSAHSPHQSPVKNTLTSPKDSTPQASQSMTPSKTPLSMTNNRSASPRKLFQSETHL
FT                   SASKDKSLGRKSLFGSTAVTGEAVPLFVLRPHEKRRSSGLGIDKEGLGSPRVAAMLDKR
FT                   RSIGEDAPRFVPQEQPKSGVRFEDPLKLQEEVDMEREEEEKREDGHIPPLQLDPTANLK
FT                   DMISSLTPKKNKLRGRKSLHVGAARGLLGKRPVELDQDDEEEADNTPKRLKGRNASPVK
FT                   SIKLPAPPTKDETVGHLKRSPTRRSVVAPPIEGSTTPSQEPKTSSLSLTPAKDVSESFN
FT                   SSTESTSTEEGNVAPQDSEPEFEPIQLQDFLNMTNIHFMELTTTKRRHTTAPGSVSKRT
FT                   ARLSAESKAATASFEDCVAAGFCTVPMLELYQHSCRELKSYISEGRQVIRSIEAETYAE
FT                   NPPLFREYATAPPDIRLLMDNQFRNVKTHARLQSKATWYEWRMKLLEGLKEGLYRHVDE
FT                   MKADGDLLTKYETLLDGIVPALVEKQSALQEEAANLQQLTDEMESCDQDELRNAREKLS
FT                   SLEDEIELKKKQLQELQGQVQEKTNSLESGAELKAEFLAQIKEAERVKEECHGWSAKEI
FT                   SELTESVRKTELQTGWSIVSATPSGSPAGPLLTMSYREQLQLVFHPATFATENAAQPPS
FT                   SIDEKTSPHLELKYHPRNGAKSTVRAPQLSPIALLVLKSLQKHLKTLEHKTATIAPKHL
FT                   LRFISNAWNSVLSLEEEARMLEFCGVTKLRLSEDEDKLSLRARCTILGTDTAEGRKTQA
FT                   SRSTKKHASNEKQRIDVDFGVRTHVVQDNESGDVGSLDFEIDVIASKVYGFGSGNDLGM
FT                   SETEMRTILCKEMGEKTAGAQLGNGVWSRAVRMLTGTVF"
FT   CDS_pept        join(complement(1140934..1141256),
FT                   complement(1140529..1140818),complement(1139800..1140472),
FT                   complement(1139180..1139731),complement(1138228..1139116))
FT                   /codon_start=1
FT                   /gene_family="HOG000183236" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268310"
FT                   /orf_name="AFUA_2G04150"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87509.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052644"
FT                   /db_xref="HOGENOM:HBG332943"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F1CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU6"
FT                   /transl_table=1
FT                   /translation="MQNLSIAAESVLSLGSLDGCASIHQAPRFKDHHNVIRIRNPLVRI
FT                   VWISRSVKKQHSFIVVSQICEACYKSKIKCEPSASNTSCKQCTRRRIPCELTSRKEKQE
FT                   RTKRVESLLKAAGLVNEENLSSPEASSDDDVSLEEDGVEAESEDEFSTPLPHNSSVHKV
FT                   RMSKSADQQSGLESPSRLSGTEDSQHVSLIRWDNKADSLYYGRSSSLSILSREGIEWIK
FT                   HKTGEVDFLRLLVSDTKHDSPWDYWRPDVFHDVFASKVFKPLPPRAEVFSLLGDYFRTI
FT                   NRLFPLYHEASFMEMVEWQYTQQTCDDAARWASINIILALAYEYRYSNSLKPEKDKERA
FT                   WLYYKNAISVFTELTLRRTDMLSVQALLGMALFLRGNSGTQSAMPLITAAIRTCHRLGL
FT                   HRDTPRPHLAPAEQEQRKRVFWIAFILDQSTCIRTGNAPTQHPDDFDVEIPAVDPENDL
FT                   LLSDDKPFFQQLCRITIIKSRIYTELYSEKALQNKTAAEVIKIVKKLHAELGEWRAANT
FT                   FDDQLKQGAAGEDFLRGFASAGMQFVYFNSLILIHRMVLVIAFIYRQRLANGGPAPDDA
FT                   NLILRESSSSIAFCSEAARDTLRLVNNLPWGDIAWIWSLLYYVFLAVMTIFINILRDSR
FT                   YPNVREDIQSLNMASTFFATLIPSDGPSNYARFMTQMSANFERIARSVVERDQKATKLS
FT                   QRATSRTSMTRAEGHDLASEEQRSQRSQPAEAPKSSPSSSPVHSPSIIDIPHLPGLPRI
FT                   NSSGYVVPDSSPSASDDLQPSNSYPPIENACQNGAASSESSASPQVFNNPTYPFDAFFP
FT                   MPIANHIPQSEFWQTIPIADWGPPGSNQFSDDPYMQGFFQGRAPSFAAPTTTATPSNMP
FT                   SVPPDLGFSTENPGQFVDDQGPSQSIWPGGGFGNPFS"
FT   CDS_pept        join(1141965..1142144,1142426..1142608)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904140"
FT                   /orf_name="AFUA_2G04160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87510.1"
FT                   /db_xref="HOGENOM:HBG052645"
FT                   /db_xref="UniParc:UPI000051EAAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU5"
FT                   /transl_table=1
FT                   /translation="MARPMDTVVLSISPVKGISASLRGALGRLGIQRQVSIIEDSSSLR
FT                   SEKAQMTERLPDNMKARLHPAPRAATFRRVLPYGEHKQSPDIAPEFSNHHFTSLRSLHN
FT                   GHGTTSPATQRGHPSG"
FT   CDS_pept        join(1153195..1153294,1153361..1155024)
FT                   /codon_start=1
FT                   /gene_family="HOG000183225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057407"
FT                   /orf_name="AFUA_2G04170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87511.1"
FT                   /db_xref="HOGENOM:HBG052646"
FT                   /db_xref="HOGENOM:HBG325942"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR021711"
FT                   /db_xref="UniParc:UPI000051F1D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU4"
FT                   /transl_table=1
FT                   /translation="MPSRLSTPVLTVDAAKIHNVDTANAQSLHGMWMVFSKCADYMEEG
FT                   RRLENLSWRLWTRETFCVEPDKSSDTSVLPLLRSEAGDLPELSASVESAASEQAERIES
FT                   HIKRSRCDLKPAVVREDSFSYLGRGKEKHITSLGLERMVLNIKEKKNLEPLDPPMTTVA
FT                   PPVVDLTPRPSTLSPTPPSESTAKRTPSFPPFNNQALHSTASCSTTAPEGNDSDAANVN
FT                   ASDTSVSSSGMLPSRSCLIKSPSVVRGFSPSLVSSSYRSQPRLAADPGPAQQPAQLKPT
FT                   PFKKKGGMFTLGGSSGDDDESSFEDRIAIQKPQHSSLSNELSKSANTNPSPSKKVTSFQ
FT                   EQVGIIKPVSERSYDNDEDAIETEDEVSESAIEDDEDSDWEDSVTESGRSSVEERELFK
FT                   RVDSRPNLVSRRSLLTMMMHQPTKMQGPASRSSPALQRSRLTSPNGPSIPASPPEDEEE
FT                   SLTMRGPDVPRSKPIIVKPSPQSVAHSPRTTRRNMLATELTESLRRHLLWERQQKSATA
FT                   NAFLKRRHTTHDMANLQEYPEPNGALKGQTSQQNAGVPNGTSAKAHAEKDVASFNHYTD
FT                   FGPWEYHVKGW"
FT   CDS_pept        complement(1160599..1160748)
FT                   /codon_start=1
FT                   /gene_family="HOG000217561" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268311"
FT                   /orf_name="AFUA_2G04180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87512.1"
FT                   /db_xref="HOGENOM:HBG052647"
FT                   /db_xref="UniParc:UPI000051F459"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU3"
FT                   /transl_table=1
FT                   /translation="MSKFCFDEFTVADDTNIIITYHQEPSTTFPCASALTACTGSTNLH
FT                   VHSS"
FT   CDS_pept        join(1161976..1162108,1162804..1164432,1164605..1164874,
FT                   1165171..1165206,1165295..1165344)
FT                   /codon_start=1
FT                   /gene_family="HOG000183214" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904141"
FT                   /orf_name="AFUA_2G04190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87513.1"
FT                   /db_xref="HOGENOM:HBG052648"
FT                   /db_xref="UniParc:UPI000051FB84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU2"
FT                   /transl_table=1
FT                   /translation="MSHKDLTRLLGDFFEPYSHHIGRMDSTSGLGAPDGLSRHASSTNG
FT                   CRAGDACPYIHDLADAKRKNTQPGTQVQAGSANEVEDSQNSLQGVATDVRNLSISDTKE
FT                   VKAVPQAGAKSGFHAGQRPISKAESSSPREFQINQLRRRFRPKETTDTSGTSLTIEMAP
FT                   SDPDFPFELDTLQCILHVPLSYPGQGRPTLKVINPNMERAFQASVERGFDDIVDSTLRT
FT                   GGRGTLLSWMNNLDRHLERLLTTTERGPTLKFVPNVGSREVQEHRAPEQVRVSHTDAPA
FT                   TERKPVPKQTSSVTNVSRAYTTEEKAQAERRRAVETKQIEARLGRMPLFQKSPDELSFV
FT                   IPVQPSKVERLPVSLRPIKTVKLLVPRLYPLEPSSIELQGVRSPEAQSVEVGFSKWVKA
FT                   NAQLNLMSQINYLTSNMHTLVTTALESASEPKLEPKQEPTTSSADLPDNPAPSGSNNLT
FT                   FEMVDKPHIRVIPRPPEWSARDTDEGSEVSDFSTSEDSFTDEDGDDEDGGAPVPDMPAP
FT                   TSERGVALSFPYLELYGIELLELVGLYITVKCDRCKEHLDVRNIPQVKDKSDALAPKVE
FT                   TCKKCTNTMSLGESHSSVCEYRANVAHIHVVALSPPAQNARLHFPSLAWLQFAARVQLL
FT                   PAVNAIAKWVSSDIVKFRALTNHWTSVFKIPEVKFLIVGSAACSAVVQRFSHVTSATTQ
FT                   RQIIQTNMQIA"
FT   mobile_element  complement(1166228..1166701)
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   CDS_pept        join(complement(1170344..1171002),
FT                   complement(1170232..1170291),complement(1169819..1170176),
FT                   complement(1169626..1169760))
FT                   /codon_start=1
FT                   /gene_family="HOG000188687" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268312"
FT                   /orf_name="AFUA_2G04200"
FT                   /product="Probable 4-hydroxyphenylpyruvate dioxygenase 1 "
FT                   /EC_number="1.13.11.27"
FT                   /function="4-hydroxyphenylpyruvate dioxygenase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="L-phenylalanine catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tyrosine catabolic process "
FT                   /protein_id="EAL87514.1"
FT                   /db_xref="GO:0003868"
FT                   /db_xref="GO:0006559"
FT                   /db_xref="GO:0006572"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG140555"
FT                   /db_xref="HOGENOM:HBG680392"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="UniParc:UPI000051ECCB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHU1"
FT                   /transl_table=1
FT                   /translation="MAPSAISTSPPPTDRVSSSLASYKGYDHVHWYVGNAKQAASYYIT
FT                   RMGFKRIAYRGLETGCRSVCSHVVRNGDITFILTSPLRSLDQVDRFPPEEQELLKEIHA
FT                   HLEKHGDGVKDVAFEVDSVDSVFYAATNNGAKIVSQPRTLEDDNGQVRVATIQTYGETT
FT                   HTLVERGSYHGAFLPGYRMETGVEDPISQLLPGVHLNRIDHCVGNQDWDEMDKVCEYYE
FT                   KALGFHRFWSVDDKQICTEYSALKSIVMASPNEVVKMPINEPAKGKKQSQIEEYVDFYN
FT                   GAGVQHIALLTDDIIRDITNLKARGVEFIKVPDTYYEDIKVRLKKAGLTLHEDFETIRS
FT                   LDILIDFDEGGYLLQLFTKHLMDRPTVFIEIIQRHNFSGFGAGNFKSLFEAIEREQALR
FT                   GNLV"
FT   CDS_pept        1171602..1172372
FT                   /codon_start=1
FT                   /gene_family="HOG000183202" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057408"
FT                   /orf_name="AFUA_2G04210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87515.1"
FT                   /db_xref="HOGENOM:HBG052649"
FT                   /db_xref="HOGENOM:HBG325937"
FT                   /db_xref="UniParc:UPI000051E5F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHU0"
FT                   /transl_table=1
FT                   /translation="MASGTTIQPSRPSLTSNDSAVLQALFDAESSPSSAVAIDPSLSPF
FT                   PEYLHISASDHESLKARELSIIRSLQSDDVSMDTITSAIRDLDALITEHPTYPSAYVNR
FT                   AQALRLHIEKTAEASTDPEEAIFTPGNTESASRLFSDLGQAISLCTPRSPADPVSTVQA
FT                   RILADSHTHRGYLLLKAARLKKNANGNEMVGGPDKLRDMGPDQLEEMASRDFFFGGRYG
FT                   NKVAQQLAVQTNPYAKMCGAIVKEALRKEVEGVI"
FT   CDS_pept        join(complement(1174105..1174172),
FT                   complement(1173543..1174052),complement(1172830..1173480),
FT                   complement(1172657..1172777))
FT                   /codon_start=1
FT                   /gene_family="HOG000139824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268313"
FT                   /orf_name="AFUA_2G04220"
FT                   /product="Homogentisate 1,2-dioxygenase (HmgA), putative "
FT                   /EC_number="1.13.11.5"
FT                   /function="homogentisate 1,2-dioxygenase activity "
FT                   /biological_process="L-phenylalanine catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tyrosine metabolic process "
FT                   /protein_id="EAL87516.1"
FT                   /db_xref="GO:0004411"
FT                   /db_xref="GO:0006559"
FT                   /db_xref="GO:0006570"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG002062"
FT                   /db_xref="HOGENOM:HBG293508"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniParc:UPI0000520495"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT9"
FT                   /transl_table=1
FT                   /translation="MPVTQFSHPDPYSYQTGFDSYHETEAVKGALPVGQNSPQKAPYGL
FT                   YAEKLSGTAFTAPRHENKQTWVYRILPAAAHENFKAEDADSYHTSMTTETHKLHHIPNQ
FT                   LRWDPFDLDETVDWVHGLHLVAGAGDPTLKHGLGIILYAAGKDMGKEAFYSADGDFLIV
FT                   PQHGVLDIQTELGRLMVRPNEICVIPRGVRYRVTLPAGPVRGYICELYQGHYQLPELGP
FT                   IGSNCLANARDFQAPVASFEDEEEPTEWRLYSKFNNTLFSARQDHTPFDIVAWHGNYYP
FT                   YKYDLGRFNTIGSISFDHPDPSIFTVLTGPSDHAGTAIADFVIFPPRWLVAENTFRPPW
FT                   YHRNTMSEFMGLICGNYDAKTGGGFQPAGASLHNVMSAHGPDADAFEGASNAELKPQKV
FT                   GDGSMAFMFESCLMVGVSEWGLKTCQKVQEQYNEHSWRPLKRHFKNPNKA"
FT   CDS_pept        1174675..1175970
FT                   /codon_start=1
FT                   /gene_family="HOG000256845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268314"
FT                   /orf_name="AFUA_2G04230"
FT                   /product="Fumarylacetoacetate hydrolase FahA "
FT                   /EC_number="3.7.1.2"
FT                   /function="fumarylacetoacetase activity"
FT                   /biological_process="aromatic amino acid family metabolic
FT                   process"
FT                   /protein_id="EAL87517.1"
FT                   /db_xref="GO:0004334"
FT                   /db_xref="GO:0009072"
FT                   /db_xref="HOGENOM:HBG000599"
FT                   /db_xref="HOGENOM:HBG289935"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="UniParc:UPI000051F1D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT8"
FT                   /transl_table=1
FT                   /translation="MASWLQIPKNSPFSLANIPFGIISSAKITSPVAAVAVGDYALNLS
FT                   IFASSGGFSQLPVIQPHLGVFSQPTLNAFAALGRPVHRQVREYIQSVFRADTPFPQILK
FT                   DNSTLQKEALLPLSEVTNHLPMHIGDYTDFYAGLNHAYNVGVLFRGPENALQPNYKHLP
FT                   VGYHGRASSVVTSGTPIRRPNGQILANPAANPKVPTFSPCKRLDIELELAAFVSKSNEL
FT                   GKPVSIDEAEDHIFGVVLMNDWSARDIQAWEYVPLGPFNAKNFATTITPWVVLLDALEP
FT                   FRTAGLEPGNRESLLPYLREKRELNAYDIPLEVEITNAGGKPTLISRTNAKNLLYSFPQ
FT                   MLAHHTITGCNMNTGDLLGSGTISGKENQTQGSLLEQTNGKNPLKLADGSERLFLEDGD
FT                   TVVLRGMAGTEGNYVGFGDCVGTILPALKLEF"
FT   CDS_pept        complement(1176181..1176876)
FT                   /codon_start=1
FT                   /gene_family="HOG000125758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057409"
FT                   /orf_name="AFUA_2G04240"
FT                   /product="Maleylacetoacetate isomerase MaiA "
FT                   /EC_number="5.2.1.2"
FT                   /function="maleylacetoacetate isomerase activity "
FT                   /biological_process="aromatic amino acid family metabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87518.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009072"
FT                   /db_xref="GO:0016034"
FT                   /db_xref="HOGENOM:HBG416344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051EA9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT7"
FT                   /transl_table=1
FT                   /translation="MEDSTSPKVTLYTYFRSSCSARLRIALNLKSIPYTPIAVNLLKGE
FT                   QSSPENIALNPSGTVPTLIVEHDSKEPVTITQSLAALEYLEEITPASSHALLPPASNPE
FT                   ARAVVRTLVDIMSCDVQPVTNLRILKRVAPFGVDRAAWSKDLIEDGFRAYEAIAAKSAG
FT                   LFSVGDSITMADVCLLPAVWGAERAGVKVEKFPTIYRVAQRLEEEDAVKRAHWRTQPDT
FT                   PEEFRVSSS"
FT   CDS_pept        join(1177947..1178166,1178444..1178795,1178852..1179768,
FT                   1179843..1180600)
FT                   /codon_start=1
FT                   /gene_family="HOG000183191" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268315"
FT                   /orf_name="AFUA_2G04262"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27314.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG324019"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51822"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U3"
FT                   /transl_table=1
FT                   /translation="MEIRRPSRHGNHPDRTYQRTYKACISCRQRKAKCDLGTGPDGLPL
FT                   GPPCAKCRREQKPCLFDEKRAWERVKKRGTQSTSNLANSMMRTVVSSGNDALNILFEAA
FT                   NAQSQEDSMIESDSLPETEQHRSGHPVTSEGSSNQIDLTVPPDVLEKAMRPVELSHVSK
FT                   DVLSTWEACRFVRMGWFTAREAVTFIDLFFKNMSILSPVLTDFYADHKNHRWLIAHDPV
FT                   LCCTILMISSRYHVLPGVGGQSRNFFIHHRLWQHCQQLVTRLIFGQELSSQPKIRNIGT
FT                   IEALLLMSDWHPRSLHFPPESDGWDSDLVTIDLESTEYGDDGSNSSAKRWAKDMSEPAK
FT                   RSDQMSWMLLGSALSLAHELGIYETGDKARDAFVAYERFMTKDQMRLRRQRAQRLLYVY
FT                   INQLAWRIGCVSLMPQGLSHSILNRQTSRELSQYGEEWLTFMDSWMDLTKLAKSVTDMF
FT                   FPSVTFARQQLQSGRYIDLLDHFRPLLDKWKERYLQPQLHDKPFYDDIFIEYHFVRVYT
FT                   HSVGMQAVVERAIADGNADEEEVRPMNIDPIDYEYIQEVIDGCCQILEKVTQLADIGAL
FT                   RFSPVRIFVRITSASIFLMKALSLGARQAKLRESLDVLERTIQALRSNALDDIHLSTRY
FT                   ATLLETHVSRLRRHLVASCKSLKRRRESTTRHSMVPPSYASATSDEHAPLITNPPVPQN
FT                   MSDMGFTPSLNDIAADDWLSLPFDPSMAPFSISSGGQFPAYEGGGLNFLWNLPS"
FT   CDS_pept        join(1181277..1181345,1181419..1181617,1181701..1181897)
FT                   /codon_start=1
FT                   /gene_family="HOG000183190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268316"
FT                   /orf_name="AFUA_2G04270"
FT                   /product="Mitochondrial inner membrane translocase subunit
FT                   (TIM17), putative"
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL87521.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG325936"
FT                   /db_xref="HOGENOM:HBG347641"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000051F1C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT4"
FT                   /transl_table=1
FT                   /translation="MDHSRDPCPWVALSDFGGAFCMGAIGGAVWHGVKGFRNSPYGERR
FT                   IGAITAIKARAPVLGGNFGVWGGLFSTFDCAIKGIRKKEDPYNAIIAGFFTGGALAVRG
FT                   GVKAARNSAIMCAVFLAVIEGVGIGFQRMMADNTKLEVWSLTIALCYDCG"
FT   CDS_pept        1182654..1184039
FT                   /codon_start=1
FT                   /gene_family="HOG000183169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268317"
FT                   /orf_name="AFUA_2G04280"
FT                   /product="Asparaginase, putative"
FT                   /EC_number="3.5.1.1"
FT                   /function="asparaginase activity"
FT                   /protein_id="EAL87522.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="HOGENOM:HBG052653"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="UniParc:UPI000051E5EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT3"
FT                   /transl_table=1
FT                   /translation="MTDSIPATFKPALIIHGGAGNIQRSRLPPDLYAQYHASLLSYLRS
FT                   TKDLLNSGASALDAAVHAVSLLEDDEFFNCGRGSVFTSAGTIEMEASVMVTTVNKPTDE
FT                   TPSPIKRGAAVMELRNVRHPIQLARECLLRTGHDANGNPNGDGGNMHSQLGAPYVEELA
FT                   RAWGLEFKPDEWFWTKRRWEEHQRGLKGETEPVSLSQGTVGCVCLDRWGELAVATSTGG
FT                   LTNKLPGRIGDTPTLGAGFWAEAWEEGLREAGGKRMVYRSSMSDPNDAEDTSWGTAAIK
FT                   RMVAECMPPVVNRLLWPATDTRLPSQEHSSEKQALLEQEGLPRRIKRRAVALSGTGNGD
FT                   SFLRVAAARTACAMLRYSQASVPRSLAEAVSAVAGPDGELQRSAGRRWGKTGEGEAGII
FT                   GIEAETVLDATGAGLRAAQKKTLSRGKVVFDFNCGGMWRAWVEEDATGKDVERVMVFRE
FT                   EYQ"
FT   CDS_pept        join(complement(1185685..1185885),
FT                   complement(1185358..1185633),complement(1184142..1185299))
FT                   /codon_start=1
FT                   /gene_family="HOG000169440" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268318"
FT                   /orf_name="AFUA_2G04290"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87523.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051329"
FT                   /db_xref="HOGENOM:HBG325657"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI000051E5F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT2"
FT                   /transl_table=1
FT                   /translation="MTVKIPWPAVYLAIAASVYMRPQYAILDSLTATFVVLSLAVTSFR
FT                   IIYAFVLYPKFFTPIKHIPTPSNWSWLTGNTSSYLIESPFEEMIEWAYKVPNNGLIRYY
FT                   IFGNLERVLLTNPKALSELLVTKVYEFPKPQLVRQSLARVTGKHGVLLVEGDEHKRQRK
FT                   NLMPAFSYRHIKNLYPIFWSKSIEMVKLIEKDLHSRADAKDNIVRVSEWASRATLDIIG
FT                   VAGMDHDFGSLHDSNNELTKHYRRLLEEPPLAMRIIFVLGVLFGSVGVVESLPLKRNRE
FT                   IRESSLYIRDVARQMIRKKEAKMKSQASAETGTDIVSVALESGAFTEEELVDQMMTFLA
FT                   AGHETTSTALQWSVYALCKHPDVQTRLREEVRTHLPPISPEHPEPLSAATLDSLPYLNA
FT                   FCNEVFRFHPSVPGTVRDAAKDTTLLGYPIPKGTRILVSPEVINHSKELWGPDADQFNV
FT                   ERWLGSGRANTGGASSNYSFLTFLHGPRSCIGQGFAKAELACLVAAIVGRFQMELKDAD
FT                   AKLEVRRSATVAPKDGVLARFTPLEGW"
FT   CDS_pept        1186731..1187945
FT                   /codon_start=1
FT                   /gene_family="HOG000183158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057410"
FT                   /orf_name="AFUA_2G04300"
FT                   /product="Lipase/esterase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL87524.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG052654"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051F699"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT1"
FT                   /transl_table=1
FT                   /translation="MTAIGAKSHLPPQLTLLQRLQLLTRILIALPRLIFRITRDLLFNH
FT                   DSASFSTIWMRNTSRVADSLPHPQARALQRPSGSTIASLCKTYSLRHETIELDAGSAFP
FT                   LATLHFIDCDPTARSPSGNVLLYFHGGGYITPLSTGHFKFARAAAQRLTAKCVLLEYTL
FT                   APELKYPGQLAQAAAALRYLLQHHDAAEVTIAGDSAGGNLALGVLAHLRDPHPLVRPVF
FT                   EGDLRQQEQKLCAVLCVSPRCANTCDAESYTYNASKDIVSRALMEVFNSHWEPVKEEVW
FT                   ATPLAGTKEFWGSIPAKKVLLLAGTDEVYVDDIRRFGELLGSSSQAASTELVLCAEETH
FT                   AQAIRDVAVNNWDGVMLKVALNWLQNLGTLNDRGLPLPPNSKGVCAVWNDTINVMTDSD
FT                   TRHAR"
FT   CDS_pept        join(complement(1189758..1189815),
FT                   complement(1189654..1189695),complement(1189578..1189598),
FT                   complement(1189440..1189511),complement(1189309..1189380),
FT                   complement(1189181..1189233),complement(1188555..1189123),
FT                   complement(1188426..1188501),complement(1188083..1188370))
FT                   /codon_start=1
FT                   /gene_family="HOG000230093" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752017"
FT                   /orf_name="AFUA_2G04310"
FT                   /product="Argininosuccinate synthase "
FT                   /EC_number="6.3.4.5"
FT                   /function="ATP binding"
FT                   /function="argininosuccinate synthase activity "
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87525.2"
FT                   /db_xref="GO:0004055"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="HOGENOM:HBG000340"
FT                   /db_xref="HOGENOM:HBG335267"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="UniParc:UPI0000F5183F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHT0"
FT                   /transl_table=1
FT                   /translation="MSKGKVCLAFSGGLDTSVILKWLIDEGYEVVAFTANVGQEEDFDA
FT                   IREKALKLGAVKCEIADLRREFIEQLCFPAIACNAIYENVYLLGTSLARPVIARAQIDV
FT                   AKREGCFAVSHGCTGKGNDQVRFELAFYALQPDIKVIAPWRDPAFYNRFAGRNDLLSYA
FT                   AEKGIPVTSTKAKPWSMDENLAHCSYEAGILEDPNVTPPADMWKLTQDPLTAPDQPEDF
FT                   TVHFETGIPVKLEYTEGGQKKVATDAVDLFLTANTIARRNGVGRIDIVENRFIGIKSRG
FT                   CYETPGLTCLRAAHIDLEGLVLDREVRALRDQFVTFNYSKLLYNGLYFSPEREFLEASI
FT                   TASQKTVNGQVRCRAYKGSISILGRSSETEKLYDMSESSMDEIGDFAPTETTGFIGVSA
FT                   IRLKKYGQMKQANGEKM"
FT   CDS_pept        join(1190799..1190978,1191065..1192150)
FT                   /codon_start=1
FT                   /gene_family="HOG000116232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268319"
FT                   /orf_name="AFUA_2G04320"
FT                   /product="NADH-dependent flavin oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87526.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG255608"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051E5F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS9"
FT                   /transl_table=1
FT                   /translation="MSQPVVPDIENKPAPGISYFTPAQEPPAGTAANPQSDGSAPPKLF
FT                   RPLSVRGLTFHNRIGLSPLCQYSADDGHMTPWHMAHLGGIAQRGPGFLMVEATAVEPEG
FT                   RITPQDLGLWKDSQIEPLSRVIEFVHSQNQLIGVQIAHAGRKASTVAPWLSANDTASEK
FT                   MGGWPGRVKGPTNVPFTVKNPVPKEMTKQDIEDLKTAWVAAVKRAVKAGADFIEIHNAH
FT                   GYLLMSFLSPAVNTRTDEYGGSFENRIRLSLEIAKLTRENVPKDMPVFLRVSATDWLEE
FT                   VQPNKPSWRGVDTVRFAKILAETGYVDVLDVSSGGTHSEQHIHAKPGFQAPFAIAVKNA
FT                   VGDKLAVASVGMIASAHLANSLLEKDGLDLVLVGRGFQKNPGLVWAWADELNVEISMAN
FT                   QIRWGFSRRGAGPYLRKKLEKI"
FT   CDS_pept        join(complement(1193898..1193944),
FT                   complement(1193768..1193849),complement(1193655..1193712),
FT                   complement(1192854..1193592),complement(1192451..1192799))
FT                   /codon_start=1
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268320"
FT                   /orf_name="AFUA_2G04330"
FT                   /product="Salicylate hydroxylase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87527.2"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052656"
FT                   /db_xref="HOGENOM:HBG321923"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000F51809"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS8"
FT                   /transl_table=1
FT                   /translation="MIVPRAKTPLEVVIVGAGIGGMAAALALGQRGHRVIVLESAPKLM
FT                   EVGAGIQGSPNMLMLFDRWGVSPLIHAKDVALEYIHVRRWQDGSLLGKMPVNKTYGQQV
FT                   VVHRADLHNALIEKAMALENVQVRVNSTVTRVQFDPPAVTLADGTMVQADVVLAADGIK
FT                   SSIRDQLLGKDATKAIRTGDAAYRIMLPRSAMENDPELKQLIDEPQATRWIGPYRHIIA
FT                   YPVRNHQLYNIVLLHPDRTDVEESWTTRGSKQMMVDDYRGWDRRVTKLIDLVKDNEVLE
FT                   WKLCQHPPLKTWIRGRVALLGDACHPMLPYVGQGAAQAVEDAAALGVLLSSISSRSEIP
FT                   LALASYEKSRKHRAETVQQSGTVNRATLHLPDGPEQQARDDQFRASMNGASNPDKWADL
FT                   ETQKFLWGWDAEKAALETWEGELPF"
FT   CDS_pept        join(complement(1196906..1196965),
FT                   complement(1195516..1196838))
FT                   /codon_start=1
FT                   /gene_family="HOG000183147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268321"
FT                   /orf_name="AFUA_2G04350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87529.2"
FT                   /db_xref="HOGENOM:HBG052658"
FT                   /db_xref="HOGENOM:HBG324020"
FT                   /db_xref="UniParc:UPI0000F5181C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS6"
FT                   /transl_table=1
FT                   /translation="MPPLGETIAVIDKSGKVVSTSKHLFGVFTQAKNAYRERKAQIQSE
FT                   RNAKIAEREALRALQNYHIDDAPPSVAPSRRSRSTHSRHHRHRRAPSHYEQDLHLVASQ
FT                   TESYYASPSDMVRRHTHHDITRELEPRPRMDRSKSEAHVDMDLAYGEFHPSALIRAPSS
FT                   QQQQLQRIEDPELNGLVDRAQWLLEEANCVHHSATATIAHLQKNPDAMAAVALTLAEIS
FT                   NLATKMAPSALATLKSAAPTIFALLASPQFLIAAGVGLGVTIVMFGGYKIIKKIQSAGN
FT                   EVIRGPTEDDGESVIVEDMIEFDTDCLSGVEMWRRGVADAEADSIGTSVDGEFITPTAA
FT                   AMSGIDITTARMMRDPRFKFHDDESVASSRRSRRSRAPRGSSRHHQSEYDARAESYAGS
FT                   KAPSAAPSRTHSKFSSKAPSKAPSQAPSRAPSKAESRHSDKDRKPKEKKRRSSRLRLMF
FT                   TA"
FT   CDS_pept        join(1199282..1199512,1199566..1199691,1199741..1199872,
FT                   1199920..1200471,1200522..1200708,1200757..1202429)
FT                   /codon_start=1
FT                   /gene_family="HOG000183136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208716"
FT                   /orf_name="AFUA_2G04360"
FT                   /product="WD repeat protein"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EBA27315.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG395935"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017149"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000F51820"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U2"
FT                   /transl_table=1
FT                   /translation="MNSTVQGKPDPSGGNHDRTIPGLDSQPLTQHLNDGPDHLNTRPDC
FT                   GIGHRVQASRSVLALVIDDECVFAGLQGGDIVAWSLETYELVLSVHAHQESVLGLYLSE
FT                   DGDLLFSSGGDSVINVWSTRTFDRLYSIHSHHDVGDIFSVAYSSSLKTIYCGGQNTSIQ
FT                   WCDLSKTDAVSTNQSAAHLSKRTHRFFDSRGPDGSRAPRPDAGADGVRAVIQGGQVLTF
FT                   KRDHHKLFSHHGYIYTMLLVRGLLESSPTEEVLVTGAGDGVVKLWRLDQDEAPSEMAAL
FT                   ENGDPVLALAVDGSFLYCGLSGGALNIWNLDSRQLVKRITGHTGDLWAVDIVQGLVVCG
FT                   DSNGVIKKFNSRFEEVGSWIAHGGTMLASAAGRFKDRLIYASGGNDNTVGIWDLTEVSS
FT                   KQNEQAPINNDEMVNFLARFVAFKTVSASPKFAGECNQGAAFLRRHCIYLGAKTKLLPT
FT                   GQDTNPIVYARFSANSPDKVDKTLLFYGHYDVVSADANRTKWNTDPYQLASIDGFLYGR
FT                   GVSDNKGPILAALYAAADLARQKALPCDVVFLIEGEEESGSQGFHETVRQHKPEIGSVD
FT                   WILLANSYWLDDYNPCLTYGLRGVVHANLIVTSDHPDLHSGIDGSALLDEPLKDLSMLL
FT                   ASLVGPKGRINIPGFHDLVLPLTEAEKQRFADVARILLPQHPEITDRDALINSLMHRWR
FT                   EPSLTIHSVEVPGSSKAATTTISRKAKASLSIRVVPNQEADEVAANLTMYAQEQFDKLE
FT                   SQNDLTVEITGKSDPWLGDPDNEIFATLSEAITAAWSRDQTSQKHQYPPLQRFPKGKDT
FT                   PGLARTDSSDSLASHIDRIIMSTTTSSASKSKARQRSALSSTVPTSSTLTSKSGVIVSP
FT                   DASGDSSDEKPAAPAQEPVATRSTVQPIFIREGGSIPTIRFLEKEFSAPAANLPCGQAS
FT                   DNAHLYNERLRVENLYKSREIFQYVFSRLPRRHRPS"
FT   CDS_pept        join(1204070..1204128,1204188..1204298,1204374..1204645,
FT                   1204716..1205164)
FT                   /codon_start=1
FT                   /gene_family="HOG000183125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752018"
FT                   /orf_name="AFUA_2G04380"
FT                   /product="LaeA-like methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL87532.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG052661"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051ECD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS3"
FT                   /transl_table=1
FT                   /translation="MASPSDAAYLLGRDPEESKRLNAQHAFLVDVIGGTPIHPSIPTAN
FT                   IRSIADAATGTGIWLVDAAQTLHNHHPRHTLSLHGFDISPAQFPFSSLKAQRHEIQLTV
FT                   QDILQPFPQEHRGRYDLVHVRLLVGALKEVDYPRAVRNLYDLLKPGGYLQWDDCDTTAF
FT                   CTDDPTPIDMEMRQIVVDAVEKLGLCGYAPQYLHQLAAQTGFVDARLYANSTADKPHLR
FT                   GPARTWLMQVLRALMPHAMVKSGEVVDEKKAIERAERLVEEFGRHCTAALPLVNLYVLV
FT                   ARKPVRPRSGCCTIM"
FT   CDS_pept        complement(1205240..1208344)
FT                   /codon_start=1
FT                   /gene_family="HOG000183114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268322"
FT                   /orf_name="AFUA_2G04390"
FT                   /product="Cytomegalovirus gH-receptor family protein,
FT                   putative"
FT                   /function="receptor activity"
FT                   /protein_id="EAL87533.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="HOGENOM:HBG023171"
FT                   /db_xref="HOGENOM:HBG052662"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniParc:UPI0000520489"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS2"
FT                   /transl_table=1
FT                   /translation="MVPHRRSSSSDHHHPSLHDSYQPSSSSDEPWDLRPENGTKGGEMR
FT                   ELDGNGNADLPRPETPTSETTDRDITTNGNESQTLRLQRPKSIRQETDDIGETMDDTAT
FT                   ANGASDNQESHHGYAELKAGQFPPQQALGLVFEHTNNGDDAHRTSLVDVLQGAEAGAAL
FT                   NGWPEKMSPSKGQDMERDREKVLKLSPAKIQELTSSPQSIPYRPVASETEQGRRVLSDG
FT                   IHTTGAESDEGESRAHAGHLARDFQSGDGLGLGISAASKNSVSNGRTRPHASRTVSTPT
FT                   SSRRPTLPGTNERLAQTWASRSKPDRPGIGLGNSRLEQESKRQLSPSPVITEPALPSPM
FT                   PPSIPLPPLSVPTYLQLELSSGRPSPLYIHRSVTNDFPYESSRVKLERLSSFLRLPPAL
FT                   EQVLWFGILACLDAWLYSFTILPLRFCKALYILLESWLVNLGMEFRFVSDFVIKGIGRV
FT                   WQRQKKSAPVAEAERRPRGTSAERGPRTKSGESRRLHRADTHKYQHRRQKSIPSALLPD
FT                   DKADILKGLLMIATCCVLMYFDASRMYHWIRGQAAIKLYVIYNVLEVSDRLLAAIGQDV
FT                   LECLFSREALERRPDGRSKVFRPFGLFLLALTYTVLHATSLFYQVMTLNVAVNSYSNAL
FT                   ITLLLSNQFVEIKSTVFKKFEKENLFQLTCADVVERFQLWLMLTIIASRNIVETGAFNF
FT                   VGTLSSSLSSRSTSTNSTPLSTPPRSSSSILPQSFTFFPSSLISSFSHVNSFLPTLAQV
FT                   LGPFLVVLGSEMLVDWLKHAYINKFNNTRPAIYGRFLDILAKDYYTNAFGDQNLTKRLG
FT                   LPVIPLSCLFFRVSVQTYQMFLAALLPHQPSSTAVESTSLASIHSHYVPSPIPSAPPLT
FT                   LRTILPVSAAHASAFFRRVLANAMPSPAQSVYIFTIVLILTAFILLLILKLLLGMLLLV
FT                   YSRSRYRRMKVREAEQAAHKTDSGSATGPASRGREFAIEGSRRVGGWGSVEVNDDKRRW
FT                   IYTDDPEGLRRLKAREERDKEKAAKEGEASMDHVQRYEMVAKRIW"
FT   CDS_pept        join(complement(1211408..1211470),
FT                   complement(1210913..1211339),complement(1209384..1210858))
FT                   /codon_start=1
FT                   /gene_family="HOG000183103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904142"
FT                   /orf_name="AFUA_2G04400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87534.1"
FT                   /db_xref="HOGENOM:HBG052663"
FT                   /db_xref="UniParc:UPI000051F43B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS1"
FT                   /transl_table=1
FT                   /translation="MPCCGEREKGPVSREEKWDSVNLDDFKSESCLTPFSYFLVYVFLL
FT                   VSIAVYGVDTFTAVNLLAFSRWAGSIEPAIPFTVSRWIFAVCIIVSFVLLFLRWLHAIR
FT                   AMRSGSIARSYLDPLAARVQSIRMGRRGRGWRRFLVFAELTKSKKGAEYVALFAYFSFE
FT                   SWMNTVFADGPRQVVNAITLYSVMRMDLLPGGKNSVDDDKAGIIQFFENVKILAEDNNQ
FT                   RAVVLCGMLFTLVIWVLSILKLASAVILYLIFLFHHIPAEDGSLKVYCRRKINARLMRI
FT                   VRRKVDKALAKSTLDRAPTQPHLALDRNPTLPMVADLDAEDKAPTVPTLSRSTTQTTLP
FT                   PYTSRPGTAAPERNPTLPTLPDVSWTEKPAMSRTVTQSSAHSESTSYSGATAVSGYSPL
FT                   DRGSLPAPPVPPVPTNVPMPGARSYTPISRPPTTRPTRTPAPPSATNASSRMPTTMHQG
FT                   DYEEAPRRYPDPYSTDAPYDENYGAHPSYSAAPDPYSRSVTRGIAVSPGEDYPTRTLSP
FT                   QSHRGTPQPSSSDPPTSYPVRAYTPGNAGTARPPLAVDAAASYAERTYTPVSQRATPRP
FT                   QQQSSQQQGGYVAFNPSSMAPSQPSAGIRPTHSPVYHAYSGPSSATSPNGPSNRGPPVR
FT                   AYTPQGYNPHPRPYRPDYA"
FT   CDS_pept        complement(1213702..1215966)
FT                   /codon_start=1
FT                   /gene_family="HOG000183090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208717"
FT                   /orf_name="AFUA_2G04420"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL87535.1"
FT                   /db_xref="HOGENOM:HBG052664"
FT                   /db_xref="UniParc:UPI000051E5FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHS0"
FT                   /transl_table=1
FT                   /translation="MTSHVEMYFLYGEAYDETAPITRVEAWISQFAYADLTTGAALSFA
FT                   LVTLLGVMALFWEDLAPWISAVAKRLVSPILAVVAAASSLVMQLVSIRSRQELGTIVQG
FT                   WVKQPIVDCRLVRLVSAVVSWWFPSNQPLTTVCRLAGSFVCGMTAYVWLFFPLSQFLSG
FT                   FAGGLVTETKEMSLYCMGIHGRWTVASRLTWRQWGRVAFCNGEETGLELRAIIEDDWQL
FT                   PRLFDLDGEIHHLRILAFVVASVSLAITAAWSFRALSETALFARVVVVFQQPSSPGQRA
FT                   DHVAGSETQLSGSSINRRQDDLMNLISRYEGILSEKERLLSATTQKLRATEQRLEDGWA
FT                   QAKRLAALHVKRDEETRARESTDVAQLRRKLAETEARLSLAHGRARAVEDDATARVRSL
FT                   CNQVAELEQQLQAQREQAGDISLGEVHSLRAELEVRNDQLVAVEHRLAAAETRERDSRG
FT                   RANDSEAERRQLADRVHELDAQAQELTAQNEVLQALCDSLSRECGSLAAIQRERDNAFG
FT                   LISALQHELVSTRATAETAFRESQESLAQTRAAESTLRQSMQELRHTCDLTLAQERAAS
FT                   ARAQARASELGAEVEDLQTKVGLAMRDAQRAQERAESAERTIGILQTRLTRHEDAARGA
FT                   LQEIPKRQIGNLGSISTALAESEVKVAQQQAEINALRCQVEQFKLQGPSGPIDKAVQED
FT                   VQKLRAALDRVRRERTEDQLRWDKRVRELEEDNRKLRVSLSNAEAASGRRPGGRRPPTL
FT                   P"
FT   CDS_pept        join(1217827..1218108,1218192..1218405,1218477..1219146,
FT                   1219203..1220226)
FT                   /codon_start=1
FT                   /gene_family="HOG000183089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268323"
FT                   /orf_name="AFUA_2G04430"
FT                   /product="DUF21 and CBS domain protein (Mam3), putative "
FT                   /protein_id="EAL87536.1"
FT                   /db_xref="HOGENOM:HBG058849"
FT                   /db_xref="HOGENOM:HBG396759"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniParc:UPI000051F694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR9"
FT                   /transl_table=1
FT                   /translation="MAIPSANRYLALRPVVLGLAKLFLLASTQIPLISAAPTLVSRNGN
FT                   GNQHHVLGGHEFDPKPADDPKFWLYLGVAAALVLSGGAFAGLTIALMGQDEVHLQVIKS
FT                   SGDKSEQKNAASVLRLLKKGKHWVLVTLLLSNVITNETLPIILDRSLGGGWPAVLGSTV
FT                   LIVIFGEIVPQSICVRYGLPIGAWMAPCVLVLMYIMSPVAWPVAKLLDRLLGEDHGTIY
FT                   KKAGLKTLVTLHKTLGEAGEQLNSDEVTIISAVLDLKEKSVGSIMTPMEDVFTMSADTV
FT                   LDESTMDLILSQGYSRIPIHAPDNPLNFVGMLLVKMLITYDPEDCKRVRDFALATLPET
FT                   RPETSCLDIVNFFQEGKSHMVLVSEYPGEDRGALGVVTLEDVIEELIGEEIIDESDVFI
FT                   DVHKAIRRMAPAPKSRVPKGRIVEEPPMLTLESTGPLLETDGQSRMPSVDRRRSSVEAP
FT                   PPRFHMRLQTSDKNSDSTDGFLTHRGTTDEIREHLKHLGPSNLASRPRQTRYQNVKIKR
FT                   ASGSPSRSGHTDMDSGHSTSGSQVVNNTSSGLTGGIGAGLLHSGIDARDGVQAVKLGYG
FT                   TMNHRTSDNGAVELDIPEAVHEEQDDKPPSTSVATSTTSSNRPEDRARLGSSYLHKGPA
FT                   RSGSITEQVVDVNGIRKVILHTTSSNTSSDDERSSNNQAKFPVRQDGQLINLDDDQSAP
FT                   AAQPNGHKKKKRRRKHKSRTKNSDGPPDEEAPLLS"
FT   CDS_pept        join(complement(1222068..1222156),
FT                   complement(1220799..1222014),complement(1220699..1220716))
FT                   /codon_start=1
FT                   /gene_family="HOG000183078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268324"
FT                   /orf_name="AFUA_2G04440"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87537.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202432"
FT                   /db_xref="HOGENOM:HBG738425"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI0000520019"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR8"
FT                   /transl_table=1
FT                   /translation="MSSLPYTCNTCLVAFRSSDAQRDHMRTDWHLYNMKRRVASLPPVS
FT                   QEIFNEKVLAAKATSTAAAAKASFEKSCLACQKTFYSENSYQNHVKSSKHKAREARMSK
FT                   DLADDSSSVMSSTFSLGEPINKSQEGDSEVAKVADNLKTSTIEEEEEEEIEDESEYSPS
FT                   RCLFCSHKASDPQENTEHMRRSHGMFIPEKDYLVNLEGLIHYLYRKINENSECLYCHAI
FT                   RNSPAGIRTHMRDKGHCMIAFETEEEQIEIGQYYDFRSTYSDDEAGSVTSETPEDGGVK
FT                   VTSSDGDDDGWETETSASSLDDDEDDDFDSHRKAAVVYQTEYELHLPSGKSVGHRSLAK
FT                   YYRQNLHNYPSMEERIARQLAIENGEVEEERPRGRNPTRALVTRANGGLGMLGATEDQK
FT                   RVAVMSERKDRTRAIRQELRYRDRVNRAANNQKHFRDPLLQ"
FT   CDS_pept        join(1222856..1223049,1223128..1226824,1226877..1226999)
FT                   /codon_start=1
FT                   /gene_family="HOG000183057" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268325"
FT                   /orf_name="AFUA_2G04450"
FT                   /product="HECT domain protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL87538.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG052666"
FT                   /db_xref="HOGENOM:HBG326011"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI000051FB85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR7"
FT                   /transl_table=1
FT                   /translation="MTRLRGASVGSYDAGVDRSQFHRSKLPSNAPDIIVQNTIDVSDPA
FT                   QVLLWYREERRRQFNLLVRKYKNQLLHGCQDPDCRTPTCASYRRRVSEGPYRRYTELSA
FT                   RTLACYLASLDNPESGLCRNTQRLSSELSSHDHPRSSRRSSRGALTDLTEARSPSSVSS
FT                   RRTPGDLPADRALLNQDTASAKPSDNTRIGSDSYTESRQQNVSAPVDGDSATQRMKDPK
FT                   SFTQNLFDTLSLRMVEWLPLRRSPDVLDSDADRLGNQYVRSPKREGCEHTDTTVGSTCA
FT                   KRRANLKNKSARVAPHTPSSQDASRRVPRVESKPEHQVKRISLIETDQHQQSPRTVKEG
FT                   KSRLDLRPSRKLSYNSHLETDASVNIPSPPALKHRPQKHRGRNEHLDGSFTQAQRKKKE
FT                   RRVSWDSAKFLNDTQNQDAEKPLAARDSHLASETQSSNDDQLNFKSPYEKVERPLTVQT
FT                   LSHLNSAIIDGLARMMVQSDEEAQRWRDELRYIESTGNFENPEWQFATWRQRRVYIFLA
FT                   QSVFYALGSTKQILRSFREETAGPEQDYSKSKLDLQQLQPSLSKLFSFCPWDIALHSLW
FT                   RAVEALFMPSKELSMPGRLSRRSSNNSTSMGPSSMPIVGRRTCDFEGHEHLADAKAADI
FT                   ATVAFFALTSSLPQVDSHTWRSLLQMRALGTVASSADMEKLSPTMAQSIVELTDKLEHE
FT                   LALRLVNRLVRALTARLAFYEISKARHPCLQDFSKKRQDSALDLLMNNLGDHYSLVRAG
FT                   TDESDGAEPPPSAAVIIAEWLRTLFLKEWDGNPEISRSSSAGGVVEILSRMYKQRNRLG
FT                   LVPEDFHTPFLCERLEPLDMPVEWIGRLTNNKTLHLLSYSFLFPPSALVIYFRALNYAA
FT                   MSKYYEAAMTTSRHVNQTAFGPIPIQDDVMLLSQMKTSMSTYLVLMVRRDNVLTDALNQ
FT                   LWRRERRELMRPLKVQMGMDEGEEGLDHGGVQQEFFRVLMAEALNPSYGMFTMDARTRI
FT                   SWFQPCSLEPLYKFELLGLLMSLAIYNGLTLPVNFPVAFYRKLLGLKVKHLEHIRDGWP
FT                   ELTKGLELLLSWQDGDVGDVFMRTYEFTFEVFGAVETVDMEKVGRDAVWPLRARDRSKS
FT                   SELATNWSELSQHADPADLSPPCSMSADHVDFLECGSSHRSKSERLDYCVPTPPVEEAS
FT                   LVTNDNRAQFVKDYIFWLTDKSIRPQFEAFARGFYTCLDRAALSIFTPEAFKTVVEGIQ
FT                   EIDLGELERHARYEGGFGPHHRVIQDFWSIVKSFSQEKKAQLLEFVTASDRVPVNGIAS
FT                   IMFVIQRNGVGDARLPTSLTCFGRLLLPEYSSKSVLEEKLNKALENARGFGVA"
FT   CDS_pept        join(1227745..1227780,1227837..1228181,1228231..1228390,
FT                   1228443..1228732)
FT                   /codon_start=1
FT                   /gene_family="HOG000183046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057411"
FT                   /orf_name="AFUA_2G04460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87539.1"
FT                   /db_xref="HOGENOM:HBG052667"
FT                   /db_xref="HOGENOM:HBG326010"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000051E853"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR6"
FT                   /transl_table=1
FT                   /translation="MPPVVHCVRHAQGVHNLSTANHVIHDPSLTDLGNEQCRILRDNFP
FT                   FHDRIELITASPLRRTIYTAYQSFQPVLEKHKDMKIVLLPDVQETSDVPCDTGSDPEVL
FT                   RKEMEEQGIPVDMSLVQEGWNSKTGRYAPTNEAIKNRARAARRWLKERPEKEIVVVTHG
FT                   GFLHYFTEDWEDSSLYQGTGWGNTEYRSFVFSDETHKDDLEGHPLDGDNATMVETMESR
FT                   HRRGKDGPMLDRERQRTLYKLGTQGWDDQGLQLSTAEREHATVPEGKEVEGVRV"
FT   CDS_pept        join(1231100..1231121,1231194..1232641)
FT                   /codon_start=1
FT                   /gene_family="HOG000183035" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268326"
FT                   /orf_name="AFUA_2G04470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87540.1"
FT                   /db_xref="HOGENOM:HBG052668"
FT                   /db_xref="UniParc:UPI000051EA94"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR5"
FT                   /transl_table=1
FT                   /translation="MLDENLPTFYLRPNSQQKHLWTIYICQHGDDPEPAYTLRYPDPAS
FT                   PSSKNRYAVALCDPFVPDVVYGEVLIIPEWTQPSLSAEAIRLNGGVTPPPEAILPSQFI
FT                   VQLYNPDQQVTIRYKHKTWNTPATWEFEMPQHTFRQPSASTLDRTQTDPALADTTPKLR
FT                   FSWRKDSKLSKDLTCLLLGKTSTLPEGRTKSKEPDITVSIFKALRELTLYEPNMYRVEM
FT                   EDFKGLEIVLLLGAVTIRDVYFTPMKDAFRIVRDEVGRKPVADPTGSPVNVSASPTVQS
FT                   GAALQNQKPAAVAPNAKANDKQPASSRPAETQVTKPSPTPAPAQAPAPTQQQKTKKQEL
FT                   SRKEEEKRTKKRLEEEEKARRKRQAEIDKETRRLQKIYGREEQQVRASSVNLARPPAQP
FT                   PRPPAPPRQQQPHPPPRPNARYYYHQQAPSMLHLTPGPVATPPRPHSTVHSLQPPQPQD
FT                   QGQQPPKKSSFFGFRRSSDDSKVHKKRSSMF"
FT   CDS_pept        join(complement(1233108..1233910),
FT                   complement(1232732..1233047))
FT                   /codon_start=1
FT                   /gene_family="HOG000292007" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904143"
FT                   /orf_name="AFUA_2G04480"
FT                   /product="Xylosidase/arabinosidase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL87541.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG052669"
FT                   /db_xref="HOGENOM:HBG326006"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="UniParc:UPI000051FB86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR4"
FT                   /transl_table=1
FT                   /translation="MKTPPIPIHILTLTLISTTLTSAATPTLQSPLESPDNNALNNSLN
FT                   MNPKTGNPIIQGWYADPEARIFDTTYWIYPTYSAAYESQTFFDAFSSQDLRTWTKHPRI
FT                   LEFGGIPWSTNRAAWAPSVIRRPASPTFPHTDDAAAQGEKNGHGYDYFMYFSAGDGAGI
FT                   GVAKSTTGRPEGPYADALGKPLIPSTVFGAEPIDAQVFIDDDDDDDDDRVWLYFGGWGH
FT                   AVVVELGSDMVSLKGEYLEITPKGYVEGPWMMKREGVYYFMFSVGGWGDDSYGVSYVRG
FT                   ESPTGPFSAEPVKILSGNATVGTGTGHNSVITPDGKDYYIVYHRRPVNDTERDHRVVCI
FT                   DRMEFDAEGNILPVMITTEGVDARALDQPKPV"
FT   CDS_pept        complement(1234140..1236047)
FT                   /codon_start=1
FT                   /gene_family="HOG000136693" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268327"
FT                   /orf_name="AFUA_2G04490"
FT                   /product="D-3-phosphoglycerate dehydrogenase "
FT                   /EC_number="1.1.1.95"
FT                   /function="NAD or NADH binding"
FT                   /function="phosphoglycerate dehydrogenase activity "
FT                   /biological_process="L-serine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87542.1"
FT                   /db_xref="GO:0004617"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG453194"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR015508"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FB8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR3"
FT                   /transl_table=1
FT                   /translation="MLSAKQPPPKVLVPEKLSPDGLALLRASLEVDERRGLDADELLQI
FT                   IPEYEALVVRSETKVTANLLRAAKQLKVVARAGVGVDNVGELAQPPLPPSPSLGSWPLT
FT                   SHRTDVEEATKLGIVVVNSPSGNIGAAAEHTIALLMAMARNIPEACSSLKSGKWERSKF
FT                   VGVEVKGKTLSIIGLGKGELLAIWGRGIHFRYDGGSSGWADRQTVGLTVARLAKGLGMH
FT                   VNALDPYASPAVAASASVTLVSSLSELLPTADFLTIHTPLIASTKGMISTAELAQMKPG
FT                   ARILNVARGGTIDEAALLESLESGHLAAAAIDVFTTEPPQPESTAARLVAHPRAVVTPH
FT                   LGASTVEAQENVSIDVCEQVLQILNGSLPRSAVNAPLILPDEYRKLQPFVRLVEKMGSL
FT                   YTQHYASTVGGSMTRNTFDLIYHGEVAGISNTRPLFAALIKGLLAPISGSEGININIVN
FT                   AELVARERGIFVNEQHSRDPADHSYSYSSLVTLVARPPSRASSRAPAPDATSQTGPNPH
FT                   DQRIISGTCSGDQPLINRLGRFETSFVPEGTLLICENYDSPGKIGAVGSLLGQERVNIN
FT                   FMTVAPVSRKLAFASGATDDGGSKHEALMILGIDKVVDQRVADGLIKGGGVLSASVISL
FT                   "
FT   CDS_pept        join(1236685..1236823,1236902..1237056)
FT                   /codon_start=1
FT                   /gene_family="HOG000048360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268328"
FT                   /orf_name="AFUA_2G04500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87543.1"
FT                   /db_xref="HOGENOM:HBG052670"
FT                   /db_xref="UniParc:UPI0000520236"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR2"
FT                   /transl_table=1
FT                   /translation="MKEQKNKDMWGTGHITSVAILVDMAQADSIAESTADSRQRTEARG
FT                   PTLPAIVSPVQNQKRPSTDQRSVDAGSYIPSKESRAEKRANHQASTTRMMLF"
FT   CDS_pept        1237692..1239314
FT                   /codon_start=1
FT                   /gene_family="HOG000217562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268329"
FT                   /orf_name="AFUA_2G04510"
FT                   /product="Cysteine-binding protein FliY, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87544.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052671"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E3A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR1"
FT                   /transl_table=1
FT                   /translation="MVGVPHSTGCSLCRERRIKVGDSSPTSRFNPTERNKCDEAVPQCS
FT                   QCRKYGRPCPGYRRTFRFQDEGPALQRRHQSRSQSRRRPETATDAATAAAAAVVRNNAI
FT                   AMMRQTRSEDPCSSSAAAAAAAAQSQTHLHQMQLQMQMQLQQPHLFASFLHSAFPTLYT
FT                   SNIFRAHNRPDFLAHVASSYASGAAPYLAATLACLTSIYTAQFSPDPAQHTRRSRQLYA
FT                   HALTHVVAALHSPAALSAPLLATIMMLAVYEMYARTSPDAFVVHVDGVRRIMLARGPGL
FT                   HFPDDKDKDTDTDNNNNNNHPPASAIADAADADADADADASGEGPGFARGCYIAFRGFL
FT                   VATALYEGRACFLDEEDWLRFAGRIRAEDVRKAGRDARVVDVCERIWMEVVRCPRYFAE
FT                   ALPEGRPGTVPEGVDAGLDEGLDEGLAARVRATWSRLVRLVDELRVVLGGSGRGREETG
FT                   PGLLLQGAEDMVAALESLLVWLRGGSGRRRRRGGGGGFRVVSDFQRGVSSASSEALPVT
FT                   WLDRVASSMGVIGLKVIWEDSIS"
FT   CDS_pept        join(complement(1240548..1240948),
FT                   complement(1239416..1240481))
FT                   /codon_start=1
FT                   /gene_family="HOG000243335" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208718"
FT                   /orf_name="AFUA_2G04520"
FT                   /product="Fe-containing alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87545.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG250366"
FT                   /db_xref="HOGENOM:HBG742415"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniParc:UPI000052025C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHR0"
FT                   /transl_table=1
FT                   /translation="MTSIRVAPSAAKRALNLLRTVQYTHPPSCPCHSNPNHHHHLQSNH
FT                   VRRLATPVDPSRQKEYAFEMAASSIRFGPGATREVGMDFANMKAKRVCIVTDQNVAKLD
FT                   AMKQAVEGLSKEGIEFTVYDKVRVEPKDSSVKDAIAFAKPYNPDAFLAVGGGSVIDTAK
FT                   LMNLYTVFPEADFLDFVNAPLGKGLPVTKALRPLVAVPTTAGTGSETTGTAIFDLVSKK
FT                   AKTGIAHRNLKPTLGICDPLNTRTMPSAVHASSGLDVLCHSLESWTAIPYNERTPRPTN
FT                   PINRPAYQGANPISDIFSLQALRSTVKYLPRAVRDPDDFEAQSQMLLAATLAGVGFGNA
FT                   GVHLCHGMSYPISSQNPGYKHAGYDVDHPIIPHGVSVAVTAPAVFRFTAASNPDRHLAA
FT                   AEAFGVDISNVKRESAGEVLGEALAKFLADLGDQPRGLKDLGFKHSDIESLVEGTIPQK
FT                   RVLMLAPNLSGELERERDELRGLLEQSMEY"
FT   CDS_pept        1240969..1241163
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268330"
FT                   /orf_name="AFUA_2G04530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87546.1"
FT                   /db_xref="HOGENOM:HBG052673"
FT                   /db_xref="UniParc:UPI000051E600"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ9"
FT                   /transl_table=1
FT                   /translation="MMMMLLMKRTKKKKTKKKGVRRWPSAGKGKGNGISKYLFIRIRLG
FT                   LLAECRDEMRISRSNERIR"
FT   CDS_pept        complement(1241531..1242064)
FT                   /codon_start=1
FT                   /gene_family="HOG000161332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268331"
FT                   /orf_name="AFUA_2G04533"
FT                   /product="Bys1 family protein"
FT                   /protein_id="EBA27316.1"
FT                   /db_xref="HOGENOM:HBG324021"
FT                   /db_xref="InterPro:IPR006771"
FT                   /db_xref="UniParc:UPI0000F51808"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U0"
FT                   /transl_table=1
FT                   /translation="MHLNLISLTLCLSPLALALPPHSLLRKPPMTPNTNQTVGHALVHN
FT                   TCTSPIYLWSVGSTIGPQSAVSPNTTYTEVYRRDPASGGIALKITRVADGLYTAAPQMV
FT                   FAYNLVGEQVWYDLSDVFGDPFLGSRVRVEYRGLAGEAEDEAKKSIEWADGMSPGGSMV
FT                   RVAGAEGDLILMVC"
FT   CDS_pept        join(complement(1243095..1243904),
FT                   complement(1242349..1243032))
FT                   /codon_start=1
FT                   /gene_family="HOG000175484" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268332"
FT                   /orf_name="AFUA_2G04535"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27317.1"
FT                   /db_xref="HOGENOM:HBG554130"
FT                   /db_xref="UniParc:UPI0000F5182A"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9U1"
FT                   /transl_table=1
FT                   /translation="MPGRGLLRLTAGWALLSLCVAEDTWPYMTLQTALYQPPQIQVTKS
FT                   GTTDPGYLFVGPRGNKPEGTAALIYDEDGHLVYQGPDEVTANFRVQRLFNQDVITFWAG
FT                   NMTDLGFGYGTVHILDNTYREIYTVTLQGNFVTPDHSVPESFIDLHESHISDRNTLLVT
FT                   AYNVTQQSLTSIGGTPEDYMLDSLFFEIDIATNEIVHSWSALEHVDQIALTDSKQGIDI
FT                   DHGTHEQPWDAYHINSVELFDEGYLVSLRHYWSGYYVHGNGTVMWQFSGELGKGDFQLD
FT                   PAGVFSWQHDMRIYNKTDTGMILSLFNNANTPTETVAASTGLSYAVDLVNRTAKTLRTL
FT                   SDSKDVIHSVSQGNYQQLSASGHVVLGYGSIAKLKEFDANNKPVLTAQFGTDNEVASYR
FT                   GYKCAWKATPFWAPAIVVRRVSDDSAQVFMSWNGATEYDNWAVMAADAPDSVRTSIVAT
FT                   FKRTGFETSGTVRGLKTRYLQVVARRGDIPLGMSPIVSL"
FT   CDS_pept        join(complement(1245308..1245756),
FT                   complement(1245029..1245245),complement(1244675..1244956))
FT                   /codon_start=1
FT                   /gene_family="HOG000183024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268333"
FT                   /orf_name="AFUA_2G04540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87548.1"
FT                   /db_xref="HOGENOM:HBG052675"
FT                   /db_xref="UniParc:UPI000052024F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ7"
FT                   /transl_table=1
FT                   /translation="MSTSDRISRPTNPDGLVLEAWGQGLMLGCLLVMASVTFVNMKKHI
FT                   LLHKLILVELILAMPNGTFIFPKDPVYGWYQSVTAVGLNISWSLHNVIAWMKNRPFMSR
FT                   KVSLFYIGTVILAQPYWVLEIYANFAYFNNYNKIFLTTRPLEPIFRDPWWIFTTCSLFY
FT                   TIKREYNFGIVELVSVSPRFGIMLASMCLSIAFMIVDTCSVLNVFSHSSLPTGIEPFWK
FT                   LSFIFKCLCDTVILDDFKTALDRMRAYWLRKRNMGGEILLTGEHRHQHHRMEGSGRSRP
FT                   TDEDIEALTGNGGDRRKSESLPKVYTREHIRGVK"
FT   CDS_pept        join(complement(1248678..1248771),
FT                   complement(1247260..1248572),complement(1247128..1247229))
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208719"
FT                   /orf_name="AFUA_2G04550"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL87549.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG052676"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000052000A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ6"
FT                   /transl_table=1
FT                   /translation="MGKRLGLLRAIYLVSASCMGSFAFAFDTGVISGVLTLESFQRDFR
FT                   YTQAQKTTVNSNAVSILQAGAFFGCFFTTPVASRLGRRTGLIISSLVFTLGTILQVINT
FT                   HTLGTFYAGRVIAGVGIGAATVLIPMYAAEMSPKEVRGRLGACFQWFFACGVMVAYWVT
FT                   YAVSKDQPSATKQWQIALGLQLLPSTLLLAGMCTVKESARWLAAQGRTDAAWDSLRWVR
FT                   GGEETADLRQEFDEILTGLQEEARVRENWTWRELLLPANRYRIFIAVTIQLCAQLTGNT
FT                   SLAYYATQIFAAVGAGTSAKLVTGFFGVVKVVGVSVFQLLVMDRIGRRVPFMVGAGAMG
FT                   SFMLIIACVLATHPTKASPGGAETGATTHAGIAMIIMTYAEAFSFNMSWGPLPWLYVGE
FT                   IFSSRTREVGVTVGAASQWLFNFMMSQVTPHAIENIGWRMFLMFAIFNYSIIGYSWFFL
FT                   REVSFPSVLVLTSRHSLEEMQNVFGGRPREKSSTDETEPSAKPA"
FT   CDS_pept        join(complement(1250953..1250992),
FT                   complement(1250034..1250899))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752019"
FT                   /orf_name="AFUA_2G04560"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87550.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F44E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ5"
FT                   /transl_table=1
FT                   /translation="MPDLSGKVIFVTGGTAGLGAATVLHLAKHTHPPAHIYISGRNAQR
FT                   ADDLIKQVSASNSATRLSFVPCDLASLASVNEAAEAVLRRSSRLDILMCNAGIMAQPPS
FT                   LTKDGYEVQFGTNHLGHALLIRRCLPLLQRTAEESSDARIVILSSLAFRGHPHGGIVFS
FT                   DLKTVQHFTACALGPWIRYGQSKLANLLYARELARRYPAITCVSIHPGVVSTGLVENQT
FT                   RGNRAFIYVTNIGQLMKPEEGAYNQLWAATARKEELVNGGFYEPVGVLGKLHRAAGDDA
FT                   LAEKLWEWTEGALGEYLEVV"
FT   CDS_pept        join(complement(1252513..1253016),
FT                   complement(1252311..1252447),complement(1251768..1252248))
FT                   /codon_start=1
FT                   /gene_family="HOG000217563" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752020"
FT                   /orf_name="AFUA_2G04570"
FT                   /product="BNR/Asp-box repeat domain protein "
FT                   /protein_id="EAL87551.1"
FT                   /db_xref="HOGENOM:HBG024217"
FT                   /db_xref="HOGENOM:HBG052677"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI000051F1D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ4"
FT                   /transl_table=1
FT                   /translation="MRFLRLLALAPLALAASVPRAKIPTYNAVTVFQPPADYNIPRVLY
FT                   ARTLELPNGDLLCTWENYSKEPPQVYFPIYRSRDHGQTWTELSRVQDQVYGYGLRYQPE
FT                   LFRLPERIGSFPAGTILMAGSAIPTDLSSTHIELYASRDSGVTWKFVSHIAAGGTAIPN
FT                   NGLTPFLTIRDSNGKLICYYSDQRANATHGQKMVHQVSTDLKNWGPVVDDVAYPTYTDR
FT                   PGMPVVAKLPNGKYIYTYEYGSFFGTDSYSFPVYYRISSDPENFLSAPHQRLVTTTGYV
FT                   PTSSPYVVWTPYGGVNGTIIVSAYSSSSVFINQALGEGPWREIPTGEPNAYTRSLRVLK
FT                   KDPKMILINGAGELNGENNKVTVTLLNLEEALR"
FT   CDS_pept        join(1253059..1253205,1253426..1253791)
FT                   /codon_start=1
FT                   /gene_family="HOG000048361" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268334"
FT                   /orf_name="AFUA_2G04580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL87552.1"
FT                   /db_xref="HOGENOM:HBG052678"
FT                   /db_xref="UniParc:UPI000051FDE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ3"
FT                   /transl_table=1
FT                   /translation="MIPGDCDNLGFIVDHREAHLVKSSSNRIMIRRKEYRKCGEDFIPP
FT                   ELSPVTSDAVSGSGGCAATAERLDLFNTRPRREEWMNDHHRSRPSCAISPWCVICSEKW
FT                   LGEMQVGFEEIEFIEVVSLDTTCGEVQEAESYCVPLGWSHWSVLMRGTQRGTRQDSIYG
FT                   SLDSLPV"
FT   CDS_pept        join(1254170..1254320,1254379..1254746,1254790..1254868,
FT                   1254922..1255403)
FT                   /codon_start=1
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752021"
FT                   /orf_name="AFUA_2G04590"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL87553.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F1C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ2"
FT                   /transl_table=1
FT                   /translation="MVTMQIPQTQTVALVSELGGKVEFDDNYPVPVPGQNEVLAKVLYT
FT                   GVCQSDLHTKNGTAAGADGNPITNIKRPHVGGHEGVGRIVAVGPGCGPGLKVGGLVGIR
FT                   FASRVCRRCEFCLAGTEQYCIRSTNHLHHEDGSFQMYIALDADYLTILPDDIDPQVIGP
FT                   VLCAGVTAYKAVLNANIRAGNWLVVVGAGGGLGHLAVQYAKAHGALVIGVDAGDKRDFV
FT                   LGLGAIEFVDFKSVDPVQRVHEITGLGAHAVVVTAGNAKAFAHACDMLRVGGTLSCVGI
FT                   PPGRPVLETPICTIVIKGLRITGNLVGSLKECMEAVELVRRGMVKPEIRVRPFRDLPQV
FT                   YEEMEKGDISGRIVLGVAE"
FT   CDS_pept        join(complement(1256316..1257109),
FT                   complement(1255803..1256256),complement(1255455..1255742))
FT                   /codon_start=1
FT                   /gene_family="HOG000217565" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268335"
FT                   /orf_name="AFUA_2G04600"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87554.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG052679"
FT                   /db_xref="HOGENOM:HBG326073"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E854"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ1"
FT                   /transl_table=1
FT                   /translation="MRRQLTKRACDECISRKVKCNGSSPCDTCLKTSKEADCTYLKPPG
FT                   RRGPKAKRYTSKSRSACDGSIGHAHTEEAAARTQSVENRPAIPADVHADTERDESLSSC
FT                   ISKTVLVYIVRLYQTFSYSVWPVVDADAVLQQLGNGTCDAQTLCLVLALCAATMAQLQL
FT                   APMAGDDGHMVDSSQLKSACMQLRERSDYRENLDVKGVLVSFFLHVYHAKINQRKSAML
FT                   FIQEAIASARLLGLDTNERNAVVTDGVVANREIVFVLLWVSERGYAMHLGVRPSYSDPI
FT                   QVPDAAQLAVDPHARGLLELFSLFATFDQIREQRCRSDSLAQAVSPSSLAETEAALSLL
FT                   AFNSDHQASTRLADCYITREWMRTIVWQEALSGHLLSSTATTEVMTFRFPVIVGRDLLV
FT                   SLHGLSEADLLPLGRDQLLKCFEVANSLADIILHTPPSSFSSAFEFGPPDFLHALYQKI
FT                   LPFLEHDPMLNSILRAKTAEALVMAPARLSVGLVARLDMEEEESISQQNDRVH"
FT   CDS_pept        join(1257611..1257643,1257701..1258234)
FT                   /codon_start=1
FT                   /gene_family="HOG000244036" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904144"
FT                   /orf_name="AFUA_2G04610"
FT                   /product="DUF967 domain protein"
FT                   /protein_id="EAL87555.1"
FT                   /db_xref="HOGENOM:HBG292275"
FT                   /db_xref="HOGENOM:HBG367719"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="UniParc:UPI000052070A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHQ0"
FT                   /transl_table=1
FT                   /translation="MDKPLGPTNTDIRELAAEESSAAVIFPSFTSTTAWSLGLALRDRI
FT                   LSLPADQRKPALISISLTGGSEPHVIFQCATEPGTVADNEVWVRRKRNTVLRWGVSSWL
FT                   MRNKMLASTGLSASEVEEAFVKKFALKSSSGGAADDFAIHGGAFPVRVRSVDGVVGVIV
FT                   VSGLKQEHDHQVVLEVVRDYIQNNA"
FT   CDS_pept        join(complement(1260532..1260682),
FT                   complement(1260272..1260467),complement(1259110..1260215),
FT                   complement(1258486..1259051))
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752022"
FT                   /orf_name="AFUA_2G04620"
FT                   /product="Hsp70 chaperone BiP/Kar2, putative "
FT                   /function="ATP binding"
FT                   /biological_process="response to unfolded protein "
FT                   /protein_id="EAL87556.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006986"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000051E855"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WHP9"
FT                   /transl_table=1
FT                   /translation="MSRLSSRNGAAKPFTAWTTVFYLLLVFIAPLAFFGTAHAEEDSVQ
FT                   ENYGTVIGIDLGTTYSCVGVMQNGKVEIIANDQGNRITPSYVAFTDEERLVGDAAKNQY
FT                   ASNPTRTIFDIKRLIGRKFDDKDVQKDAKNFPYKVVNKDGKPVVKVEVNKSPKIFTPEE
FT                   VSAMVLGKMKDIAEGYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRVVNEPT
FT                   AAAIAYGLDKTGDERMVIVYDLGGGTFDVSLLSIDNGVFEVLATAGDTHLGGEDFDHRV
FT                   MDYFVKQYNKKHNVDVSKDLKAMGKLKREVEKAKRTLSSQMSTRIEIESFHNGEDFSET
FT                   LTRAKFEELNMDLFKKTLKPVEQVLKDAKVKKSDVNDIVLVGGSTRIPKVQALLEEFFG
FT                   GKKASKGINPDEAVAFGAAVQGGVLSGEEGTGDVVLMDVNPLTLGIETTGGVMTKLIPR
FT                   NTVIPTRKSQIFSTAADNQPTVLIQVYEGERSLTKDNNLLGKFELTGIPPAPRGVPQIE
FT                   VSFDLDANGILKVSASDKGTGKAESITITNDKGRLSQEEIDRMVAEAEEFAEEDKAIKA
FT                   KIEARNSLENYAFSLKNQVNDENGLGGQIDEDDKQTILDAVKEVTDWLEDNAATATTED
FT                   FEEQKEQLSNVAYPITSKLYGSAPADEEDEPSGHDEL"
FT   CDS_pept        join(complement(1264242..1264467),
FT                   complement(1264104..1264169),complement(1263177..1263914),
FT                   complement(1262945..1263127),complement(1261686..1262893))
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268336"
FT                   /orf_name="AFUA_2G04630"
FT                   /product="Translation elongation factor EF-1 subunit,
FT                   putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="EBA27318.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG324022"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0000F51833"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9V2"
FT                   /transl_table=1
FT                   /translation="MSRLRVKNVSYDEDDYDDGYDSPDPEEQEILEQCTAEVLAQLLSG
FT                   EPSVTATRDEVQEALWHYYNDVEKSVNYLRGKKTKEMKKKQNPAPPVAAKGKVPAYPLP
FT                   PVASSPSSHFSAKDFFRDSPWLNVPAHRKGEILIEPLYPRLGLLGGAPESGGKVSKLAA
FT                   LAAARKKKETDKAASGAPTTPGEPGTPDRTPTVESKLASLSLRERLAGNGKAQKPSESG
FT                   QLPRTLRRGTPSESPLAQKKLSPEPSKAKSPEMIPGEPTTRKPCAGEEETERPKASIRA
FT                   PPSTFASTIVGANTRPQITEPSHLYSSTVDLMQIYGQDLTEPFDFAGPSPDDVVLNAQS
FT                   SAKGFKSKQPASKSAGDKKNQGDLAGGMNNLSVQEKVAVKSKNLDVLSEYHKSQRKRAM
FT                   NFAVIGHVDAGKSTLMGRLLADLKAVDQRTLERYQREAEKIGKGSFALAWVLDQGTEER
FT                   ARGVTIDIAMNKFETENTVFTIVDAPGHRDFVPNMIAGASQADFAVLVIDSGTGNFESG
FT                   LRGQTKEHALLVRSMGVQRIIIAVNKMDAVEWSRDRYEEIEQQISSFLTTAGFQAKNIA
FT                   FVPCSGFRGDNVTRRSDDPNASWYTGRTLVEELEATEPYSYALDKPLRMTISDVFRGGV
FT                   QNPLSISGRIDAGSLQVGDQILTMPSGETATIRSLEVDGEPNDWAVAGQNVVLNLANID
FT                   PIHLRSGDVICRPSAPIANITSFTAKVLAFDHLMPSMVDIHRGRLHVPGRISRLVATLD
FT                   KGSGSVIKKKPKIVPPGSVARIVVEMDQAVPLEAPTRIVLRSGGDTVAAGLLE"
FT   CDS_pept        join(complement(1268625..1268753),
FT                   complement(1267267..1268564),complement(1266096..1267193),
FT                   complement(1265102..1266044))
FT                   /codon_start=1
FT                   /gene_family="HOG000230585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752023"
FT                   /gene_name="pan2"
FT                   /orf_name="AFUA_2G04650"
FT                   /product="PAB-dependent poly(A)-specific ribonuclease
FT                   subunit pan2"
FT                   /EC_number="3.1.13.4"
FT                   /function="nucleic acid binding"
FT                   /function="poly(A)-specific ribonuclease activity "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL87559.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0004535"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG059316"
FT                   /db_xref="HOGENOM:HBG735259"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00005204A2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHP6"
FT                   /transl_table=1
FT                   /translation="MEADWDELSRIPVPPPSPHGLPTVATTIAFDDVSELLWAGNEFGR
FT                   ITSFYGPELQRYTSVRAHPVSDGPVRQILFHERGVISLSPKSVHMITRRGLTQWHISHE
FT                   EMTDLYCMSFTAQLNKIIVAGCQRAMFTIDIDKGIIVDKLHTDHNYTMMKKSRYLCAAT
FT                   DTGSVNALSLTDFRVVKSWKSHGTAINDMDARNDLLVTCGFSVRHLGSPIVDPLANVYD
FT                   LKTLSPLPPIPFHAGAAYVRMHPKLSTTSFVASQTGQLQVVDLMNPNAINLRQANVSFM
FT                   LGIDISPSGEALAINDAECSIHLWGSPSKIHFNEMSKEVEFADVVPRPPPLDWSPDTPL
FT                   NMIGMPYYRERLLSAWPSHLVFEVGSPPAPIDQSLIPYLRPAEMGHYAPNPKKTRRYQV
FT                   ENTRALTTAEPALIAPKFLSEKAREQSKFKSEASVSDTAEALAGAKLNGEAEDDPLLKY
FT                   SNVEIKYSRFGVDDFDFSFSGLETHIANSFTNALLQLLKFIPLVRNLALHHAASTCIYE
FT                   TCLLCEMGYLFDMLEKANGQNCQATNLLKTFSSYREASNLGLLEENLTTKSLSSAIQSV
FT                   NRFFLNQIAHDFRMIVPSSDDLDHRLSTIASESIRCMFCQNEIVRPGNSLANELIYPTI
FT                   DIKQARRNPAFRFSSILRASIERETQNRGWCNYCRRYQQVTIRKSIHRMPLVLILNAAL
FT                   SNAICRRLWSIPGWLPEEVGIAVDNGQVMCFEGDELKTQLQNKLPNLVVYELVGLVSEI
FT                   DIPEHQKPHLVSFINVSISSREPEAKNRWHLFNDFLVTEVDKDEALRFNQPWKSPCILA
FT                   YQVKDARHAVDDSWKNVLDTTLLFRDWSLNGGRAVETRQTLTEEEKPTPGTPVALDTEF
FT                   VDLEKAEIDVKADGSQEIVRPSKSGLARVSVLRGSGVHEGVPFIDDYITIKEPIVDYVT
FT                   QYSGIKPGDLDPRTSQHNLVPLKVAYKKLWLLLNLGCVFVGHGLASDFRKINIQVPKSQ
FT                   TVDTQYLYFHPGKNRRLSLRYLAWAVFKEYIQEEPADNNQGHDSIEDARMALRLWKKFQ
FT                   EYEDAGIVNQILEEIFREGSKLGFRPPPRNGVATVLSRPGTAVTMQNSSGRNTPSTPDV
FT                   GGAATATATTSAPATPRQAFRRSIALTPSNGTFSGPGAGDFFGGSPLK"
FT   CDS_pept        join(complement(1271616..1271655),
FT                   complement(1271474..1271523),complement(1271376..1271410),
FT                   complement(1271233..1271308),complement(1271071..1271169),
FT                   complement(1270896..1270959),complement(1270225..1270836),
FT                   complement(1269395..1270173))
FT                   /codon_start=1
FT                   /gene_family="HOG000048362" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268337"
FT                   /gene_name="hse1"
FT                   /orf_name="AFUA_2G04670"
FT                   /product="Class E vacuolar protein-sorting machinery
FT                   protein hse1"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="EAL87560.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="HOGENOM:HBG052682"
FT                   /db_xref="HOGENOM:HBG735279"
FT                   /db_xref="HSSP:1GCQ"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013315"
FT                   /db_xref="UniParc:UPI000051F6AA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHP5"
FT                   /transl_table=1
FT                   /translation="MFRAQQNAFDDAVAKATDENLTSENWEYILDVCDKVAAEESGAKD
FT                   AVAAMIKRLAHRNANVQLYTLELANALAQNCGPKIHRELASRSFTDALLRLANDRMFAN
FT                   NPDFGIMEQAYMKLKTQNPNLQPPSKPGKREITEADRQKEEEELQMALALSIREKPSAA
FT                   PEPKAEPSTSVSEPASQTQTATSQAVPPGTSAATVSRVRALFDFQPSEPGELQFRKGDI
FT                   IAVLESVYKDWWKGSLRGQTGIFPLNYVEKLPDPTVEELQREAQMEAEVFGQIKNVEKL
FT                   LTLLSTRSSELNVQDNEEITSLYHSTLSIRPKLIELIGKYSQKKDEFTQLNEKFIKARR
FT                   DYESLLEASMAHPAQPQYGRPGQAPYGYPGPAAPLGYPQGPPQSDPQRYFSPRPQDQTH
FT                   MYPPTSHSPDPRGRTPPAGPSFPQHQQPPPDSYQPVHHRPESTYDNPQELGTSVYDSPV
FT                   EHPSSSQRLPYPPSGAQVPPGVHQQFQHQQQEYPPSGYPPEDASKPPAAGFALQPPQQT
FT                   LQQPPYPTAPGAHQPTPSHQPPPVPSTASKPTPYPSLTPGTPSGGEYQAYNPSQAGAAN
FT                   SNPNSYYR"
FT   CDS_pept        join(complement(1273831..1275738),
FT                   complement(1273675..1273774),complement(1273287..1273621),
FT                   complement(1273126..1273230))
FT                   /codon_start=1
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752024"
FT                   /gene_name="ste20"
FT                   /orf_name="AFUA_2G04680"
FT                   /product="Serine/threonine-protein kinase ste20 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="response to pheromone"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL87562.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0019236"
FT                   /db_xref="HOGENOM:HBG052684"
FT                   /db_xref="HOGENOM:HBG324023"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000F51832"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WHP3"
FT                   /transl_table=1
FT                   /translation="MSNDGFSSLKFRRTSSKLQKDPPSVSSRILRSQQSNTSLKRHPSA
FT                   PVHPRSSVTGSREHSRTRSNAYGSSSSSLEQHSGGPSPVLAGGDSNNSFSSKSRPGRFS
FT                   FNTDPSSDELTGSPFDSRGMLSALEENTAESEKSPPPQPPTLRSYHTSPDSRGLRQSAS
FT                   FTALQNRMDTFTQKSENDQSTNTKRHSDEANGTKVFGRSKKSSFSSFVNSMLGSPRGIK
FT                   ISAPENPVHVTHVGYDNQTGQFTGLPKEWQRLLQENGISKKEQEEHPQTMVDIMRFYEK
FT                   NARG