(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_3

ID   ASFUM1_3; SV 1; linear; genomic DNA; GRV; FUN; 4079167 BP.
XX
AC   CM000171_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   3, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000171.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4079167
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 3"
FT                   /db_xref="taxon:330879"
FT   CDS_pept        join(complement(1275..2018),complement(400..1209))
FT                   /codon_start=1
FT                   /gene_family="HOG000234909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262076"
FT                   /orf_name="AFUA_3G00100"
FT                   /product="Flavin-containing amine oxidase, putative "
FT                   /EC_number="1.4.3.4"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86293.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053060"
FT                   /db_xref="HOGENOM:HBG327139"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI000051EDC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG34"
FT                   /transl_table=1
FT                   /translation="MVKPVETVDLSNTAGAYYAPATIAPAGRLIHIAGQPGSTKDGFVP
FT                   TDYESQIHLALLNLRKLIIAAGSSIEHIVKLNLFIVDYDAANRKHTRHIERFLAGHRPA
FT                   ITLIPVPKLAVPSWLFEIDAVIALPESSVPPVLPAVNETVDVIIVGAGLAGLSAAYDVV
FT                   RAGLSCVVLEARDRVGGKTWSTPLKDGKGVIDLGAAWINDTNQSKVYALAKRYGVELIE
FT                   QNTQGNAVLQDADGNCSPFPYGELPNFDKNTRAHLAKIRDMCEADCQALDTWRPKDTRL
FT                   DSVTFEAYLTSRGANEAALATATVWTRAMLGQDPKDISALFFLNYCKSGGGLLQMRSDC
FT                   KHGAQYLRVRQGTQAFSLGLASSLPEGTVRLSSPVQSVIQHADGTVKVQAGGTAYAGRK
FT                   VIITVPSPAMRTISFYPKLPPAKQAWVDSTTYGYYTKAMMEFRSPFWVMAGFCGLAQSF
FT                   TGPASVVRDSCSPEDRKYVLTCFMAGDPGRAWAALSTKERERSLLDQLAKLFGVANLGQ
FT                   "
FT   CDS_pept        join(2591..2699,2777..3146,3221..3855,3947..4208,4
FT                   308..4431)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262077"
FT                   /orf_name="AFUA_3G00110"
FT                   /product="Succinate-semialdehyde dehydrogenase, putative "
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, NAD or NADP as acceptor "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86294.1"
FT                   /db_xref="GO:0016620"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000520348"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG33"
FT                   /transl_table=1
FT                   /translation="MAVFNVHLRDPSLLVGLNYIDGKWVEAESQKRFDVTNPANGNVIG
FT                   SCPESDAKDAQKAIDAAAAALPAWRSLSGRNRGRILRRWYELVLENQEDLATLITMENG
FT                   KAKPDAVGEVLFAASFLEWFSEEAARLYGDVVPHSQPNFRVSVLKEPIGVCGLITPWNF
FT                   PAAMITRKLGPALAAGCTVVVKSAGETPFTANVLIKLSERAGIPAGVVNCVTALANTSK
FT                   IGETLCLSNVVRKISFTGSTRVGKLLMQQSSSTLKKLSLELGGNAPFIVFEDADLGLAV
FT                   DAAITSKFKSSGQTCVCSNRIFVQKRIYPEFIRRLKDAASRFQVGNGLDEKTSHGPLIT
FT                   SAAVERVAGLVNDAVSRGAKIEIGGKKIPDLGPNFFEPTILTNVTTDMPVVNEEIFGPV
FT                   APIFSFDTEDEVVSASNACDVGLASYIFTQDVTRASRVSELLQSGMVAINTGIISDAAS
FT                   PFGGIKHSGMGREGSKYGIEDYLQLKTVVTGNVNVIHKASL"
FT   CDS_pept        join(6667..6822,6879..7083,7198..7389,7449..7840,7
FT                   899..8315)
FT                   /codon_start=1
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055836"
FT                   /orf_name="AFUA_3G00120"
FT                   /product="Amino acid transporter (Mtr), putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86295.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG051937"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000051FA12"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG32"
FT                   /transl_table=1
FT                   /translation="MAEEKSKIRDDVEATEPIGHVPPQIRDILKGEDTTHDAVFGEVTE
FT                   AGPNYRNVGWLGTVALMMKTQIGLGVLSIPSVFDTVGMIPGVILLCIVASIAAWTSYVV
FT                   GVFKINHRQVYGIDDADWIFVAGSGILGISISLNAISAHGACTAVYVAVAAIIGFFLAS
FT                   IRTLGKISWIAWLGLACILTAILIVTIGVGIQKRPSSVSQVGPWSSDLRLINSPSFTDG
FT                   VSAVSSLIFACSATPAYFSIAAEMRDPRFFTRALIISQIGSTLIYLVIGVVVYYYCGSH
FT                   VASPALGSAGPIIKKISYGIALPGLLATTTIVIHLPSKYIFVRILRGSAHLTSNSIIHW
FT                   CTWLACTFGSTVIAYLIASGIPFFNNLVSLIGAFLGVILAYQPTGCMWFYDNWRKRDTG
FT                   NWKWILMACWNVFVILIGSFMTVAGTYGAIVNIVNSLAEDGGSKPWTCADNSNS"
FT   CDS_pept        join(13431..13686,13744..14099,14153..14384,14442..15750,
FT                   15845..16029,16069..17555)
FT                   /codon_start=1
FT                   /gene_family="HOG000217657" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262078"
FT                   /orf_name="AFUA_3G00130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86296.2"
FT                   /db_xref="HOGENOM:HBG053538"
FT                   /db_xref="UniParc:UPI0000F51C54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG31"
FT                   /transl_table=1
FT                   /translation="MERVRKTFFNPLATTKAQVEKILEGLPVGSAHPFSPEQLLLCRTE
FT                   NGIEEIDISSYPEDFFFNAVDLSETGEILLRRMAGFQSYLKVFDDFQIMQAPSSTFKVP
FT                   IVSDQITILAVSERTPTYYDFCFADESCNTCCWLARNTFPGITHSGDILNGQDLLDYVT
FT                   IIKDTLTEKEICVFISGYRSTLITRFLGTYPALLVADHVDKVLYIIPVPLDAATIGDAT
FT                   ICCPLVIKRDGDSIICSILPSATTDRGIMCNSNKLVSPAFPEAIKCADFTMRTPDLTAR
FT                   KTAPVNDSVVEDTASNSDNLRKVITKENAIFTTGSSALPPFIDLEKTQIIRFGTGLEFQ
FT                   LPDEESHMREEPSAIVLPCIFGTELQGPILLATGTVPSNVPFPNADALRDYYKQLKNAV
FT                   VIVDERMTDNARNLASAYRINALFIVRLTPETELKDTNNVISLMNSANINAVTALAGPQ
FT                   SLILVQISEKYYFYRGIANRAHLNTSGLAFGSDVTSVLESVGTGSILDPRIERVINLGG
FT                   VNSIVLPSTGQLVQPQDLQKLLEDISIDQIQNLEEDISAVVPQLQVLLNQKDLQELSRS
FT                   LVTALSAKISNAATPLRDSYTRFLTQEYRMEDPKSVQKKNQMFGELRKVTKDMQKALEP
FT                   VISCLANMMSSQTTSKRTHDLKRLIRQTTIQKNVEAVKSMTFETLMGYLEEYAGEMGVM
FT                   LLNIETTHYHQLLGNLKNSAIDASQCCALDSRILHLEGFDAGIIMEQSQAKHNGPLKST
FT                   LGPCQPILALPCLSQLSETGSMLAWVLRWIEKCNEPHIAALRIIMRSTLSQAVASREHD
FT                   IQPSSPETGHLMSALLMAAMSKLAAMRISKPVELDKAEDTVTKLMRGLFGNLLTIAGSG
FT                   VRPLSMVWQLFGTNPLYDLPTSSAEWIWYENVVALYPYTGWPLRQFHENLEKFLDKAVI
FT                   RVVTKNENVASIKASRMAELVKFCKLRNIQLAHSRTIITVFMRMLTAEDIDIQPVAAQL
FT                   LTQLPHKLERQSQSYTRMIRYLNHLAGGGERCVHDDLTAANVYTSRSAAFAELKKQVCE
FT                   ACKRSDWPRMKEACQEIMTKHIEIATLWRVKPESLKIQNMKLYKALLAADFDSLDQNTQ
FT                   AKNLQLTRYVFSDAETKRVPWQVGKKGQFGDSIEPLDEVFLHEIMTGEKSEPAPPATVN
FT                   EFPGEEKKAMIETEDEFAKFESSLRAEFIETMRKDLSAEEVCDIINVPVSTMRVFVRAL
FT                   NPEFIWEDLAVNFKGIILELVKDRSNRAESRPVRRLLRIKVGKNLQIEG"
FT   CDS_pept        join(18754..18795,18844..18946,19000..19856)
FT                   /codon_start=1
FT                   /gene_family="HOG000217658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207120"
FT                   /orf_name="AFUA_3G00140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86297.2"
FT                   /db_xref="HOGENOM:HBG053613"
FT                   /db_xref="UniParc:UPI0000F51C6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG30"
FT                   /transl_table=1
FT                   /translation="MIVGKSAPAVRGPRTWSPTHPSPSLFVDHAKPVPTASVVAIEDCP
FT                   DAVGVKLVWTRPNAVASSPRARLHRPLQLEIPKSYPQQIVRFLVHCMREFPIAFAHSRK
FT                   THFIHPDLYKSKMPTQIIAAYDLCKLHAQIDQGKGTGTATLGPRLRQQLINLLDQFRHA
FT                   KSFEELLACAQALILLQCIVLLRDDQNKYSDGVSCSLADLGHRLWQQAPFQLPHALSPR
FT                   RAWIYAESVRRTIIVGFMLRSVYSLQRRNYSIRTPFIDSLPFDVRTSLWDAPGQAWVDG
FT                   PSEADMVSLHEYSGMLESGQIHEITPFGSLILAACRGVAISEIPFPAALRPR"
FT   CDS_pept        join(complement(20549..20746),complement(19895..20500))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750537"
FT                   /orf_name="AFUA_3G00150"
FT                   /product="Short-chain dehydrogenase/oxidoreductase,
FT                   putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86298.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000520802"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG29"
FT                   /transl_table=1
FT                   /translation="MAFPYKNVLIIGATSGIGKALANKLVQNGIPTIIAGRRQGNLVDF
FT                   VQQHGTDKVKSKVIDVLQLDKIPQFVADVIDENPDHDCVFVNSGIQRPFDFSKPESVDM
FT                   DVFDQELITNYSSAVRLAKAFIPHLQRQSTAAIAFTTSQMALVPMKRCPNYGASKAALH
FT                   HFILALRTQLQDGPGNVKVIEIYPPAVQTELHDAKHQPDLKDGHLIGMPLCEFIEDVWC
FT                   QLCHGKEQVAVGSAREIFEAFEIKRQEVYYQMTEMLSKLLRQFLR"
FT   CDS_pept        complement(21644..22639)
FT                   /codon_start=1
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207121"
FT                   /orf_name="AFUA_3G00170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86300.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG053848"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniParc:UPI00005207E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG27"
FT                   /transl_table=1
FT                   /translation="MEEEFEGHYIHDVLSGVSAEMKKSAPEFNFYRDLHENQDRLTEFM
FT                   RQNATAQRKAWHLDKWKFLPAVEKALQAKPDAKWFMFMEADTFLVWSNLLKWLAKLDWR
FT                   RPYFLGQPVTMEGQLFAYGGAGWLLSRPAIQQMADHMASRNSEYEYFTNGTSFGDLILG
FT                   YVLEQAGVGLTGAWPLIQRETPSTMEYTRDVWCHPAVTFHHIDALEIKSIWDLEQRWIA
FT                   NMQGPLLHFDIFNHLIYPLLATKIVDWDNFSDGEEKFLTPNEGFADCKLHCEEDMHCMQ
FT                   FRFTPKKCTLSHSITLGWKADRSMDSMSGWMMERITQAIASVRCEGSKWI"
FT   CDS_pept        join(23780..23985,24065..24191)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262079"
FT                   /orf_name="AFUA_3G00175"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27267.1"
FT                   /db_xref="UniParc:UPI0000F51C72"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y6"
FT                   /transl_table=1
FT                   /translation="MKIVFPALLSLPIGALAGSAQWCHIVNSDVKVNCRAGPHLNSRVV
FT                   RTLSPGENLYFGCYKRGDCYKDNCTWDHQINPGGKGDCYVNGYFTDNHCTMGNTTYSLC
FT                   SCLSYC"
FT   CDS_pept        join(complement(26720..26761),complement(26397..26665),
FT                   complement(26014..26330),complement(25802..25897),
FT                   complement(25623..25687))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055837"
FT                   /orf_name="AFUA_3G00180"
FT                   /product="Short chain dehydrogenase (AtsC), putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86301.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F7BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG26"
FT                   /transl_table=1
FT                   /translation="MSVYVVTGVSRGIGFEFLRQISGDQKNLVIGLVRDKAATEKKIAA
FT                   ELGNRANVHILYADLTNYATLKQAAADAAEIVGERGVDYLVANAGLVPSLDAYGPIGAL
FT                   SDKVEELEAVSSQLWQTNVVGNIHLFHLFLPLVLKGKIKKVITISTGVADLDLTNDYEI
FT                   DTGALYAASKAAMNMIVAKFNAQFKKDGVLFMSISPGLVEVGRYTDAYAPHFKGPITPQ
FT                   ESVRHARSTWEKASIEGGSGTPHEIEVSHQFARFYVPWHV"
FT   mobile_element  28478..30019
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(32525..32716)
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   mobile_element  complement(33013..33543)
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   mobile_element  complement(33607..34281)
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   CDS_pept        join(37429..37462,37527..37619,37731..37779,37830..38029,
FT                   38086..38238,38293..38405,38464..38714,38768..38841,
FT                   38927..39113,39168..39344,39406..39631)
FT                   /codon_start=1
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902532"
FT                   /orf_name="AFUA_3G00200"
FT                   /product="Hexose transporter protein "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86303.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG190581"
FT                   /db_xref="HOGENOM:HBG327399"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51C4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG24"
FT                   /transl_table=1
FT                   /translation="MSPNVKWTDVPNNTHPIWYKDVGLRRNVALGLGLCLVIATNVNQA
FT                   SLLTGFQAMPSWQKYFKSPTGALLGIYAASYFLPSIFTAFIGDVISTKMGRRWCIIVAN
FT                   IIITIGCLVNTFASSVGMWCGGRAIIGAGVGIVKVAAPVLIQEISHPRLRPILGSCYQT
FT                   FAYIGIFFAAIMTFAGLYVPGDWGWRFPSLLQVIGPVAVIIVTMLCPESPRWLIKNGRE
FT                   EEAVGVLARLHANGDKEDALVQLEIKEIRTAIEREVAQRKASFVDFLRTRGNRRRLAVV
FT                   VALACSLNWMGNGIITYFLSPILKSVGITSAVQITLINSGLALWNLILAASAAVYCDKA
FT                   GRRPLFLTSVAGMLCSYVVVMGLSAGFANTKQSSLGIAVIPLLFIYFGFYDMAFTPLPI
FT                   AYTVEILPFTIRSKGMALFTSTATMGNAFNQFVNPIALKAISWRYYAVYIAILLFYFCF
FT                   IFFMFPETKRLSAEDAARVFDYNRKGAVMDNAGDDVEQGPVSPDNEKQESRSVVEVKDR
FT                   V"
FT   mobile_element  complement(40207..41505)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(41486..41749)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(42155..42915,42980..43480,43533..43695,43760..43922,
FT                   43976..44214,44278..44525,44593..44758)
FT                   /codon_start=1
FT                   /gene_family="HOG000217659" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902533"
FT                   /orf_name="AFUA_3G00210"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86304.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053198"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51C9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG23"
FT                   /transl_table=1
FT                   /translation="MTPSPRAVPEGSPSLDRVDRHNSTAAVHKRQFQKQRTQRATYACE
FT                   RCRLKKLRCTGGHPCGACRRAGIECDFGDRGLDWQQSLSLTNQRLLQLEKTVMELVSSL
FT                   GHLTHPPQEALPQSAFPQARQIVNSPSAQITRTAGPPDSFPARTNVAEPTQSHGASATP
FT                   ERIRTLSAHPVHSEGLDSRWAALKNNSAPFPPLMAHPTVWSGEPAKTVPAGDPNAQLAL
FT                   GMTHYEAEVDLQSEPVSRGIVDKQEARALFSLFFQKCHPLFPLLEPGKDLDRHFDHIRS
FT                   SAPFLFTAVLAVAGRYYTAYRDKLSSRSSLPPIAGSALAALADLAGAHLGFVLLRKQHQ
FT                   LSDVQATLLLSVWIPRGGGQSADQWMLTGLCTRLAYRIGVPDSFGCPAIIRLLSSSDLD
FT                   PNDIGEANSVLPQWHTWLLINQYDTWLSLGFGRPHPMPVVQPSPRQYLTAVRKLGPSAQ
FT                   VDSEAATYVTSLAELSAVAADLVSGLRTARLPPTPRQNIRQPAATAWSKISSLLSDLNP
FT                   RLDAWQRQWTWAGSYDAVMLGRYTDLVKIYGEHTRLCLNSLSLNLLTANATANSENHIT
FT                   ISCLEKACDAAVALVQYYVKSSDSEPIVRYGADYLVLILGQAAMFLVRVLVARLEHPLP
FT                   VDRRVLTHHLRTAIELLESNDMSTTGICGWVAQLGRELARYAGLALDSGEGDPTDANLT
FT                   GLDPSLPEIQWDFDICALLGQDIPAGETGLDLGHYFDFAQSFFPPPTDPGTL"
FT   CDS_pept        join(complement(46553..46811),complement(46337..46489),
FT                   complement(46158..46270),complement(45849..46099),
FT                   complement(45718..45791),complement(45469..45655),
FT                   complement(45230..45406),complement(44925..45171))
FT                   /codon_start=1
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262080"
FT                   /orf_name="AFUA_3G00220"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86306.2"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG190581"
FT                   /db_xref="HOGENOM:HBG327399"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG21"
FT                   /transl_table=1
FT                   /translation="MLLDDAGLLNGLQAVTSWNEFFDHPKGTILGLYAASLYLPSIVTA
FT                   YLGDFLSQRFGRRITLALGSFIVLAGGFINAFASSAGMWVAGRAIIGGGGGLAKVAAPA
FT                   LIQEIAHPRLRPMLASCYYPFFYFGALLSALLCFAALYIPGDWSWRTPSIVQVVGPLFV
FT                   LATLKSCPESPRWLVSKDRTAEASAILSKYHANGVVDDPLVRWELAEIQMVLEKERVGL
FT                   HASYRDFFMTAGNRRRLIVLLSLCVGTNWVGNGTVSYYLTPVLNSIGITSPVQITLLTS
FT                   GLAIWNLILSFGAALNVERFGRRPLFLVSIIGMLVSYVLIMGLFAGFATTGSHAMSVAV
FT                   VPSIFLYYGFYDIAWTPLPVPYTAEILPFRLRTKGLALFTSVGTMANSFNQFVNPIALH
FT                   AIQWKYYAVYIAILLFYLVFAYFMYPETRHHTIEEVSMIFDKRNDEIANLNELALREVE
FT                   KRAADGYAHRGKDEVSEWKGSCSHREDV"
FT   CDS_pept        join(47666..47778,47847..47879,47939..47994,48044..48854,
FT                   48936..49419,49475..50333,50385..50530)
FT                   /codon_start=1
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262081"
FT                   /orf_name="AFUA_3G00230"
FT                   /product="Beta-glucosidase, putative "
FT                   /EC_number="3.2.1.21"
FT                   /function="beta-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86307.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008422"
FT                   /db_xref="HOGENOM:HBG390192"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000520325"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG20"
FT                   /transl_table=1
FT                   /translation="MANKGMDRSFMTASVEDLVQRMSLTEKVSLLSGEDWWRTTAVPRL
FT                   NIPSIKLTDGPNGARGQSFFKMTPAVVLPNATGLAATFSPTLPAEAGRLLAAETKARGA
FT                   VGLLAPTINICRSPLGGRTFESFGEDPTLSGIMAAKYVSALQDDGISAAIKHFVANDQE
FT                   HERMGQDSIIAPRALREIYLRPFHIAQALAKPWSYMTSYNKLNGTHCSEHEWLLSGLLR
FT                   TEWGFDGLVMSYWMGTYSVAEAINAGLDLEMPGKPRWRQLSLVRQLMNAHKISPVTIDE
FT                   RVRTILKWVQKLVVLNPDTVYGRDDSIEWTRTEDQAADAALIRRIGNEAIVMLKNESAR
FT                   LRPAWCVTPWQGLVDNKPDQVDLRYALGCKGAKFLPVFGEEFTSMDGTTRGFDMLHYAI
FT                   VDGKQASQPAVSEVWTNSDIMLADFSHPDLGDDYFTEIRALFTAPITGEWQFEISVTGQ
FT                   AWVYIDDRLLADLSKEQKRTSSFFGNGGNGTVITFSITKGKVYKFRLLHDSRKPPLAPG
FT                   QDSQPLQLIGMKLGSFPAVNEDQTIDEAVELAKESDIALLMVGLDQDWESESYDRPDLS
FT                   LPLRMNDLIRRVATEAPDTKKVVILQAGSAVSMPWLEHVDAVLWPWYGGNEAGNAIADV
FT                   VYGTVNPSGRLPITLPKRELDIAANLNFKSARTKTYYEEGIWVGYRHFNARGIEPLYPF
FT                   GHGLSYTTFDYSDLTVGPSASSSPDSWRISVSARVTNTGTVPGAHSVHFYTSPPPPTMT
FT                   SLTHPAVTLQAFAKTAVLRPGQSERVTVEMDKFAISHWDELTSTWQAEPGQWHVKIGRD
FT                   AQTMCIEAPFNVAPGFKWHGL"
FT   CDS_pept        complement(51465..53210)
FT                   /codon_start=1
FT                   /gene_family="HOG000050281" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262082"
FT                   /orf_name="AFUA_3G00240"
FT                   /product="TPR domain protein"
FT                   /function="binding"
FT                   /protein_id="EAL86308.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG074714"
FT                   /db_xref="HOGENOM:HBG326069"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051EDE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG19"
FT                   /transl_table=1
FT                   /translation="MTHESEVTPPVPISDEYYDLGAFGRKITTSSADTQAWFDRGLSWA
FT                   YAFNHVEGAYCFEQAIAHDPSCAIAYWGLAYAVGPNYNKPWERFDKDDLKICMKRAYEA
FT                   SRKAKEHASNATPIEQGLIEAIQSRFQSASPPQTAEEQSALNHAYATAMKPVYQAFGDD
FT                   LDVAALYADALMNQTPWALWNLFTGEPNPKAATMEVEEVLERALTQKESEKHPGLLHFY
FT                   IHYIEMSPNPEFGVNVADQLRDLMPDAGHIHHMPSHLDILIGDWRRSIASNYRATLADD
FT                   KYVRRAGPYNFYTFYRLHDYHSLIYAAMLSGRLITALDAVNRMEASVPEDVLRIESPPM
FT                   ADWLENFMTVRLHVMVRFGMWEALKQMELPRDSELYRVTTATTLYAKGAAYAATGDVDG
FT                   ALEQRTLFQQTSALVPETRIVYNAKCTQTLAVAAAMLDGEIEYRRQNYDKAFEHLRKSI
FT                   ELDDKLPYSEPWSWMQPTRHAYAALLLEQGHLQEAAKVYRADLGLDNTLIRPCRHPNNV
FT                   WSLQGYHECLTRLGRTEEAAVIEPALKLALAIADIPIKSSCFCRSDTSQAPRVIKGGSS
FT                   KENCH"
FT   CDS_pept        54078..55301
FT                   /codon_start=1
FT                   /gene_family="HOG000217662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750538"
FT                   /orf_name="AFUA_3G00250"
FT                   /product="Salicylate hydroxylase, putative "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86309.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053362"
FT                   /db_xref="HOGENOM:HBG334104"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI00005207E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG18"
FT                   /transl_table=1
FT                   /translation="MPRIDTVAIIGAGPSGLALALALHKQSIACTLYEARASALDIGGA
FT                   MMLCPNGLRILDSLGVYSRIRPEGYEFDKLYFRSPDDQPMDTYEFGGVEQYGYRAMCIY
FT                   RHVLIRELSAMVREAGIPIEYHKKFVRVLAETEKDITWEFSDGSTATATCVVGADGIHS
FT                   RVRHYLYPGLEPSFTKMVIVAAAVPTSQLQVPSSYNLPVTILNQQHGAVFIAPQLGDGS
FT                   EVMVGRQKRSEQLTREGWDELLNNNKEWCMDFLRQGSDDFPEIVQRAVSNITPEKIFLW
FT                   PLFIVPKLGTWTSRHGRVVIVGDAAHAIPPAAGQGVNQAFEDVFTYSLMLGRSDKDALA
FT                   RSLKVWQTRRQERIDKVLALNTYMERRRVPSLEEEKDAEDAPLDFASLYKPDFVEIVDT
FT                   WLSKHTSC"
FT   CDS_pept        join(complement(57514..57708),complement(56302..57447))
FT                   /codon_start=1
FT                   /gene_family="HOG000179527" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262083"
FT                   /gene_name="eglC"
FT                   /orf_name="AFUA_3G00270"
FT                   /product="Probable glucan endo-1,3-beta-glucosidase eglC "
FT                   /EC_number="3.2.1.39"
FT                   /function="cation binding"
FT                   /function="glucan endo-1,3-beta-D-glucosidase activity "
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="cell wall"
FT                   /cellular_component="extracellular region"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL86311.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="GO:0042973"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG053377"
FT                   /db_xref="HOGENOM:HBG331494"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00005200F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG16"
FT                   /transl_table=1
FT                   /translation="MQFTHLVALALALATSEAAHQGFNYGNTKSDGSAKSQADFQAEFS
FT                   TAKNLVGTSGFTSARLYTMIQGGTANTPISAIPAAITEQTSLLLGLWASGGNFANEIAA
FT                   LKAAIAQYGDDLAKLVVGISVGSEDLYRNSVDGVKANAGIGTNPDEIVSYINEVRSTIA
FT                   GTKLSGAPIGHVDTWTAWVNGSNSAVIDACDWLGFDGYPYFQNTMANSISDAKALFDES
FT                   VAKTQAVAKGKEVWITETGWPVSGKTENLAVANLANAKTYWDEVGCPLFGKTNTWWYIL
FT                   QDADPVTPNPSFGIVGSTLSTTPLFDLSCSASSSSSAAAAASSTAGPSASSVIGGKASG
FT                   FTTAAANSAKPTFTVGKGPGGSYNGTGFWNSTSSARPSSSAISGSSSGSAAGSSGAGAS
FT                   GASGQSSSSTGSSSAPSTSNILSNAASGLSGSIFGAVVAVCLALAAL"
FT   pro_peptide     complement(56305..56373)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG16 "
FT   mat_peptide     join(complement(57514..57654),complement(56374..57447))
FT                   /product="Probable glucan endo-1,3-beta-glucosidase eglC "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG16 "
FT   sig_peptide     complement(57655..57708)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG16 "
FT   CDS_pept        join(complement(59987..60513),complement(59549..59930))
FT                   /codon_start=1
FT                   /gene_family="HOG000179538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262084"
FT                   /orf_name="AFUA_3G00280"
FT                   /product="Metallo-beta-lactamase domain protein, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86312.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053384"
FT                   /db_xref="HOGENOM:HBG330167"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI000051E481"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG15"
FT                   /transl_table=1
FT                   /translation="MPLQTYHHTSSIKGLSSITTLIVGASESILIDPPFLIPDALSVVR
FT                   WIKETTENPLKAVFVTHHHPDHFFSANPILDAFPSAKFYAASYVLEGINREYDDKVKYW
FT                   PTIFGRQNVPEAPRKPEVFNFGFFLLNGNPESPVVLLGPLQGDSVGHTVFWLPMEKTVI
FT                   CGDTVYGRSTHVWVEEVETPALLEAWKKTIALIAALQPVKVIPGHLEPGWELDAQADIA
FT                   HTQKYLDLFAEKVTYAPTKPQVQELYDFFQGAFPQCQQNLDFFLGHLSNQFGEGGKVWE
FT                   ENRHHDVGKRTIEGLTGYWFK"
FT   CDS_pept        join(61076..61139,61190..61497,61547..62083)
FT                   /codon_start=1
FT                   /gene_family="HOG000179549" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262085"
FT                   /orf_name="AFUA_3G00290"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86313.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053394"
FT                   /db_xref="HOGENOM:HBG324132"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51C67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG14"
FT                   /transl_table=1
FT                   /translation="MAQFHPTITPEALKDKVIVVTGGANGIGASLVEYCGQQGAYVCFG
FT                   DVAENAGYQIAQSLCSSGSSSSPRAVFQHTDVTSYQSVLGLFDLALKTYGRIDHVVACA
FT                   GIMEIGNLFDPALTLETVRETPTTKVLDVNLTGCLYVARIASVYLRQNRPENADRSITL
FT                   ISSVAGFKESPGMFVYQASKHGVLGLMRSLRLYLSSPTHHIRVNAICPWMTTTAMVKGV
FT                   QEAWMKAKLPCNTPADVAYIIAGVLADSALNGKSMYVEGGRAWEIEANIDRLEPQWLGE
FT                   EQSRSLAQGQAVLGSGMDWAQ"
FT   CDS_pept        join(64483..65094,65123..65262,65324..66170)
FT                   /codon_start=1
FT                   /gene_family="HOG000179560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262086"
FT                   /orf_name="AFUA_3G00310"
FT                   /product="Extracellular phytase, putative "
FT                   /EC_number="3.1.3.8"
FT                   /function="3-phytase activity"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="EAL86315.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0016158"
FT                   /db_xref="HOGENOM:HBG053406"
FT                   /db_xref="HOGENOM:HBG325154"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI000051E91E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG12"
FT                   /transl_table=1
FT                   /translation="MKTVAGVLVLAVSSLAVGSDATKQAPPAPTGSSYPSGFDMTRSWA
FT                   NLSPYQEADSFGVPKGMPHGCELSQVHVLHRHAERYPTPYPLDGQGMEDFAAKWSNYTK
FT                   SLHLKAPATGPLSFLNDWEYILGEDTLLATGAATEATAGASFWANYGRLLYRAGRENGA
FT                   AWNASLNVYPNGTARPKPVFRTTSQPRILESARWWLSMDSLMSRGGFFGDTGANSSSDQ
FT                   YDLVVIPEASNFNNTLASYDSCPGDMTEGDDSAQKFIPRYTRQAISRLSRHLPKDFNLT
FT                   ALDVLAMQNICVYEHISLGGSSFCSLFTEQEWRDFAYNVDVQYYGDYAYGSPTGRAQGI
FT                   GYVLELAARLQGTLIYSSDTSINFTYDNNLAQFPLDQPFYLDMSHDDILLSVITALGLR
FT                   YFRYGPHGLPGNVDHALNRTFAMSQMTPFGARLMSEVWTCPRNASLDSLAPVLYRNPHV
FT                   EHTVGTTRFIRFVLNGAPLPLDGLVGCEQARHGFCPVEGFLNGVPTLKKEAEYQRACFG
FT                   HYPTGSQVGNGAPES"
FT   CDS_pept        join(66983..67269,67322..67721)
FT                   /codon_start=1
FT                   /gene_family="HOG000179135" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16262087"
FT                   /gene_name="xlnA"
FT                   /gene_synonym="xynf11a"
FT                   /orf_name="AFUA_3G00320"
FT                   /product="Endo-1,4-beta-xylanase xynf11a "
FT                   /EC_number="3.2.1.8"
FT                   /function="endo-1,4-beta-xylanase activity"
FT                   /biological_process="xylan catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86316.1"
FT                   /db_xref="EMBL:ABA40419.1"
FT                   /db_xref="EMBL:ABN48478.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0031176"
FT                   /db_xref="GO:0045493"
FT                   /db_xref="HOGENOM:HBG329722"
FT                   /db_xref="HOGENOM:HBG452980"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="UniParc:UPI000051E496"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG11"
FT                   /transl_table=1
FT                   /translation="MVSFSYLLLACSAIGALAAPVEPETTSFNETALHEFAERAGTPSS
FT                   TGWNNGYYYSFWTDGGGDVTYTNGAGGSYSVNWRNVGNFVGGKGWNPGSARTINYGGSF
FT                   NPSGNGYLAVYGWTTNPLIEYYVVESYGTYNPGSGGTFRGTVNTDGGTYNIYTAVRYNA
FT                   PSIEGTKTFTQYWSVRTSKRTGGTVTMANHFNAWSRLGMNLGTHNYQIVATEGYQSSGS
FT                   ASITVY"
FT   sig_peptide     66983..67036
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG11 "
FT   mat_peptide     join(67037..67269,67322..67718)
FT                   /product="Endo-1,4-beta-xylanase xynf11a "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG11 "
FT   CDS_pept        join(complement(69635..69690),complement(69403..69581),
FT                   complement(69241..69347),complement(68985..69189),
FT                   complement(68821..68927),complement(68483..68763),
FT                   complement(68307..68436))
FT                   /codon_start=1
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262088"
FT                   /orf_name="AFUA_3G00330"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="EAL86317.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG053423"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51C4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG10"
FT                   /transl_table=1
FT                   /translation="MASPATTKSVLIVGATGYIGGSILTELLQSPEASELSISALIRRP
FT                   EQAARLQSLGVKPLEFKGLDDLDACRDAASQHDVVINAASASHDSSAKALIEGLSQRQK
FT                   ATGRDAYMIHTSGTSILGDHPYSGTPQNQKVWSDEKDDVYAMEKNHPERYGQRVTDVTV
FT                   VETGLSLGVKTYIVVPPTIYGKGSGPFATLSQQVPNLARLARKRGQAAVIETGAGIWNH
FT                   VHILDLANFYLLLFRAVREQPDWLPSGPKAIFFVESGEHTWLQVSQGIADALHKQGLLD
FT                   SNKVESISMKDAAAEITRGNESLVEITLASNSRARADFARNRLGWKTSRGNEDFLNHFD
FT                   GEIEAMREELQSRK"
FT   CDS_pept        join(71186..71285,71360..71607,71655..72104,72162..72734)
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902534"
FT                   /orf_name="AFUA_3G00340"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL86318.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI00005205A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG09"
FT                   /transl_table=1
FT                   /translation="MRMLSLRQLCGATTLLLSGQVALADLGIQADNVDSLKSAAKTVAA
FT                   PMMDFYDKNQTEGIPGKLTGTWYVAGAMFMTLIQYWQSSGDDTYNSIVSHDLMFQSGEN
FT                   YDFFSGNYSQWLGNDDQMFWGLASITASETGFPEISGKPTWTSLARVVFNMQVARWDKV
FT                   ACDGGMRWQIWPYQAGYTMKNAISNGGLFELSARLARFTKNETYAEWANKIWDWSASTP
FT                   LLQTDRWYIADSTSNEANCKDAGNTQWSYNYGTYLSGASFMYNYTNGEDKWLKRVNGLL
FT                   DSLIGTFCPKDKGGNVLSEVACEPIMTCDRNQIGFKGYTAMWLAHTAILVPSTAARIFP
FT                   VLQGSALALSKQCSKAPDNTCGVRWWQPTWDGFTPGLETQMAALAGITANLMYYKSSAP
FT                   KTIQSNPDGKEHQIDTHEDEAPDALAPINTGDRAGAWILTVIIVVAVGGSVGWLIKT"
FT   CDS_pept        join(73100..73121,73175..73476)
FT                   /codon_start=1
FT                   /gene_family="HOG000217663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262089"
FT                   /orf_name="AFUA_3G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL86319.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="HOGENOM:HBG053441"
FT                   /db_xref="HOGENOM:HBG324143"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI0000F51CAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG08"
FT                   /transl_table=1
FT                   /translation="MVYTIVVHLRAKPDPECISKLHAKLLEASAVYSKDKETLSWFVMQ
FT                   SVHDKQDFCIVERYLNEGSQKYHLENPYWKTFDPYVIPLLEKPMDLRRFEELVPEGDKQ
FT                   ETD"
FT   CDS_pept        73702..74544
FT                   /codon_start=1
FT                   /gene_family="HOG000225965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207122"
FT                   /orf_name="AFUA_3G00360"
FT                   /product="Riboflavin biosynthesis protein Rib7, putative "
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="EAL86320.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG053449"
FT                   /db_xref="HOGENOM:HBG668075"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="UniParc:UPI00005200F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG07"
FT                   /transl_table=1
FT                   /translation="MSNHRSSDALTFPDSSRAFLEPHLPPNSKNFQSPDSGLPFTTLTF
FT                   ATSLDSALALSPGAKTALSGPQSKAMTHYLRSRHDAILIGVGTAVADDPGLNCRIAGVG
FT                   GYGGQGLEGQPRPIVIDPSARWDFTENSKILTLAREGRGRAPFILTGTQSIPAEKKALL
FT                   ERHGGKFISLDVVTSETEERRMDWTTLLKALSKEGLKSVMIEGGATIINSLLEPSYQNL
FT                   IDSVIVTIAPTWLGQGGVVVSPTRRFNEQGVAIPASRLTDVKWYPFGEDVVLCGRIMS"
FT   CDS_pept        75582..78020
FT                   /codon_start=1
FT                   /gene_family="HOG000236450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262090"
FT                   /orf_name="AFUA_3G00370"
FT                   /product="Phosphoketolase, putative "
FT                   /EC_number="4.1.2.-"
FT                   /function="aldehyde-lyase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86321.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016832"
FT                   /db_xref="HOGENOM:HBG004388"
FT                   /db_xref="HOGENOM:HBG285855"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="UniParc:UPI00005207F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG06"
FT                   /transl_table=1
FT                   /translation="MTSKGEIESLSAYGVARSTIQGTPLSQDELRKMDAYFRASMYLCL
FT                   GLLYLRENPLLKEPLKVEHLKARLLGHWGSDAGQSFTWIHMNRLIKKYDLDVLFISGPG
FT                   HGAPGILSQSYLEGVYTEVYPDKTQNEKGMQRFFKQFSFPGGIGSHATPETPGSIHEGG
FT                   ELGYSISHAFGTVFDHPNLITLTIVGDGEAETGPLATSWHSNKFLNPITDGAVLPVLHL
FT                   NGYKINNPTILARISHEELEMLLRGYGWAPYFVEGSDRESMHQAMAATLEHCVLEIKKI
FT                   QKQARESNKAFRPLWPMIVLRSPKGWSAPREIDGKYLEGFWRAHQIPITDVQSKPEHLK
FT                   ALENWMKAYKPEEVFDKNGTLIPELKELAPTGSSRMSANPVGNGGLLRRPLDLPDFRQY
FT                   ALTDIEPGVTIRPSMTNMSKYLRDVVARNMTTFRVVGPDETESNKLAEIYKAGKKVWMA
FT                   EYFKEDEDGGNLDMHGRVMEILSEHTCEGWLEGYVLSGRHGMLNSYEPFIHVIDSMVNQ
FT                   HCKWLEKCLTVEWRAKVSSLNILLTATVWRQDHNGFTHQDPGFLDVVANKSPEIVRIYL
FT                   PPDGNTLLSTMDHCFRSVNYVNVVVADKQEHVQFLNMEEAIEHCTKGVGIWDWASNDQG
FT                   SEPDVVMVSCGDVSTHEALAATALLREHLPKLKIRFVNVVDLFRLISDTNHPHGMPDRQ
FT                   WGAIFTTDKPIIFNFHSYPWLVHRLTYKRPGQHNLHVRGYKEKGNIDTPFELAVRNQTD
FT                   RYSLAIDAIDRIPSLGNTASGVREHLINLQLAAKNKAFDDGIDPDYIRNWTWNYPRKKC
FT                   "
FT   CDS_pept        join(complement(80673..81471),complement(80502..80625),
FT                   complement(80333..80441),complement(78492..80277),
FT                   complement(78222..78439))
FT                   /codon_start=1
FT                   /gene_family="HOG000181922" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207123"
FT                   /gene_name="lacE"
FT                   /orf_name="AFUA_3G00380"
FT                   /product="Probable beta-galactosidase E "
FT                   /EC_number="3.2.1.23"
FT                   /function="beta-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86322.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004565"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG051071"
FT                   /db_xref="HOGENOM:HBG695906"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018954"
FT                   /db_xref="InterPro:IPR019801"
FT                   /db_xref="UniParc:UPI000051E6EE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG05"
FT                   /transl_table=1
FT                   /translation="MKSLLKRLIALAAAYSVAAAPSFSHHSSQDAANKRELLQDLVTWD
FT                   QHSLFVRGERLMIFSGEFHPFRLPVPGLWFDVFQKIKSLGFNAVSFYTDWGLMEGNPGH
FT                   VVTDGIWSLDEFFTAAREAGLYLIARPGPYINAETSAGGIPGWVLRRKGIIRSNSEDYL
FT                   RATDTYMATLGKIIAKAQITNGGPVILVQPENEYTTWPNVSESEFPTTMNQEVMAYAEK
FT                   QLRDAGVVVPTVVNDNKNLGYFAPGTGLGETDLYGIDAYPMRYDCGNPYVWPTYRFPRD
FT                   WQHEHRNHSPTTPFAIMEFQGGSGDGWGGVTEDGCAILVNNEAVRVVYKNNYGFGVRVF
FT                   NIYMTYGGTNWGNLGYYGGYTSYDYGAAITEDRQIWREKYSEEKLQANFLKVSPAYLTS
FT                   TPGNGVNGSYTGNKDITVTPLFGNGTTTNLYLVRHADFTSTGSAQYNLSISTSVGNVTI
FT                   PQLGGSLSLNGRDSKFHITDYDVGGFNLIYSSAEVFTWAKGDNKKRVLVLYGGAGELHE
FT                   FALPKHLPRPTVVEGSYVKIAKQGSAWVVQWEVAAQRRVLRAGKLEIHLLWRNDAYQHW
FT                   VLELPAKQPIANYSSPSKETVIVKGGYLLRSAWITDNDLHLTGDVNVTTPLEVISAPKR
FT                   FDGIVFNGQSLKSTRSKIGNLAATVHYQPPAISLPDLKRLDWKYIDSLPEISTEYNDEG
FT                   WTPLTNTYTNNTREFTGPTCLYADDYGYHGGSLIYRGHFTANGDESWVFLNTSGGVGFA
FT                   NSVWLNQTFLGSWTGSGRNMTYPRNISLPHELSPGEPYVFTVVIDHMGQDEEAPGTDAI
FT                   KFPRGILDYALSGHELSDLRWKMTGNLGGEQYQDLTRGPLNEGAMYAERQGYHLPSPPT
FT                   SSWKSSNPIKEGLTGAGIGFYATSFSLDLPEGYDIPLSFRFNNSASAARSGTSYRCQLF
FT                   VNGYQFGKYVNDLGPQTKFPVPEGILNYNGVNYVAVSLWALESQGALIGGLDLVASTPI
FT                   LSGYRKPAPAPQPGWKPRRGAY"
FT   mat_peptide     join(complement(80673..81414),complement(80502..80625),
FT                   complement(80333..80441),complement(78492..80277),
FT                   complement(78225..78439))
FT                   /product="Probable beta-galactosidase E "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG05 "
FT   sig_peptide     complement(81415..81471)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WG05 "
FT   CDS_pept        83686..84177
FT                   /codon_start=1
FT                   /gene_family="HOG000179582" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262091"
FT                   /orf_name="AFUA_3G00400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86323.1"
FT                   /db_xref="HOGENOM:HBG053470"
FT                   /db_xref="UniParc:UPI000051FA13"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG04"
FT                   /transl_table=1
FT                   /translation="MNKHEVCEVWTEILKFHFPISQIGRPGNNEYAIQATPGTVFPFVQ
FT                   LSVATQLGTFEATRFLFLHCRSSPRQAQGPPSPRCEDRLRLQLAEGLAAIPVHDGLEIH
FT                   GAIPFGPHIRFYRLMANVIFGCCLWGARDSLHVLHDHYFIAEHLEEIKSDWLSVYVPGY
FT                   "
FT   CDS_pept        join(complement(85385..85727),complement(85013..85251))
FT                   /codon_start=1
FT                   /gene_family="HOG000253033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750539"
FT                   /orf_name="AFUA_3G00410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27268.1"
FT                   /db_xref="UniParc:UPI0000F51C61"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y7"
FT                   /transl_table=1
FT                   /translation="MNTNAELDAFADRVIAIEAIKDSDLSSRISPARRDPLEPLSNLAP
FT                   ANGGSIRSDTRLKPEPHGWSFKNENRVPSPKRPHACDMSKLVSPARLLGAKRSLTDIIP
FT                   CLQAPKIISQKRQRHESVQQWNILPPDAREQYKSRAILFTRAHSAPTSQLLAELREFAS
FT                   QNAGFDQCFISYKEGFDAYVKQSDLDIELK"
FT   CDS_pept        join(87667..88017,88069..88248,88313..88660)
FT                   /codon_start=1
FT                   /gene_family="HOG000179593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055838"
FT                   /orf_name="AFUA_3G00420"
FT                   /product="Acetyl xylan esterase (Axe1), putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86324.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG053478"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="UniParc:UPI0000520101"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG03"
FT                   /transl_table=1
FT                   /translation="MLFTAVTLALLGQALAGPVELEERQSSCPNIHVFGARETTAPTGY
FT                   GSSSTAVNLILNAYPGSTSEAINYPACGGQSSCGGVSYANSVVAGINAVVSAVNSFNQR
FT                   CPNTQLVLVGYSQGGQIMDNALCGGGDPNQGYTNTAVPLSSSAVNMIKAAIFMGDPRYV
FT                   AGLPYNVGTCKAGGFDPRPPGFSCPSASKIQSYCDAADPYCCNGNDANTHQGYGTEYGQ
FT                   AALTFVKSKLSSSGSGGGSGGGSGGSGGSGGSGGTVAHYGQCGGQGWTGATSCQSPYTC
FT                   TVISQWYSQCL"
FT   CDS_pept        join(89709..90221,90278..91399)
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262092"
FT                   /orf_name="AFUA_3G00430"
FT                   /product="High-affinity glucose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86325.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F7A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG02"
FT                   /transl_table=1
FT                   /translation="MGDDLEASKSSLDRKEFPSAEHVEGTTVGIVRAVDPHQLESLPYG
FT                   PSGFKGIFSSKYVFGAAFLASMGGFSMGYDMGVISIINSMDKFHAAYPRAESAFGKGFM
FT                   TGMLLLGAFVGCIFMPYLADRISRKWALTAMVIVFNFGAILQTAATNYDMLVAGRFIGG
FT                   IGVGTLAMGAPLYISEVSPPHMRGTLLVLESISITLGVVVAFYITYGTRHMATEACFRL
FT                   PFGLQMVTATILGAGIHFFPYSPRWLALVNRQDDCMSSLCKLRGLTSSDERVQLEYQQI
FT                   IAEINFQRAVLAKKHPGASGTKLEVLSWMNLFTRKLWKRTAVGVGVAFFQQFSGINAFI
FT                   YYAPTLFESLGQTAETSLILSGVFNVLQLIAAIVCFLVIEKVGRRPLAIFGGFGTAVAY
FT                   IIIAVLSGLYSTSWASHSAAGWGCVAMAFIFILIYGVTYSPLGWALPSEVFSTTSRSKG
FT                   VALATCTIWLSDFIVGVVTPSMLADIGYRTYIFFAVMCSLAGIWAFFLVPETGGKSLEE
FT                   IDELFGDSSAREEWELAQEAIMTGSTK"
FT   CDS_pept        join(95150..95424,95698..95953,95985..96473)
FT                   /codon_start=1
FT                   /gene_family="HOG000179626" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902535"
FT                   /orf_name="AFUA_3G00440"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL86326.1"
FT                   /db_xref="HOGENOM:HBG053491"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051FA1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG01"
FT                   /transl_table=1
FT                   /translation="MAYDCYCAICGVGFCGMLIETPSETATERRRRWIEKRSRALQAGQ
FT                   SIDQVPQEGEEPVRSYDPKIVGWENVAWLYKAYCLGYNPQAASGKGNYGSGTDDTPGPV
FT                   IPFHGCCFEILTRVLTGSTDSSTIDMKVLYNVMTELSNESSSALRLNYGDDIRRAQGRY
FT                   WECIPGAEASSNDQYCTIHPTETSGWDDFLKTDMTTDSKFKRSFLQFDLKGRSPASPFG
FT                   KLPLELVYQICSYLPGDSLKALTQASLSIQVVTQDNWFWKRFIQWDMPWFWEFYSSQNP
FT                   RDLPADVNYKRLYMWLDKMTAARYGMDDLALIGVANRRRIWGVCEELASQYHKAVAAS"
FT   CDS_pept        join(97061..97481,97577..97962,98018..98470)
FT                   /codon_start=1
FT                   /gene_family="HOG000048393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262093"
FT                   /orf_name="AFUA_3G00450"
FT                   /product="NmrA-like family protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86327.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG053499"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F046"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WG00"
FT                   /transl_table=1
FT                   /translation="MELGKCNVWTMSIDYASQAVIELLARLFGINVSSICSERSRLINR
FT                   QRQNEPPSLSQCCLATQTRSLVDPTAGSALRRSETHDDVMRWLPANGWTSVFRLFVYKR
FT                   PYVRPQASVYEPAISRIRNKSTFEYHGYHPKSRCFRSALQHAGFTVTIITRSESKATFP
FT                   PDIPVITTTYTLENLTSALAGQDAAVCVVGPGGIGAQVTMIDAAEAAGVKRFILDDFGW
FT                   GDNPNSFPEFNAIHAQRRAGWDHAKAKAESNPNFTYTGISIGNPIDWALKRFPAMGFDI
FT                   AHCSAVIYDSGTERFTGTTLEGIGQSVVGVVQHPGETANRFVKAQSIITCQNELLEAFQ
FT                   TVTGKQWEVQRAHTKALMENGRRKIQEGVSGWILDLVVAQLFDEGQSRCLLAPSREESD
FT                   ADLLGIAEESPEQVAAKALA"
FT   CDS_pept        join(99333..99490,99526..99634,99756..99946,100063..100186)
FT                   /codon_start=1
FT                   /gene_family="HOG000048391" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262094"
FT                   /orf_name="AFUA_3G00460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86328.1"
FT                   /db_xref="HOGENOM:HBG053507"
FT                   /db_xref="UniParc:UPI000051EDD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ9"
FT                   /transl_table=1
FT                   /translation="MIHEKQYGKPRTVDHSNKFWIRVLTALVLQLSDQQLVTELLLLVC
FT                   GYAQYWRSDQCGLLLQFHTCSDAALPPSLLPTPSEACYAPRIHHAMKVRTIVSCVSPSA
FT                   QDIVFIREWLALAKPLPHSGASDSIWHRYNPYAIAKRCLFKTAVAFSERCSDLQSSPER
FT                   PHIILGFWSITPCLHGRAADRQLGHFYNWR"
FT   CDS_pept        join(complement(101312..101583),complement(100582..101251))
FT                   /codon_start=1
FT                   /gene_family="HOG000179135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262095"
FT                   /orf_name="AFUA_3G00470"
FT                   /product="Endo-1,4-beta-xylanase, putative "
FT                   /EC_number="3.2.1.8"
FT                   /function="endo-1,4-beta-xylanase activity"
FT                   /biological_process="xylan catabolic process"
FT                   /protein_id="EAL86329.1"
FT                   /db_xref="GO:0031176"
FT                   /db_xref="GO:0045493"
FT                   /db_xref="HOGENOM:HBG329722"
FT                   /db_xref="HOGENOM:HBG452980"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="UniParc:UPI000051FC76"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ8"
FT                   /transl_table=1
FT                   /translation="MISISSLSFGLAAIAGAYALPSDKSVSLAERQTITTSQTGTNNGY
FT                   YYSFWTNGAGSVQYTNGAGGEYSVTWANQNGGDFTCGKGWNPGSDHDITFSGSFNPSGN
FT                   AYLSVYGWTTNPLVEYYILENYGSYNPGSGMTHKGTVTSDGSTYDIYEHQQVNQPSIVG
FT                   TATFNQYWSIRQNKRSSGTVTTANHFKAWASLGMNLGTHNYQIVSTEGYESSGTSTITV
FT                   SSGGSSSGGSGGSSSTTSSGSSPTGGSGSVSLLPYGCGFMCILTVIVLCFVGPVRWNWL
FT                   VWSYLLLFGHLPGFELVLLPVLVVPSCRVISK"
FT   CDS_pept        join(complement(105047..105189),complement(104265..104988))
FT                   /codon_start=1
FT                   /gene_family="HOG000198745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750540"
FT                   /orf_name="AFUA_3G00480"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86330.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053522"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051F53B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ7"
FT                   /transl_table=1
FT                   /translation="MHPLCAVLFTVGYAMRAYGADGHYIYNPDSSQNLLVYILSQVFIY
FT                   ICPPLLELANYHVLGRLFYYVPNLAPLPPGKVLAIFGALMALVEALNALGVALNANPTG
FT                   SQQGLGKALILVSLALQLCVVLAFVLTAASFQWRCAKANIRRRSLPTLLITLDISMGLI
FT                   LVRCIYRLIEHVDNTSVDLGDPEGLRSLSPLLRYEWFFYVFEASLMLLNSFLWNVFNPG
FT                   RYLPRYPTVYLAADGTTEIEEEEVRNDQHFLVKSAYAAVNALTFGLFRLFVRQKDEENH
FT                   PLTERTK"
FT   CDS_pept        join(105832..105990,106359..106687,106747..107461)
FT                   /codon_start=1
FT                   /gene_family="HOG000217664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262096"
FT                   /orf_name="AFUA_3G00490"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86331.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053532"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E482"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ6"
FT                   /transl_table=1
FT                   /translation="MEDRPRHCWECLRRSLVCDFIRPQCKRCSTSGIVCPGYEDKAPFR
FT                   LKWLPPGRSKSLAVTFYRYRGLVIRSLRNDINQGHKRASDVVLAGIITLLLVDVSLKCS
FT                   MRNHPPILNHILLRKAQQGASPHWRYHMEGLQKLILLRGGIRSLARSARLAPLLHCFVC
FT                   IAVIGDTVSPTSHLATSRLRLEESYFILENLGNGVFDFQMCPKPLFAEIIRINHLRVQA
FT                   WKQSPTRPGPLAQEAYGVLNRINTFSSERWADSKPSSKEDWRIVGESYQAAVSLYCILS
FT                   LQSLSVLPLNPSLRASCASCGRLLQDLLNEALSSPRIKRSVLWPLVVLGVLAVNGGAGM
FT                   RAFVREHLPEMSRHIGSYVPLMAKALLEKFWASGETSWDACFDKPYTVVTQIAVDLSQL
FT                   D"
FT   tRNA            108846..108919
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        join(109670..109965,110023..110148,110204..110366)
FT                   /codon_start=1
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750541"
FT                   /orf_name="AFUA_3G00500"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86332.1"
FT                   /db_xref="HOGENOM:HBG053539"
FT                   /db_xref="HOGENOM:HBG325540"
FT                   /db_xref="UniParc:UPI000051E92E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ5"
FT                   /transl_table=1
FT                   /translation="MAWAPRDTLRPFLLVARLFAWISAVIVMGITAWAVTKRDGYRVIY
FT                   PLVIVGLSRYMTGTMVLTLAGRSNNAFFIPAMIVSAMKRNRGYMLPLDIVFSYLWLAAF
FT                   IFLAQHIGQENCRWFFFGVSSACTRKRTAEAFSFLAFFFTLCAMCLEIFNFYYSGREGP
FT                   VGMRPHAEKHPHPDTGRAPADAPADVAQPAA"
FT   CDS_pept        join(111562..112149,112404..112493,112607..112801)
FT                   /codon_start=1
FT                   /gene_family="HOG000169785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262097"
FT                   /orf_name="AFUA_3G00510"
FT                   /product="GPI anchored cell wall protein, putative "
FT                   /protein_id="EAL86333.1"
FT                   /db_xref="HOGENOM:HBG053546"
FT                   /db_xref="HOGENOM:HBG325538"
FT                   /db_xref="UniParc:UPI000051FEBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ4"
FT                   /transl_table=1
FT                   /translation="MFFSRLLFIAAFALAVSALPQFYPGGSMTRHDATPTSSTSISPTS
FT                   TFASSSASPSATTSSSGSVQIVNKLDTTVYLWSTSDTSSAMQTIASGETYTETYRTNSN
FT                   GGGISIKMATTESQASVLQFEYTKASDTLYWDLSAIDMDSDSEFITAGFSATPSDASCS
FT                   SVTCAAGESDCSEVYQESDDVATQSCSATAGITTAVRPPRLSEGLPNMSYCKDQSTVAI
FT                   CHISVFLSVLILYIEHNVAATVLEAAVVVLACSRDVVYERATITIACPGTLTVAAPPLS
FT                   DTVVPLTLL"
FT   CDS_pept        join(113361..113515,113561..114617)
FT                   /codon_start=1
FT                   /gene_family="HOG000085952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262098"
FT                   /orf_name="AFUA_3G00520"
FT                   /product="SIR2 family histone deacetylase, putative "
FT                   /EC_number="3.5.1.-"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL86334.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG267174"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="UniParc:UPI000051EB77"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ3"
FT                   /transl_table=1
FT                   /translation="MGHLTRIFIETYEICEKYDNPFKDFKLPSSSSMDDDSLPNVGLPD
FT                   AQTGLPCLKTQAPPAVNNNHHQYIEAFRSDKMTDIENIANLIKSGQVHKIVVLVGAGIS
FT                   TAAGIPDFRSPETGIYDRLKPLHLPYPEAIFHINYFRHTPEPFYAIARARHPRSLKPTI
FT                   THAFLALLEKKGLLHFVFTQNIDGLERDVGIPEDKILNAHGSWRTQRCWKCKTPYPDDL
FT                   MKQAISTGTVPYCQVPDCGGAVKPDIVFFGQPLPAEFDEKEKEVSEADMMLVMGTSLKV
FT                   APCSRLPRLAREGIPRVLVNREKVGDFGKRAEDVSILGDCDDGVRKLADALGWTAEMES
FT                   LWKKAIAAKEAAQEDWGEEESLDELIDRYAKTLTDARKISAGHKRMLEEHLENKFAEVL
FT                   KKST"
FT   CDS_pept        join(114809..114908,114956..115419)
FT                   /codon_start=1
FT                   /gene_family="HOG000217665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055839"
FT                   /orf_name="AFUA_3G00530"
FT                   /product="ATP/GTP-binding protein, putative "
FT                   /protein_id="EAL86335.1"
FT                   /db_xref="HOGENOM:HBG053561"
FT                   /db_xref="UniParc:UPI000051FEDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ2"
FT                   /transl_table=1
FT                   /translation="MSRLLDAIARLGPAIQRTSSDPRPVVLMTCAVAGSGKTTFAKSIC
FT                   SAYPSFTRLSIDAYVYSHHGLWNVDYPKEHYEKYQEEAEAALRQQLVHILQHDDANVVL
FT                   DFSFAFREDREAWKALISEFGGRWVLVYLNVDPTEIRRRVAARNALIDKDGDSAFYLTE
FT                   DLLERYINGFERPVGEGEIVINLD"
FT   tRNA            115480..115567
FT                   /gene_name="tRNA-Phe"
FT   CDS_pept        join(115710..115736,115899..116104,116159..116308,
FT                   116365..116457,116516..116659,116730..116891,
FT                   116942..117592,117702..117960)
FT                   /codon_start=1
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262099"
FT                   /orf_name="AFUA_3G00540"
FT                   /product="MFS peptide transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86336.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG053568"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="UniParc:UPI000051EDE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ1"
FT                   /transl_table=1
FT                   /translation="MRPEAQSAATSGTYKFLENYVQNSVSDPLRPGALGLGQSKASLLV
FT                   NIFLIISYMTPMAAGILADGYLGRYRTVLLSMTLYVLGVAVLFATSIPSMLHRGAGLPG
FT                   LIVAMILVSLSLGGIKASLPPHACSVVKSSSGSGLPRKENALLLIPTSHWNMLLMCMNI
FT                   GAQSRIAATFMEKDIDFWAAYLLSLCSIVTGVLLLYVGRRFISYVLLPAVQALWIAIRH
FT                   GFRMDAARPDAVARDGITVTWSDELIDELKSALFACRAFTPFVIFWLCQAQMTTNTVSQ
FT                   AAEMETHRVPNDMLPNLNSITVIIALPLVTKFAYPFLHRRGIPTPPLRRVALGFFLEAL
FT                   AMGYAAGIQGWIYSSGPCYEHPRACAASMNGSLPNHVNIGYQSPVYVLEGLSEIFASPA
FT                   GYEYTFTKAPKSMKSIIQALYGLTAAGGSIIALALTPTNKDPDLLGMYAGVSGAMFVAA
FT                   VIVMVVSYKHEGRTARDDDSLSQVWSLFKIIPIIRAECFKSEVRLPGLRKHCTVDVLFI
FT                   ITFGCTCPYFRLTYTCSHWSQSSDTMFHALWALNLMTDISESRKKI"
FT   CDS_pept        join(complement(118359..118546),complement(118035..118308))
FT                   /codon_start=1
FT                   /gene_family="HOG000217358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262100"
FT                   /orf_name="AFUA_3G00550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86337.1"
FT                   /db_xref="HOGENOM:HBG053577"
FT                   /db_xref="UniParc:UPI0000520584"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFZ0"
FT                   /transl_table=1
FT                   /translation="MKVSTIFSVVLAAGSAIAVPGKRAGQAITISDLKASQVDQQGYIT
FT                   FALKDPNYDDSTGANVIWHRPGNPVSGTRTSDGAYYVNFPGGVNDIAVFTLEVQRVKGT
FT                   ETVSVTLNDNGNGSAPGSKWSCTSTSGSVMGTVKKCAYDGDITLTPFNA"
FT   CDS_pept        120239..120841
FT                   /codon_start=1
FT                   /gene_family="HOG000051123" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262101"
FT                   /orf_name="AFUA_3G00560"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="EAL86338.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG053583"
FT                   /db_xref="HOGENOM:HBG707336"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015808"
FT                   /db_xref="UniParc:UPI000051FC85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY9"
FT                   /transl_table=1
FT                   /translation="MTAPQSTPPRVLSVTISASHNFSKNAVSSIKLIANLGVEGDCHAG
FT                   ETVQHRSRLHIKPPPANLRQVHLIPIEILRGICATLPTDEMRTQLLAPGALGQNITTEG
FT                   VDLLSLGAGTEIRFVEDGEAVGEEAVITLTGLRNPCPQIDKFQAGLKEQFLVRDEERNI
FT                   VRRLAGVMATVKKGGVVRPGMKLIIDKPSQYVPLDVV"
FT   CDS_pept        join(complement(123262..123387),complement(122357..123208))
FT                   /codon_start=1
FT                   /gene_family="HOG000169319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750542"
FT                   /orf_name="AFUA_3G00570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86339.2"
FT                   /db_xref="HOGENOM:HBG053592"
FT                   /db_xref="HOGENOM:HBG324175"
FT                   /db_xref="UniParc:UPI0000F51C5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY8"
FT                   /transl_table=1
FT                   /translation="MPDMMGFIDTLVPESLASINLWKIATIFLLAVNVKCLPFVWHYRI
FT                   FKPLVRAAWRTFRSGPKLAVIPHSKTPTVFLPSITSTYAPLFECDYIMHKSNSTYFTDL
FT                   DASRSYLLSALCYDGLVTVDRELAAEGKKGMLAAIIGSVTTSFKKEIRIFQEYEVWSRI
FT                   LTWDRKWLYIVTHFVQKGSAKPTGYLIAKSTRLDLRRSTEESRCHSGQPVIFATSISKY
FT                   VFKKGRLTIPPERILRASGLMGQDNKEEKREVLPNNVQGHTSDSGVPEDIESERLKGMK
FT                   YAESWNQLDSLHEELLKQDELVNGVLALNHFGDISLPWKRFTTA"
FT   CDS_pept        join(124300..124443,124499..125065,125113..125291,
FT                   125330..125537)
FT                   /codon_start=1
FT                   /gene_family="HOG000048390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262102"
FT                   /orf_name="AFUA_3G00580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86340.1"
FT                   /db_xref="HOGENOM:HBG053600"
FT                   /db_xref="UniParc:UPI00005207E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY7"
FT                   /transl_table=1
FT                   /translation="MSTYVVSDQPLNNSLVGSISSLLSAAGVPNLLWGNYLLTVYGVPT
FT                   IVDGVSFVVPDALLETGRSTLSYAGFLPCTQGPKCPYPNSAPCLETATHLHINDELVIS
FT                   LHRKSDVLWDFPDLEIGANSTDIMSAADTRLPPERLGRGQGRFPPSLSGVRIPSAVRYC
FT                   EAMIRLLCLDSESPREPYWMAILTYLLEYVDETDIFQKNWLREGYRQFYEAMKQGDPEM
FT                   YLHLRTLRDVFIKSSPQPSSLVSRLDDRLTIKHGRNSILTDLIALVFLPSSHILSIASF
FT                   PKWQEKVQLMLRPAYGLLDQSIQPIQPFRVSPRKHTTNSAIVIAAMNLPCLKRFDGFYL
FT                   VLSNSNFVSLAARIRESGPNIYKFS"
FT   CDS_pept        join(complement(129276..129373),complement(128892..129213))
FT                   /codon_start=1
FT                   /gene_family="HOG000234494" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI19055840"
FT                   /orf_name="AFUA_3G00590"
FT                   /product="Asp-hemolysin"
FT                   /biological_process="cytolysis"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="EAL86341.1"
FT                   /db_xref="EMBL:BAA03951.1"
FT                   /db_xref="GO:0019835"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="HOGENOM:HBG053606"
FT                   /db_xref="HOGENOM:HBG638467"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI00005207F8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00050"
FT                   /transl_table=1
FT                   /translation="MASVQAYAQWVTVHLINSMSSETLSIQNASLSWGKWYKDGDKDAE
FT                   ITSEDVQQKTAPPGGSVNVNSCGRSDASSGTTGGFDLYDGNTKIGRVHWDCPWGSKTND
FT                   FDVGERNKNYWVEIGTWNKYGGAIGTVDVEVGRKR"
FT   mat_peptide     join(complement(129276..129358),complement(128895..129213))
FT                   /product="Asp-hemolysin"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00050 "
FT   pro_peptide     complement(129359..129373)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00050 "
FT   CDS_pept        join(131435..131796,131867..131983,132070..132166,
FT                   132235..132367,132415..132496,132551..132805,
FT                   132888..133084,133144..133232,133290..133373,
FT                   133450..133516,133570..133886)
FT                   /codon_start=1
FT                   /gene_family="HOG000234493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902536"
FT                   /orf_name="AFUA_3G00600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86342.1"
FT                   /db_xref="HOGENOM:HBG053614"
FT                   /db_xref="HOGENOM:HBG330253"
FT                   /db_xref="UniParc:UPI0000520591"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY5"
FT                   /transl_table=1
FT                   /translation="MNIFFRIWFYRKCLIVPCMQQVRCVEYHYAIAFLTIPCVKPSVGS
FT                   DYDESDCLTGRDRSLSCDYYVHIRATLKECHHEFNVPLPFRFTFISITLYSFSSHRKPK
FT                   MVAELVPYVDGMQRGQGYDTYLQELRVANAVTITSKSPPSETYDLTYKSVQIEEYTELA
FT                   KSLEITAGAAISGWGQSAQIDTSYLNRSKFESATTTYQVEVSSQQQATIDNTYSFNKIS
FT                   TTDPNASYGDRFVADFIKGGKFLARVSISSISKSSTEEVKEAAKVAFTMYGVTGEVTEE
FT                   VKHAVSSIQKNSRITIWIHISGGGTKLGETKRIDSGPDDEDSPLFKIKKEADNFYQELK
FT                   DGKHKYRRFGVLWKYTNVPDFNNAFDPFDYSAANKKVRPSLVMRSIMEFDELCQSWNFF
FT                   EDFTQYGVYIDNVKKMPVDKFLGGRQQQADLYDEGTRVNVAISNKIAAIDKDPTDVDKP
FT                   LPYPKPYEFQRKVLRALKTVTYIAQERSVDGGRLTDIALPTLQGGAEKLFEFKAFDFDA
FT                   VVGTSVVSFGKRDSSYICLNGQRASDFGYKEESVFWTFPFPVDQVAEQKINVSKLKSAD
FT                   LIRLSRTETGPSFLFDVYTEKSS"
FT   CDS_pept        join(139329..139350,139355..139564,139624..140458,
FT                   140514..141306)
FT                   /codon_start=1
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262103"
FT                   /orf_name="AFUA_3G00610"
FT                   /product="Glucoamylase"
FT                   /EC_number="3.2.1.3"
FT                   /function="carbohydrate binding"
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="EAL86343.2"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG052802"
FT                   /db_xref="HOGENOM:HBG324178"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008291"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI0000F51C4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY4"
FT                   /transl_table=1
FT                   /translation="MRFAGIACIASVLGHLATPSSAKELAARSPAAANSRLVKEGLFAY
FT                   ESILAALGNTGINAPGTAAGLLIASPTIQNPDYFYTWTRDAALTFKGLVDIFIGGDTFI
FT                   VVNLDGLETHIQDYISSQAVLQNVSNPSGRLSDGSGLGEPKFEVNFNPYSGGWGRPQRD
FT                   GPALRAITMLTYIRQLIQQGKQSVASNLIWPVVANDLTYVAQYWNHTGFDLWEEIDGSS
FT                   FFTTAVQHRAMVEGSAIAQALGKPHAGYDAVAPEILCLLQSYWNESAIISNINVNNGRS
FT                   GIDLNSVLTSIHTFDPAAGCDDSTFQPCSSKALANHKVYVDSFRSIYGINAGLGPGKAA
FT                   NVGRYAEDVYQGGNPWYLATLAAAEQLYDALYQWKKQGYLTVTQTSLAFFRDFSSTVEP
FT                   GTYKSNTPTYKSLTDYVRTYADDFFFLVEKYTPSNGSLAEQYDRNTGVPLSANDLTWSY
FT                   AAFLSTLQRRLNIMPDSWGPSSANPVPTTCSKTTITGTYSAVAPPFPTSTAQCVAAVTV
FT                   PVTFWLIENTYYGENVYMTGNVSALGDWNASAGYSLNAGLYTSDENLWFATVKGLEPGV
FT                   TMEYKFYKIEPGNSVTFEGGENRVYAVPTACPVAPQVHAVWQT"
FT   CDS_pept        join(141604..141666,141786..142028,142083..142647,
FT                   142695..142790,142839..142954)
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262104"
FT                   /orf_name="AFUA_3G00620"
FT                   /product="Zinc-containing alcohol dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86344.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E93B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY3"
FT                   /transl_table=1
FT                   /translation="MLCSLIWSSATPRGACIVEFTLKAVIYTGNNKFSVEDRPIPVILE
FT                   PTDAIVKVLHTTICGTDLHILQGHVATCTPGRILGHEGVGVIDSLGAAVTNFKAGQTMP
FT                   SQCESGGWILGNKIDGTQAEYVRIPHASFSLHALPEGIDPEVAVTLSDTVPTSYECGIL
FT                   NGDIQPGATVAIIGTGPIGLMILQMAKNLFGPAMTVVVGRGQPRLEIANAMGADHTLSV
FT                   LGGQDEVISAALAVTKERGFDVVIEAVGTVESFAIAQALVGAGGTLASLGVFGESCELR
FT                   LEKLWHRNICLRTRLVDGVSTPDLLKMVEAGGIDPRFLVSHRFTFDEIHNAYEAFEASS
FT                   KHGALKVVVTLPEPTMNGLA"
FT   CDS_pept        complement(143075..143800)
FT                   /codon_start=1
FT                   /gene_family="HOG000179136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207124"
FT                   /orf_name="AFUA_3G00630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86345.1"
FT                   /db_xref="HOGENOM:HBG053634"
FT                   /db_xref="UniParc:UPI000051F53C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY2"
FT                   /transl_table=1
FT                   /translation="MDYTRLRKDDEEEFVYSKTTPPTHPSQGRPYRSYATLLSSLALTI
FT                   SIISGIFTLIAYTTSPRELTPQSQDSLFRCGTSAAEAKAAGCHFDLMSFSWLPSACYNE
FT                   DLTNEFLNYTDWKWSLDSEGRHLAPKEYVQQGDFEYLFTSYEYHVVHCVFMWKKTHQAI
FT                   LDGSFDHLDGYIAGLGHTGHCGEMLLDRETDLKTWGTPGWTKFPACGQGVLNLEQGWYR
FT                   MHNGEKAWGMPGAGGHHHN"
FT   CDS_pept        join(144990..145080,145127..145306,145354..145844,
FT                   145936..146340)
FT                   /codon_start=1
FT                   /gene_family="HOG000296073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207125"
FT                   /orf_name="AFUA_3G00640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86346.1"
FT                   /db_xref="HOGENOM:HBG053642"
FT                   /db_xref="HOGENOM:HBG326356"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniParc:UPI00005200FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFY1"
FT                   /transl_table=1
FT                   /translation="MASSTNSSKHILTMSGVKRYSPKRLIVCCDGTWQDSLADGAQPPS
FT                   NLTRFSRALSRLAVVDGEDGQQYEIPQIVYYQKGVGTSLGDKYWGGVAGLGVSANVRAA
FT                   YGFLADNYNDGDKIYFFGFSRGAYTARAVAGLVCKWGLLTPRGMDNFALVYDDFYNQKI
FT                   EGYDAERRKRMGFRDPLPRFTVEIIGVWDTVGFQKAWLGRDAGEKLELRNTILQDNVRY
FT                   AFHALSLDEERTAFQPIVWHIPHRNEGQEMLQCMKHRQLRFDIDEYLFDDPPRPEESEM
FT                   APWATSLGKIDHSSIGRTLQGKLGGRSTRKPMGYNPTGQESDITNEFIHESVRDRNLAK
FT                   WPCAALKGRHDEKSWTLTSGKQIAELPALQMEKYMKGRIRTVHVTEED"
FT   CDS_pept        join(147729..147821,147882..149294)
FT                   /codon_start=1
FT                   /gene_family="HOG000051000" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262105"
FT                   /gene_name="lap2"
FT                   /orf_name="AFUA_3G00650"
FT                   /product="Probable leucine aminopeptidase 2 "
FT                   /EC_number="3.4.11.-"
FT                   /function="aminopeptidase activity"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="pathogenesis"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="extracellular region"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86348.2"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0009405"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG053657"
FT                   /db_xref="HOGENOM:HBG670222"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI0000F51C4D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFX9"
FT                   /transl_table=1
FT                   /translation="MVTMKLLYLTSFASLAVANGPGWDWKPRVHPKVLPQMIHLWDLLQ
FT                   GAQQLEDFAYAYPERNRVFGGRAHEDTVNYLYRELKKTGYYDVYKQPQVHQWTRADQAL
FT                   TVDGQSYDATTMTYSPSVNATAPLAVVNNLGCVEADYPADLTGKIALISRGECTFATKS
FT                   VLSAKAGAAAALVYNNIEGSMAGTLGGATSELGAYAPIAGISLADGQALIQMIQAGTVT
FT                   ANLWIDSQVENRTTYNVIAQTKGGDPNNVVALGGHTDSVEAGPGINDDGSGIISNLVVA
FT                   KALTRFSVKNAVRFCFWTAEEFGLLGSNYYVNSLNATEQAKIRLYLNFDMIASPNYALM
FT                   IYDGDGSAFNLTGPAGSAQIERLFEDYYTSIRKPFVPTEFNGRSDYQAFILNGIPAGGL
FT                   FTGAEAIKTEEQAQLFGGQAGVALDANYHAKGDNMTNLNREAFLINSRATAFAVATYAN
FT                   SLDSIPPRNMTTVVKRSQLEQAMKRTPHTHTGGTGCYKDRVEQ"
FT   sig_peptide     147729..147782
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFX9 "
FT   mat_peptide     join(147783..147821,147882..149291)
FT                   /product="Probable leucine aminopeptidase 2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFX9 "
FT   CDS_pept        join(complement(149661..149691),complement(149473..149612))
FT                   /codon_start=1
FT                   /gene_family="HOG000246110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055841"
FT                   /orf_name="AFUA_3G00660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86349.1"
FT                   /db_xref="HOGENOM:HBG053664"
FT                   /db_xref="HOGENOM:HBG395639"
FT                   /db_xref="UniParc:UPI000051FECA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX8"
FT                   /transl_table=1
FT                   /translation="MCMPSKCNTCQKNTWWGCGSHIPSVMDPVPESDRCTCSPKVNADG
FT                   KEYPPKGPGPA"
FT   CDS_pept        complement(150192..150911)
FT                   /codon_start=1
FT                   /gene_family="HOG000179147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262106"
FT                   /orf_name="AFUA_3G00670"
FT                   /product="DUF1275 domain protein"
FT                   /protein_id="EAL86350.1"
FT                   /db_xref="HOGENOM:HBG053671"
FT                   /db_xref="HOGENOM:HBG332959"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniParc:UPI000051F7BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX7"
FT                   /transl_table=1
FT                   /translation="MAPLSSIWAYLNEDIGEDLLLECQLLLLSFATGIQDAATWPDYSC
FT                   FASNQTGNTLFLAIGVAGLANNAYSFPNIGMSLGMFIAGGLLVGQLGNLFGVRRRLWLL
FT                   LSSVIQTVLVVAGLVVQYTLPVKQEGPAALGVIACLAFSSGAQVAMSRSLKITEITTAM
FT                   ATAAYVDVVVDPGLLRVHNRPRTRRVLFLVMLTAGCFVGAFAQRAVDSSFALLWCAVGK
FT                   AVVTVSLLWNKRLEKTC"
FT   CDS_pept        join(complement(153244..153549),complement(152609..153188),
FT                   complement(151644..152555),complement(151397..151596))
FT                   /codon_start=1
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207126"
FT                   /orf_name="AFUA_3G00680"
FT                   /product="Copper amine oxidase"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86351.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG061830"
FT                   /db_xref="HOGENOM:HBG325455"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI000051E6EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX6"
FT                   /transl_table=1
FT                   /translation="MMALHPFDPITPAEIQLAVKILEAAFPGASLRYKKIDVNEPLKKE
FT                   VVPYIEAERLGKALPAAPTRLLQVLFHRLDNGAFYKALLNAGTRSVVYTKQLPKEVQGP
FT                   VDADELIEIEQLCLSHPAVQAEIAKMQLPQGVTVCNDPWIYGTDDPKETRRLFQCYMYV
FT                   VTTDHPQNNHYSTPCKFSPVFDALTRELVRMDYLPGGVDTQVSETQPWKTVETIQYAHD
FT                   LLTEPLRTDLKPYIVQQPEGPSFHVQGNLVSWQKWKFRVGFNTREGLVIYNTTYDGRNV
FT                   FYRLSVSEMTVPYGDPRAPYHRKQAFDVGDVGFGITANQLSLGCDCLGYIKYFDGYRSD
FT                   SKGNPVQLKNVICLHEQDNGLQHKHTNYRTGAATVVRNRQLVVQMICTVSNYEYIFAFI
FT                   FDQAANIELEVRATGILSTVPFDNEKFGTTVPWGTNVGPGVMAPFHQHMFSFRIDPAID
FT                   GFKNTVYYEDSVPMPEDENNPYLVGYTTEQTVLRTSGSANTSVERHRVFKIRNDACINP
FT                   ITYKPVAYKLQTAPSQMLLAGNRSFGYKRAEFATKPIWVTKYQDDELFAAGEFTNQSKQ
FT                   SEGVEKWVQRNDPVENEDLVLWHTFGLTHNPRVEDFPVMPVERVSVMLKPDGFFTKNPA
FT                   LDVPASTQSFNRSTLHPEPAACCAPAKVKL"
FT   CDS_pept        join(complement(155313..155427),complement(154561..155261),
FT                   complement(153930..154508))
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262107"
FT                   /orf_name="AFUA_3G00700"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL86352.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI000051EDC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX5"
FT                   /transl_table=1
FT                   /translation="MGRQCPCHWPLSLRLSLLLSLLLLPLRATTLDLNVTDPDNIKEVA
FT                   SQLAWDLVSFYTGNNTGDVPGNLPAPYYWWEAGAFFGTLVNYWRYTGDDTYNNITMQAI
FT                   LHQAGTGDFMPSNQTRTEGNDDQAFWAFTALMAAGHNFPNPPEDSPSWLAMAQAVFNEQ
FT                   IARWDDQACGGGLNWQIFPFNNGYTYRNSISNGGLFNIAARLARYTGDATYAKWANKVW
FT                   DWVTETGLIGREYYVFDGTYESDNCSALNRVEWTYNNGVFLHGAAHMWNYTQGNSSWKA
FT                   RIDGLLDAQRTFLSPNKSSENVLYEYACETINTCRTDQYSFKAYLARWMGDVAQLAPWT
FT                   RDTIATRLRASATAAAAQCVGGKTGTYCGMRWTTGEFDGTTGVGQQLSALEVVQANLYN
FT                   TVAGPLTNSTGGTSKRNSAVERGSSERIAVSDDSSIVTMADRVVAWVATGGLGVLLGGY
FT                   LYLVVT"
FT   CDS_pept        join(156238..156324,156353..156469,156536..156785,
FT                   156837..157381,157431..157694,157734..157925,
FT                   157966..158155,158204..158721)
FT                   /codon_start=1
FT                   /gene_family="HOG000217670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207127"
FT                   /orf_name="AFUA_3G00690"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86353.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053697"
FT                   /db_xref="HOGENOM:HBG331596"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005205A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX4"
FT                   /transl_table=1
FT                   /translation="MVLTVGKRMDHSARSKRTSHAYADLAPSRRCRARKVKCSGTQPCD
FT                   KCRNRQQDCVFEEDRKIVVSEEYRKVSELEGSLTSTPSKRPRVLQSHASYSESISSKEA
FT                   LQSASEPGGLATPEQQELNRHDERFAANPLVSPSTYVKNNRRTQRAWLLLGPTSTWSFS
FT                   RRVLSTIQTRLSPTCTKSIPLAVDGDAYQIYWRQASSEEVPDRSGLPSRDQAIYMLNTV
FT                   CFHFGHLYQPFDEEDFTRNLDEFYCNASAKVQESRLWYVQFLVVLAFGEALLAPVRRAS
FT                   NTASWTKYFSRAMSLLPDTTALWQDPLLAIEVLALIALYLHSVDMRDSAYCYIGHAMRM
FT                   ALVEGLHRALPVEQLGEKRVERCTKIWWTVYILDRKFSSLIGSPTSVNDEDVTTILWDL
FT                   KTCSQEAAALSLHVKITQVITRTDIATAVYSANGKLGNAFLQGIRSILHEMSDLSRELE
FT                   EVFAHRFSSSVDTLSGVTTRLTLSCHSKQCIIVTARPLILSLLWERLSCFEEGDVFRSL
FT                   SAPIRTLIQACIDSALRSLKILTALRDQNLLESFLPFDLENLFSSFFILSLISAVLPGT
FT                   LPDHSYRDMGFSLLDEMIARGNRVAQLRRSEIELLEELVQPLIRPETTRPEEDPGSPLM
FT                   EALNERNCVAQQRHHGMAADAEGPGPTPAVTVTGAQEEDLLFDWRDFGLSLNHMLSATD
FT                   ELNANSLVPGAESEELSADLWLWGDG"
FT   CDS_pept        160364..161437
FT                   /codon_start=1
FT                   /gene_family="HOG000178363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055842"
FT                   /orf_name="AFUA_3G00710"
FT                   /product="Allergen Asp F4-like, putative "
FT                   /protein_id="EAL86354.1"
FT                   /db_xref="HOGENOM:HBG053703"
FT                   /db_xref="UniParc:UPI000051E483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX3"
FT                   /transl_table=1
FT                   /translation="MKWESFLLTAITAGSAMAGAHHANEHAHLRHRLVHNAELKAREVD
FT                   DQANPAVSTKTIVNLEVVTMYTTITRRPHGHKPTTTVAAVETSTTGSQPLASVSLDVDA
FT                   NLLDVRSDTTSTATTLSTSTSSATVSAATSSSGNSASWTSTPSNGVYSTSGFGQRTNSS
FT                   GSGIEYVGNVGSPWGSNIIEVTASTASQYKYVVKFTGSDTDDWFVSFWNKVGPDGKLDG
FT                   WYGHSALNFTLAPGQTRYVAFDENSQGGWGAAAGDSLPTDEYGGYACTWGEFDFGNTSN
FT                   DQWSGWDVSAIQAQNAGLTVQGMRICDHNGDDCSYITTDAAKVVNAYTAAEASVDGIGG
FT                   SVSAGAVRLVVEVDYSG"
FT   tRNA            163221..163293
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        join(163867..165126,165181..165288)
FT                   /codon_start=1
FT                   /gene_family="HOG000217671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262108"
FT                   /orf_name="AFUA_3G00720"
FT                   /product="DUF500 and UBA/TS-N domain protein "
FT                   /protein_id="EAL86355.1"
FT                   /db_xref="HOGENOM:HBG053711"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI00005200E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX2"
FT                   /transl_table=1
FT                   /translation="MSVPRTNKISTTPYRRPTESKMSSTANKTKPSSPSSSSLGTKKSL
FT                   TQNKAWIYGKKGFDKAWDALDKVGAPVNRLSNKLGSEAFWPMTLDKESEKAARILRSFC
FT                   KEGVYVANDATVATREQTPDKKIDKPRGKPKVLQKIPAEVIRQAKGIAIFTAMRTGLWF
FT                   SGAGGSGILVARLPETGEWSAPSGILLHTAGVGFLAGIDIYDCVMVINTYEALEAFTKV
FT                   RVTLGSEISVAAGPVGMGGVLESEVHKRQAPIWSYVKSRGFYAGAQIDGTILIERNDEN
FT                   ERFYGRKVTVKEIMAAHVRTENASVRMLMHTLHSAQGDKQFDQTPSGVAVPTGPSPSDF
FT                   APEDLADSKLMAQGALVTPAQTATETPATFNDRSVPVDGVQNEETVIAQMESMGFARID
FT                   IDRAMRAASFNPDRAVEYLLNGFPDDEHPEQQQQPAFGPAPDHPELPAPPLPPRRH"
FT   CDS_pept        join(complement(166043..166134),complement(165340..165994))
FT                   /codon_start=1
FT                   /gene_family="HOG000195293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055843"
FT                   /orf_name="AFUA_3G00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86356.1"
FT                   /db_xref="HOGENOM:HBG053721"
FT                   /db_xref="HOGENOM:HBG330346"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000051E6ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX1"
FT                   /transl_table=1
FT                   /translation="MESNAQPTILFYDIASAPPVTCYAPNPWKIRYALNFKQAHYQTEW
FT                   VELPDIPTVRKSLGLAANRVLPDGSPFYTLPIIKNLSTGELVGDSFEIAQYLDRLYPEG
FT                   PRLLPPSTVGLISAFNSQVDAVFTQHCVLCVQGMPYNPATAEESKATFAKRAGKERYED
FT                   LMITGEARAGILESFQNALGELAKAYRRTEGPFLDGDTPTYADFIVGSWLNFYKKTIEE
FT                   WEQLFGWHDGLWGELHRALEKYAEVK"
FT   CDS_pept        join(complement(167425..167617),complement(166709..167370),
FT                   complement(166508..166660))
FT                   /codon_start=1
FT                   /gene_family="HOG000050225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750543"
FT                   /orf_name="AFUA_3G00740"
FT                   /product="2-dehydropantoate 2-reductase family protein,
FT                   putative"
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86357.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG406508"
FT                   /db_xref="HOGENOM:HBG668370"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FC86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFX0"
FT                   /transl_table=1
FT                   /translation="MSPKARVLLVGAGGIGTIAALNLERGGLAEVTCVLRSNYEAVRSR
FT                   GIEIISCEHGHIKNWRPTAVLNVIPRVCSEDHSTLFDYIVCTTKNIPGVTPSICETIAP
FT                   AVRPGHTVIVLIQNGLNIEKPFLSRFPQNVILSGVSRCDAHEIAHGVIEQKEDDDLHIA
FT                   AFHNPLLDQETQQKAAEQFVQIYGAGGKTNVRHEPNWERDRWSKLVYNATLNPICALTG
FT                   VNTGDLQIAGGAFDRLVIPAMQEVVKVSKAVGVELPDDIIETTIRKNPVERKIAPSMQK
FT                   DMEKGNLLEHENLIGEVVREAQKQGVAIPVLSVLYELCSAIQWRVAKERGMRIA"
FT   CDS_pept        join(168136..168677,168696..168882,168938..169000)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902537"
FT                   /orf_name="AFUA_3G00750"
FT                   /product="Short-chain dehydrogenase/reductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86358.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FA2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW9"
FT                   /transl_table=1
FT                   /translation="MHIDTTSHIGGLGSSIGKKLREQGAHLAILYAPFEAARREELLES
FT                   GYGGGSDAIRTYECDITAPSSVESAFHALEREMIRASSSTQSDVVFPSILINTAGYVSL
FT                   SDMEMTPPEETMQHLTTNIFGPMLCSQAFARLYFAASKTAEASANPSPPGRIVNIASQA
FT                   AHVALPRHGAYCASKAAFMASEWGGQGITANSVSPTVVWTALGKKAWGEDSVREAFLKT
FT                   IPSGRFVLPEEVADAVVFLCQDSSGMVNGADIRVDGGFTIQ"
FT   CDS_pept        169511..169978
FT                   /codon_start=1
FT                   /gene_family="HOG000078531" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262109"
FT                   /orf_name="AFUA_3G00760"
FT                   /product="GNAT family N-acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL86359.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG342985"
FT                   /db_xref="HOGENOM:HBG669781"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051FA09"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW8"
FT                   /transl_table=1
FT                   /translation="MTTMLIRSDTLDYPEVQHLLQHHFTELRSQGRPETSFALDLTAFL
FT                   DPSITLYTAWEGDSLLGCGALKQLSPTHGEIKSMRTAPGHLRKGVAKTILKHIVAEARE
FT                   RKYQSLSLETGTDGRFESARRLYLGMGFEVCGPFGDYKSSDDNMFLTLRLC"
FT   CDS_pept        join(complement(170589..170740),complement(170025..170526))
FT                   /codon_start=1
FT                   /gene_family="HOG000179169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262110"
FT                   /orf_name="AFUA_3G00765"
FT                   /product="N-acetyltransferase, GNAT family, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EBA27269.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000F51CB3"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y8"
FT                   /transl_table=1
FT                   /translation="MALLPQQSIRVSIPEPLPPIITPRLYLRPLADSDAEGLFAIRSRP
FT                   EVARTNHPKIPHRTVRETREWMTTKIFTAGPESVLGRHLTYVLIERELLENETQSPPAD
FT                   KQVIGYMSINQVYPSPEIGYSIHPDYWGKGYATEALDGLLKTWWDLPRQPQLTSAEDRA
FT                   EPTEKVFALCEKTNAGSSKVLSKCGFRVIGQEVYDEDEVLLWELKKPVLRHSCP"
FT   CDS_pept        complement(171267..172277)
FT                   /codon_start=1
FT                   /gene_family="HOG000179206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902538"
FT                   /orf_name="AFUA_3G00770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86360.1"
FT                   /db_xref="HOGENOM:HBG053751"
FT                   /db_xref="UniParc:UPI00005205A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW7"
FT                   /transl_table=1
FT                   /translation="MNPLRYLAPPRPFGDISNSTQEEIEGRELFASCLLNNSHMSLSDL
FT                   DRDVIRTYRDACRRLDTGESQTRENDMQAVREYEQSLQTNGPVNLYFDLATRTKMGEEL
FT                   DNLHDMWSYVRYEKYLPATVKEDAEKHPSSKVSDPWHKAFWKPFYGRLEAEAGAWAQVL
FT                   SGKNHLNECPTYLLLALLCEQQTMDWDETVALIRYCAVEGVELPKADFVDYLKAKDVTG
FT                   LAKRLELDENTIALSTEYVMGVGTMLLAYFRMHLPEALYEFEEDLEPEKWVPKKRLHDL
FT                   MALQDGHDQAVQELIREIFYEMVLGGSDDDEEEGWDDDDDNDNDTDEDDIMDEAD"
FT   CDS_pept        join(173811..174067,174141..174342,174393..174457,
FT                   174527..175070)
FT                   /codon_start=1
FT                   /gene_family="HOG000217673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750544"
FT                   /orf_name="AFUA_3G00780"
FT                   /product="CAMP receptor (Car4), putative "
FT                   /function="transmembrane receptor activity"
FT                   /biological_process="cell surface receptor linked signaling
FT                   pathway"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86361.1"
FT                   /db_xref="GO:0004888"
FT                   /db_xref="GO:0007166"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG053759"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="UniParc:UPI000051E6E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW6"
FT                   /transl_table=1
FT                   /translation="MDLTAAQLRTLTTVERVASTLSILGVITIIGTFAHSRHFRNPMHR
FT                   LIFINAFYNLFDFIATMIATSGPAAGNHSRLCQFQGFCLQMFPMADVLWTLAMACDVFL
FT                   VVYYQFDVRALRKLEIWYIAIITSLVSIPAIVFLFIHTPEKGPMYGGATLWCSISPEWV
FT                   VFRVVFYYGPIWFLILIVLLFYILVGIKVVKLRHQFNISHTDHIALSSNISNNNPAFDQ
FT                   PRNTVAVTVQIDIQSQPAAHDSSSPSEPKPHPSRNDPSSHNVNPGQKRSKHTNVSFRQY
FT                   ILMPMVFFLVLLATWVAPTINRLSALVDPSHVSYPLLLAVGAMGSLRGFWNGVVFITLG
FT                   MKGWKREMQLKLIEA"
FT   CDS_pept        175706..176905
FT                   /codon_start=1
FT                   /gene_family="HOG000217674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262111"
FT                   /orf_name="AFUA_3G00790"
FT                   /product="Methylaspartate ammonia-lyase, putative "
FT                   /EC_number="4.3.1.2"
FT                   /function="methylaspartate ammonia-lyase activity "
FT                   /protein_id="EAL86362.1"
FT                   /db_xref="GO:0050096"
FT                   /db_xref="HOGENOM:HBG053769"
FT                   /db_xref="HOGENOM:HBG305006"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR006395"
FT                   /db_xref="InterPro:IPR022662"
FT                   /db_xref="InterPro:IPR022665"
FT                   /db_xref="UniParc:UPI000052034A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW5"
FT                   /transl_table=1
FT                   /translation="MKPTDVQFVIGLSGYFVKDLEAVRRSPAYDPLRDDIPPCTPGFRS
FT                   VVQAGQVISIILHLPCGGIAVGDSVDVIFSGAASREPWLLSCDLSHFRHNAERVDLPWT
FT                   ELHGRRLHSAIRYGLTQALLAATALAQRRTIAEVICHEWSLGSIADRPVDILASCHRND
FT                   ALQLDRMIMKKAPMLPHASFVHASDIGPHGMVLMDYVDTVARRIRQRAPPGYHPRLHFD
FT                   VYGTLGDVFPETTRLADFLGRLRQRARPYALLIESPIIAPSKPAQIQRLAALRACLKRK
FT                   SIDVRIVADEWCNTLPDIRDFADADAVDYVQIKMPDLGGVDQSIDAVLYCQGKGIGCCL
FT                   GGSANETDVSARITAQVALATRPDFLLSKPGIGADEGLMILTNEMLRGIALAKRAHCKL
FT                   "
FT   CDS_pept        join(complement(178457..178550),complement(177333..178252))
FT                   /codon_start=1
FT                   /gene_family="HOG000217675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750545"
FT                   /orf_name="AFUA_3G00800"
FT                   /product="Oxidoreductase, 2OG-Fe(II) oxygenase family,
FT                   putative"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86363.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053776"
FT                   /db_xref="HOGENOM:HBG447631"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000051F7BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW4"
FT                   /transl_table=1
FT                   /translation="MATQATQLNFPLAASTEPLEQYVHPPETKQDSFFYVTNFGLTQEQ
FT                   VDRQFAIAKEFFSLPEEERRSFRAPLEEGIYNGYRPLGSIEILPGLRDNIEFYNIMKFL
FT                   PQYERTHPDVIRRHWAEIEKFHRHVHEHIAYRLFRLLAIVLEIPEDELEKGHLYDSNCD
FT                   SGLRYMCYRARSAEENEKYKSLYSRGHTDNGTITFVFQQPVAGLQVKKHDDSEWEYLRI
FT                   PSGTIAVNIADLLSILSNGYLKSGVHRVITPPKDQQHLDRLGVLYFVRPSDRLTLRTVD
FT                   SPLLRRLGYYKEGITEINIPAPEWTRARIKKNWTRSPTDPNEGTSMAGFSVKHFHD"
FT   tRNA            complement(178975..179048)
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        join(complement(180771..180966),complement(180548..180711),
FT                   complement(180264..180498),complement(180123..180205))
FT                   /codon_start=1
FT                   /gene_family="HOG000204543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055844"
FT                   /orf_name="AFUA_3G00810"
FT                   /product="Cholestenol delta-isomerase, putative "
FT                   /EC_number="5.3.3.5"
FT                   /function="cholestenol delta-isomerase activity "
FT                   /biological_process="sterol metabolic process"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86364.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016125"
FT                   /db_xref="GO:0047750"
FT                   /db_xref="HOGENOM:HBG196250"
FT                   /db_xref="HOGENOM:HBG590959"
FT                   /db_xref="InterPro:IPR007905"
FT                   /db_xref="UniParc:UPI000052033D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW3"
FT                   /transl_table=1
FT                   /translation="MIPHYYYPPTIRLPHYSANETSVLSLITQFGFLWAAVLGIAFIVI
FT                   RRTRPTVSRSDQLSFIWMCLTGFIHLFFEAYFVTHHESLAGAQQLFGQLWKEYSLSDSR
FT                   YLTSDAFLVSMEAVTAFCWGPLAFFIAYCIAVQHPLRHALQLIMSTGQVYGDVLYYATS
FT                   LFDLYFHGVIFCRPERYYFWFYYFFMNFIWIAIPSYHVYQSVVEITRAFRRLGELDQRQ
FT                   KGK"
FT   CDS_pept        complement(181481..182728)
FT                   /codon_start=1
FT                   /gene_family="HOG000217676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750546"
FT                   /orf_name="AFUA_3G00820"
FT                   /product="Putative exported protein "
FT                   /function="poly(beta-D-mannuronate) lyase activity "
FT                   /biological_process="alginic acid catabolic process "
FT                   /cellular_component="periplasmic space"
FT                   /protein_id="EAL86365.1"
FT                   /db_xref="GO:0042122"
FT                   /db_xref="GO:0042597"
FT                   /db_xref="GO:0045135"
FT                   /db_xref="HOGENOM:HBG053788"
FT                   /db_xref="HOGENOM:HBG757003"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniParc:UPI000051F793"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW2"
FT                   /transl_table=1
FT                   /translation="MKFLQMSCLSLLVSLSSSLSLPDGHGRHDIIPKTVVIDGTRLVEN
FT                   KLRLRAGDASLTAALGHLTAEADRWLSQGPWSVTAKTQAPPNGTIHDYASQAPYWWPSN
FT                   TTDGCPYVNRDGERNPEVEKYPDHSGRDSMFRSSYILSLAWYYTGQAKYAQRASLILQT
FT                   WFIDPATAMTPNLRHAQIIPCRNDGRSIGIIDFSMEYSNVLDAAVILASTNAPGWTRAN
FT                   QRAFMNWNRQFLDWLVNSPFGKEEASQENNHGTFANMQIAALALFTGNTSLSRKTSQGA
FT                   KSLIDLQIRPNGSQPMELARTRSWHYSNFNLGAHLRFALVAKKVGVDLFGYKGPDGQSL
FT                   FGATNFLLKAVVEGKSAWEFEELEFKPYAATDNVHAAADAGDSRAKAAVPRLPPPPTGD
FT                   IYLLRPAAEQLDNIAG"
FT   CDS_pept        join(complement(189873..190854),complement(189259..189796),
FT                   complement(185510..189185))
FT                   /codon_start=1
FT                   /gene_family="HOG000234473" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207128"
FT                   /orf_name="AFUA_3G00830"
FT                   /product="Pfs domain protein"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="EAL86366.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG053798"
FT                   /db_xref="HOGENOM:HBG329848"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniParc:UPI000051FA20"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW1"
FT                   /transl_table=1
FT                   /translation="METPARSPFANDEYTVGWICGLASELAAAQSMMDKVHGEPQTPPA
FT                   EADNNVYMLGSMGKFKVVAACLPIQHPSTEAVVKKMLVTFPRIRVGLLVGIGAGIPNHD
FT                   NDADICLGDVVMSSSPKTGGVISYDSGKALADGSFESLSVSNSPPMPLHSASAKLQSQY
FT                   KMEGGRAADYIEQMRRRFPQICSMKGSDPGDPADRLFQPSCPHAGGDSCTECAPSAEIS
FT                   REPRPDGIPRSHYRTIESGDRAIKDAPTRDLIQDRDGAIIFERETTGLMDNLPLMVIRG
FT                   IGDYTNSHKEVRWQAFAAAAFARGFLDHVQPEAIEAEPAAINTMYHDLGAPIRDGPAES
FT                   RNVVGASVDSESVPIQDAAPSLTAVTFTDSGYASTKDWEYGKVRPGNVAGVSQLEDEHW
FT                   ARSVDPSDAVTGAGRDPMEVAEDTERAEVRSVYSYASSISNEKKERFISELAEEFANVV
FT                   QPYRPDEQSWHRISQLLPELLRGFAFRFGHNAPSQMHRDVMVFIHKQRRNVAAAFMDRC
FT                   SAYNSADVNGRDCMEMSLSEKIALWDRMIERGAECERGLDSMMDIVQRRETPEGEADDE
FT                   DQEDDDDIPDLIVYRKIVLGAPAFKTLVATLQRECLLVTPELDFMREIGQKLLECLPLS
FT                   PRISRRRSAESFKVKCTVSWDPITFLITQEYTPQPATAFETAITLTGSNRIAQALPCGQ
FT                   YLSQTWPSTGEQIMGLIKGLIRKGFHNPQSGILHDGTEIVAELQGAIGDSSSMLYSEVT
FT                   GTAYSIIEVVEQLAWLGAALRSSPIESGVVYCRPVVDCSWAVQDEGEATRRVEYHCKID
FT                   YTLRMGEDNPIHLNGLCWHHLFRNPVVVEGYPIARRPKSTTDTGLEIPLNMMAGLAQAH
FT                   RLSTFNSRTVLKGWSTMLVPTEQHDGLVFWHLMHHPEGKRMSFDTCNTFPPTNVCLPAL
FT                   EKARHVLGWCAEMQFFGGAADASYNVRRSRLPETSEDCMLDKAYLSSGHMISGGHPFSI
FT                   GRKDIPLHISRHSYIRKLRWIAQKFVILWDEGDKRGWLVNGTSALLHLVRAAMKQASVD
FT                   RFQSYLLFDADKLRESRRSHEPTAAIDVLMDPSNRALKVYHEKDDSIHFESQVEHFYDL
FT                   LEKIIDHQQNTAGKGGRNCNTIPRAYLEGWDFHELVVEVDPVHPRVAVLESIGKSWVDF
FT                   ARSIHAVTLFGRGFGEIIKPPTGTCWQWARLPKWRYYLSACMSDLKDIMQTRGDPDSIP
FT                   MELVDNILWQNSDSFLAPCRCKGDDGETHSDFAQVLLPSSMAREMLQNVTRTADLNSGG
FT                   AVIFGQNREVEWFWDDTGEPCRKEEAIPSQAFPGSPSHDSGIGRSVASLTSTTGESMAG
FT                   LCSSQPSVNGLSDGPQPGNAGSEGTGVLSITTLDERLQHLVPEDYKVGIVCPLYLELMA
FT                   VRTLFDSEHEALTITDHDPNYYALGRIGRHNVVAACLPDGEYGTNSATSVAWNMKRTFT
FT                   GVRFCLLVGIGGGVPSSENDIRLGDVVVSRPTGTLGGVLNYELGKALGKGGFQPQGCLP
FT                   PAPGHLMSALSDLRSDPRLSSTPLQPYLEQIASKNPAYKHPGSGKDRLFTSDNIHVEQS
FT                   GRRGNCESCVSQGEVERPPRLSTHPKIHYGLIASGNKVVRDAEMRDQVANQHNALCFEM
FT                   EAAGVMLALPCLVIRGICDYADSHKNKIWQEYAAGAAAAYAKLLLSRLRPSPGQLEDER
FT                   AECHSVSRLQRPKRARTVSTAAIEPSSGLKKVRR"
FT   CDS_pept        join(complement(193326..193601),complement(192632..193243),
FT                   complement(191941..192576))
FT                   /codon_start=1
FT                   /gene_family="HOG000217682" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750547"
FT                   /orf_name="AFUA_3G00840"
FT                   /product="FAD-dependent oxygenase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86367.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG053806"
FT                   /db_xref="HOGENOM:HBG331463"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000051EDB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFW0"
FT                   /transl_table=1
FT                   /translation="MRWLKIEAVAALAASAVPAFCLSVPVARDLRGICPRGDDDLKELG
FT                   AKLSRTGKIYFPGSTEFEQASTRWSVLETPTVNVVVVPGTENDVVETVKYANKKNLPFL
FT                   AYNGVHGAITTLGRMDHGIEIYLNQLSGVEISKDGKTAKIGGGTKSKLVTDQLWAAGKQ
FT                   TVTGTCECVSYLGPALGGGHGWLQGHHGLVADQFVSANIVLANGSLKTIDAKSDLWWAL
FT                   NGAGHNFGIVTSVTTKIYDIQHADWAIDTLIFSGDKVEAVYQAANEHLLKNGTQPVDLI
FT                   NWSYWLNIPTADPNNPVILFYIIQEGVKTVDPAYTKPFHDIGPLSAEAIGGSYTDLAGW
FT                   TGIATTSPPCQKAGLVNPRFPIYLREYNVPAQKTAYDIFAAATRGSSAFNNSIFMFEGY
FT                   STQGVKAINSKSSAFAFRNENLLAAPLVTYAPAGPERDNDAKQLGNQLRQILFQASGLN
FT                   EIGAYVNYAYGDETPQQWYGSEQWRQDRLRALKKKYDPAGKFSFYGPIA"
FT   CDS_pept        join(194215..194394,194454..194581,194641..194740,
FT                   194797..194938,195002..195210,195283..195732)
FT                   /codon_start=1
FT                   /gene_family="HOG000178988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262112"
FT                   /orf_name="AFUA_3G00850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86368.2"
FT                   /db_xref="HOGENOM:HBG053817"
FT                   /db_xref="HOGENOM:HBG324206"
FT                   /db_xref="UniParc:UPI0000F51C62"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFV9"
FT                   /transl_table=1
FT                   /translation="MSTDSAADEAARAALHKPTVEHWTLYAIGVTLTLLRTYARVRAVG
FT                   FRHLQAEDLLVWVGIIFYTVQTALAYSVGRVAHGLANNGLTDAQRAALSPDDPEYRAAV
FT                   IGSKIQVAGWTTYSVLMWSLKLSMLAFYLRLTDGLGQRYRNPIYVGFGLVIATFLVSVI
FT                   TIFSACRPFHKYWQINPDPGNACQAAVSDPIIWASFASNVSTDIYLILIPIPMLWKSRL
FT                   KLIKKIAATVVFGAGLFVLVCAILKSVFVLVDPIDGAQLAGEWGNREAFVAVVTTNLPM
FT                   IFHLLRSWLTRLFGTAFGSSEKTYKFPSGFQTIGGGAGESSSRKRRAQRTVHPISANLT
FT                   FSESEERIVDNVKMNDLEAFGAPSTRRDHSPGGIVVSNQVEITHEDRNSHLGESDQPRG
FT                   GNW"
FT   CDS_pept        complement(197609..198154)
FT                   /codon_start=1
FT                   /gene_family="HOG000123284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055845"
FT                   /orf_name="AFUA_3G00865"
FT                   /product="Putative uncharacterized protein "
FT                   /function="FMN binding"
FT                   /protein_id="EBA27270.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG324209"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0000F51CA8"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y9"
FT                   /transl_table=1
FT                   /translation="MGHSVISPAIFYWGTPVVLATTVNKDGTPNIAPISSAWWLGNRAV
FT                   LGLGRSSQTIANIIRTRQCVLNLPGDDMVQCVNALARTTGAKDVPASKTQRGYRDEKDK
FT                   FGIAGLTPESSHLVQPPRIQECPVQMEAEVAGTHELFKDGPIELQGCVMAIEVKILRTY
FT                   VREELRLAAYANRIDPDK"
FT   CDS_pept        complement(198637..199110)
FT                   /codon_start=1
FT                   /gene_family="HOG000296051" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262113"
FT                   /orf_name="AFUA_3G00870"
FT                   /product="GNAT family N-acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EBA27271.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG477226"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000F51C8B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z0"
FT                   /transl_table=1
FT                   /translation="MSSSIPPLPPNYRLHDGYPAVADYLHLRAASGLTPKTKAQATVVA
FT                   QGSWYGCYVTFEDESSGTSTPVGMGRIIGDGGWYFHIADMAVLPDHQRKGLGDIILKTL
FT                   LAKIRSEAPEGKPYVNLLADPPGRKLYAKNGFVESAPKELGMMMVMDRGEPST"
FT   CDS_pept        join(201596..201720,201771..201902,201956..202209,
FT                   202269..202417)
FT                   /codon_start=1
FT                   /gene_family="HOG000179228" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI20750548"
FT                   /orf_name="AFUA_3G00880"
FT                   /product="UPF0619 GPI-anchored membrane protein
FT                   AFUA_3G00880"
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL86371.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG053839"
FT                   /db_xref="HOGENOM:HBG325093"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI000051EB76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFV6"
FT                   /transl_table=1
FT                   /translation="MRFALTLTAFVGSVAALSITSPKKDQDVDLSEKTTIEWSSVSSDP
FT                   SSFDIYLVKMNSYPPVNKLVAENVKTSEGSYTIDGVSADNGSGYQINFVSRDPQNTGIL
FT                   AQSQQFKVESSGSSTTSDSTSSASATGSASTSSSSTGTVSSTASASATASASATASSTL
FT                   SKSASGTASKTASATGSETSGASASSTSSPTTTPNGAGSLTVPAGSLLLGLVALAL"
FT   sig_peptide     201596..201643
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFV6 "
FT   mat_peptide     join(201644..201720,201771..201902,201956..202209,
FT                   202269..202351)
FT                   /product="UPF0619 GPI-anchored membrane protein
FT                   AFUA_3G00880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFV6 "
FT   pro_peptide     202352..202414
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFV6 "
FT   CDS_pept        join(complement(204232..205245),complement(203484..204155))
FT                   /codon_start=1
FT                   /gene_family="HOG000165530" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262114"
FT                   /orf_name="AFUA_3G00900"
FT                   /product="Alpha-amylase, putative "
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL86373.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG324773"
FT                   /db_xref="HOGENOM:HBG434453"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00005207EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFV4"
FT                   /transl_table=1
FT                   /translation="MSSLSISRRCMHIVSLSLLVASSLAANTAQWKSRAIYQTMTDRFG
FT                   RTDGSTTARCVASENIRCGGTWRGTIDHLDYIQGMGFDAVMISPVVKNVEGRVSYGEAY
FT                   HGYWPEDIYSLNPHFGTKQDLLDLSAEVHKRGMFLMVDTVINNMAYITNGSDPATHIKY
FT                   STLTPFDSSSYYHPYCKIEDWNNFTQAQWCQTGDNVVALPDLYTEHPDVQSILEKWAQD
FT                   MISTYSIDGLRIDAAKHVNTGFLANFGKALSDTFMTGEVYQQEVDIICDYKNNYITSVP
FT                   NFPVYFSVIEAFTKGNTSSLANIVEVMKNSCHDVTSMTTFTESHDVNRFANMTSDMALA
FT                   KNVLTFNILFDGIPIIYQGQEQHFNGAYYANNSNREAVWLSGYNTDAELYKLAAKLNRL
FT                   RKHVYNLDNNYLDIETYPIYQGSSELAFRKGVEGRQTIMLLSTQGANQKEPYDLYMPVS
FT                   FNPGVVAMDVLNCVNYTVNRAGQLVVPMDKGEPRVFFPANLMPGSGLCGFSDTNISYVE
FT                   LKTGKPASSGSAKVFSMTPAGIPVTILFSVLVSLVSGLGFGLGC"
FT   CDS_pept        join(210186..210542,210599..210774,210826..216992,
FT                   217046..217559,217618..217666)
FT                   /codon_start=1
FT                   /gene_family="HOG000163916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262115"
FT                   /orf_name="AFUA_3G00910"
FT                   /product="Alpha-1,3-glucan synthase Ags1 "
FT                   /EC_number="2.4.1.183"
FT                   /function="alpha-1,3-glucan synthase activity"
FT                   /function="cation binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86374.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0047657"
FT                   /db_xref="HOGENOM:HBG051156"
FT                   /db_xref="HOGENOM:HBG326621"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00005207F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFV3"
FT                   /transl_table=1
FT                   /translation="MKWGWTGALLAWFATTTSCWPYDESLVGYNLNENKEAKSPVEYWG
FT                   EWPDHKGKYFPSPENWRFPFYTLFLDRFVNGDPENDNINGTQFEHDISSNQMRHGGDVA
FT                   GLVATLDYLQGMGIKGIYLAGTILMNQPWGADGYSTLDTTLLDQHFGNIDTWRNAITEI
FT                   HKRGMYVIFDNTIATMGDLIGFEGYLNTTTPFSVKEHKALWKTDRRYVDFDIGNDYNST
FT                   CDYPRFWYEDGLPLPSEQADQLVGCYNSDFDQYGDIEAFGVFPDWQRQLAKFASVQDRL
FT                   REWIPSVRERLIRHSCIIIASLDIDGFRYDKATQATVDALGEMSMAYRECARAVGKNNF
FT                   FISGEITGGDYFGSIYLGRGRQQNQWLPDPSQGPKMTNESSAQYFLREAGHEALDSAAF
FT                   HYSVYRTLTRFLGMDGNLAAGYDVPLDWVDMWRQMLRSNDLVNANTGKFDPRHMYGATN
FT                   QDVFRWPTVQWGVERQLLGSYITTLLLPGIPLLLWGEEQAFYVLDATATNYIYGRQAMS
FT                   PATAWRDHGCFSLNSSQYYKWPIQAGREGCHDDTVAYDHRDPSHPVRNILKHMYQLREQ
FT                   FPVLNDGYTLNNLSKSTFPVQYPGSNGTETETGMWSVSREANLEVQDFGSDDLNSPVWM
FT                   VYQNDNHTVDYKFDCNSETDALIAPYPADTVVKNLFYPWDEFTLTAGPTKRTFGNATLP
FT                   AGCYGNLTLKAFEFRAYVPKKLHRKPRPMITKFSPGHDVPIASTVAPDASENVPIELHF
FT                   SEEMDCDGVTKSISLTSSTESLKVPSIDAGSVHCERITNFNTSWTAQIPSMWKWQATLT
FT                   NVYNGIHQITVKEPKTSSGNASTNSTDHFLFRIGQVDNPMVFTRANYSTSLLHEYENGT
FT                   LFIQHHAAGADKYRYSTNWGTTWSSWTKYHGGNDTIEELPWQGTKEQRWEGKHVRVEYW
FT                   SGLTGSSDYYQEGDVGWPHQVPRRFPHIHFNGPFNQFGYDGGLPNKLKLDTTTGHWKYH
FT                   FTYEWPAQAQINVWGMNPDGRPDQSWVLGDIDGDHVLDRMPPSSLSATMINITDLPPSP
FT                   HLAWIISINDGTMRYTLEPTGDQSTQMAMYILFWIVPLLTGAVCVYVFMKSFYQVKFNQ
FT                   VGVSEKRTLIPLALRRKLKRARNGEGEAMNPLMRLANKSGFLQSATDLTAASGGSKRRM
FT                   VLIATMEYDIEDWAIKIKIGGLGVMAQLMGKTLGHQDLIWVVPCVGGVDYPVDRPAEPM
FT                   IVTILGKPYEVQVQYHILQNITYVLLDAPVFRQQSKSEPYPPRMDDLDSAIYYSAWNQC
FT                   IAQTIKRFPIDLYHINDYHGSLAPLYLLPQTIPACLSLHNAEFQGLWPMRTEKEKEEVC
FT                   SVFNLDKEITRRYVQFGEVFNLLHAGASYLRVHQQGFGAVGVSKKYGKRSYARYPIFWG
FT                   LKKVGNLPNPDPSDVGEWNKEKALAKSEDPPVDQEFEAGRAELKRQAQEWAGLEQNPDA
FT                   DLLVFVGRWSMQKGVDLIADVMPAVLEARPNVQLICVGPVIDLYGKFAALKLDRMMKVY
FT                   PGRVFSRPQFTALPPYIFSGAEFALIPSRDEPFGLVAVEFGRKGALGIGARVGGLGQMP
FT                   GWWYNVESMTTAHLLHQFKLAIEGALNSKPEVRAKMRARSAKQRFPVAQWIEDLEILQS
FT                   TSIRIHNKEASKSNNRPVTPTGPMTPRGLGTMSPTFPGSGTQTPVGTHSREASYVNLRQ
FT                   LSEIGPQQRDTIISYSNNNAGREMTEKPAPGLSRKLSLGVRSGPGHINRPGRRGQGQQD
FT                   LALPDRRDGGDVSDIEEESDEDFIDQYYGDEEYTLTPEQAEEGRRLQNNPQSQSGRATP
FT                   RELTRSSQFPSSPSVHSDMGLAPPTRPFLEPGNRLSSASVLSVDSVVGDKKDFKLQKVD
FT                   PFFTDSHGEYARLFENSLENLNAANSETQLCIEEFLVKSEKEWFDKFRDAKLGRLNSPA
FT                   PSVFRGKRGPSPVDSYYGDDASSRMSPDDEQSQEDDEFLLGKDYVPPTGLRKWMQLRIG
FT                   DWPVYSLLLGLGQIIAANSYQITLLTGEVGQTAEKLYGIATTYLITSILWWFVFRYFKS
FT                   IVCLSVPWFFYGLAFLLIGLAHFDHNEFSRGWIQNVASGFYATASSSGSIFFALNFGDE
FT                   SGAPVKEWVFRACVIQGTQQAYVIALWYWGSTLTKASSQGLLTAETNIANTWKMTAICV
FT                   PITVFLWCVGLLMFFGLPNYYRQSPGKVPSFYRSVFRRKIVIWNFAVVIIQNFFLSAPY
FT                   GRNWNFLWSSAHAKTWQIVILCIVFFGFVWAGFLFVLSHLSKKHSWILPVFACGLGAPR
FT                   WAQIWWGVSGIGYYMPWVAGGLTGGALASRSIWLWLGVLDAIQGLGFGMILLQTLTRMH
FT                   MCFTLIVCQVLGSIATICARAFAPNNVGPGPISPDPTYGASAVANAWFWIALIFQLLIC
FT                   AGFLLFFRREQLAKP"
FT   CDS_pept        join(218497..219336,219393..219629)
FT                   /codon_start=1
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055846"
FT                   /orf_name="AFUA_3G00920"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86375.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053869"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051FA21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFV2"
FT                   /transl_table=1
FT                   /translation="MAVVQGKCARGRLYSSLSSCPFALDGHLGETSTLSASSYKSSISS
FT                   FFLGLSSQSSTQHTMASDNDDTIYFYNPSLGASILFTILYIIPLIYQSYMTLVYPRKAH
FT                   TPRANYFIPMVIGAALEVAGYAVRCASVRKPADIALYAVSSTIIVIAPVFVCASLYMLL
FT                   GKLETSSDSGAKQPPAAFLCGGSGRRLPWMFVTLDILAVLTQGSGSGIASSEDWEGSTK
FT                   DVGIGVLIGGLVLQVVTFATYLVIVAWFQWRVMAEGHQLPHGVRMVLKGVYLAGFFIML
FT                   RSIYRVFEFAFGIDSYTFTHEWPLYVLEAVPMLVALLVLGWFHPARWLAMSAPEGEEQV
FT                   YSLRKSAGRGNTGEQSLA"
FT   CDS_pept        join(complement(221134..221331),complement(220787..221083),
FT                   complement(219804..220733))
FT                   /codon_start=1
FT                   /gene_family="HOG000179239" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262116"
FT                   /orf_name="AFUA_3G00930"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86376.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053877"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E48D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFV1"
FT                   /transl_table=1
FT                   /translation="MDMHVPARSGGLSWSPDLKASNTTELQHRQKFQSEEQAKIMTNQR
FT                   QKRPHTKSRWGCYNCRARRVKCQETKPACENCMYRDLECVYPSKVREWVGAGKQTASRG
FT                   DALVASSPSGKPVPRSQGLAVSPFSRDDLRFFHHFLIAARPHLPFGSEETWATEVPRYA
FT                   HEYPHLMHAILALGATHYSLVSPNGSEYSSTALVHRGKALKELSAAIGKGPECTTTDMD
FT                   VILATCYALVFQAYHMHDGLVDFAVMVRGCGVITNCIVDKYQTSQLFHLQTEEEAAEVA
FT                   LSLADEPVSSPLLVDSLLAAIDRLQPLFQSAIHHRFFRALRETLAGLAISQRAAFVRLT
FT                   RIYAVWYKADNREFLTFIAPANHVSRALFMYFLVIELVMLPVYIRLRELSGTTLITTDL
FT                   TVRQWADAIYRELPSSIRELVELPMEIIAADENTARSTRGTRSDSVFPNLHAQFFDMET
FT                   AAWLGCAKPGGVGVLE"
FT   CDS_pept        join(222859..223699,223750..224321)
FT                   /codon_start=1
FT                   /gene_family="HOG000217334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750549"
FT                   /orf_name="AFUA_3G00940"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL86377.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG053883"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051FEDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFV0"
FT                   /transl_table=1
FT                   /translation="MEVDAAILFNELGTRYEDAYADSPGLLEVTEYVVGKLPRSSHVLD
FT                   VGCGTGKPVAAALASAGHTVYGIDVAENMVSIAASQVKGTFSRADMRTYTPPVKMDAVF
FT                   AIYSLFQIHPSDTHKMVYRFAEWLKADGILVLGVSPSSGLVGGTDVHDLVWDCMRCKAT
FT                   WMERPVSELYFSQTAWLNLLREAGFAVEVENMFDYVSKDPKHTRTETHYLIVGRKLEPQ
FT                   PLLGPYPWPEGLPGKSMRNEPAWRRLQGHLFLTDDERMKLSSMLEGHQRILDIGGGLED
FT                   FLDKASTANKSVETLAPLCNNLPYADAQFDCVIAALVLDSVDDLRGVLLEVVRVVDKSS
FT                   SNARVILVQGAPYNEVQKLVNAVCTPLSSKSIGPAHQGLLLHSAMKILADIGFGMTSLH
FT                   PLSTSYSFDDKSSSDRSNDLAEMLGNVWFPGEEKLAQMKQQLISPIENLLHDHPGFLQN
FT                   ELVILEAVLHAH"
FT   CDS_pept        complement(224772..225500)
FT                   /codon_start=1
FT                   /gene_family="HOG000217688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902539"
FT                   /orf_name="AFUA_3G00950"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL86378.1"
FT                   /db_xref="HOGENOM:HBG053894"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051EB93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU9"
FT                   /transl_table=1
FT                   /translation="MSPVVRSLLSSQYSHLLVRHRTPNQPGDNPTKLISQRPSPTITMQ
FT                   SRFKERLSYQGNPQELETFMKRKLERSTSVQESPKPEDPEKQTRQERTALHDAAEFGYP
FT                   NFALTFIEQGNDINAVDAKGRAPLHVAVQAGQEEVAHLLIKKGADVNVHDNDGLTPLHF
FT                   AVVLRSVALARLLVQAGAHPRAENAHGHTPFLFAYLFEEDEILECFAETSRPKAEAVPS
FT                   STLRGYLVNMRSWAKMRSML"
FT   CDS_pept        226637..227149
FT                   /codon_start=1
FT                   /gene_family="HOG000257431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262117"
FT                   /orf_name="AFUA_3G00960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86379.1"
FT                   /db_xref="HOGENOM:HBG173380"
FT                   /db_xref="HOGENOM:HBG401761"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="UniParc:UPI000051EDE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU8"
FT                   /transl_table=1
FT                   /translation="MTSSIYTYTVPTYLKGLDTLTFMLKKAEEYAKENNIPLSEFAEAR
FT                   LYPDMLPLSFQVQCVSNTSKNSVARLSGTDIVPMEDNEKTFEEFYDRINRTIDVIKAVD
FT                   PKLFEGREHTEFSVKLGSYESTFTGESYVNRFGLPNFFFHLNIAYAILRSKGVPLGKFD
FT                   YLKYFNS"
FT   CDS_pept        join(complement(227512..227846),complement(227320..227452))
FT                   /codon_start=1
FT                   /gene_family="HOG000179272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262118"
FT                   /orf_name="AFUA_3G00970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86380.1"
FT                   /db_xref="HOGENOM:HBG053903"
FT                   /db_xref="UniParc:UPI000051F530"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU7"
FT                   /transl_table=1
FT                   /translation="MPLFHRNSVSSSSSARSIEEPNQRSHGLFGGRNSHSSRSPRRSSG
FT                   SYSSGHTQRRSLLGRHHEDPSIAAAKEQVFRAESAEKAADHALRESRMAVREARDHVKR
FT                   LEHEAAEEARLAKHKQHQAKSISKRAKPLGRKSGLLTGYPCQLPLTMIGHV"
FT   CDS_pept        join(complement(231010..231178),complement(230904..230961),
FT                   complement(230717..230855),complement(230587..230665),
FT                   complement(230352..230538),complement(230197..230302),
FT                   complement(230020..230148),complement(229769..229929),
FT                   complement(229235..229724))
FT                   /codon_start=1
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750550"
FT                   /orf_name="AFUA_3G00980"
FT                   /product="MFS transporter Liz1/Seo1, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86381.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG191489"
FT                   /db_xref="HOGENOM:HBG398301"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051FA0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU6"
FT                   /transl_table=1
FT                   /translation="MAPPPVAINERAIVDNPQKLSKRKWLSYIWDTLDKSPEERKLLFK
FT                   LDTAILTFASLGYFIKYLDQVNINNAFVSGMKEDLSLYGNQLNYMQTCWTVGYVIGEIP
FT                   SNLLLTRIRPRYWIPAMELLWTILTFAMARCNTPTQFYVLRFFIGLAESTFYPGMQYII
FT                   GSWYRKDELAKRSCIFHTSGGIASMFSGYLMAGVYHLGGRGGFKGWQWLFIIDGVISLP
FT                   VALSGFFILPDVPEISNPWYLTKEDIALSQKRMQLEGRKNREPLTSKKLKRIFSSWHIY
FT                   LLTLLYMYCYNISVIPPPFIVYMLTKQIPQTLNQPQVLRRPDQRLPDYHWSSSSSDHSD
FT                   LCLDIGLHSRRQTLATHHLRRGKHRSPTPTPLSLTIQIINIISYTSLAIWDINTGWKWT
FT                   CYIIAGAGYGLSGLLMAYVFPFSVGVSQTEDNRWAHEICAEDNEERALVVGSMNEMAYV
FT                   FQAWLPQIVWRQVEAPEYRKGFVTVTVLSGILILATFVTVGLEKRER"
FT   CDS_pept        join(complement(233321..233454),complement(233146..233268),
FT                   complement(232826..233099),complement(232629..232775),
FT                   complement(231773..232573))
FT                   /codon_start=1
FT                   /gene_family="HOG000179305" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750551"
FT                   /orf_name="AFUA_3G01002"
FT                   /product="FAD dependent oxidoreductase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="EAL86382.2"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053917"
FT                   /db_xref="HOGENOM:HBG324218"
FT                   /db_xref="InterPro:IPR012143"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000F51C69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU5"
FT                   /transl_table=1
FT                   /translation="MTRRQIHHVAVIGAGISGVVSAGHLLAAGIEVTVFERNHAAGGVW
FT                   LYDERKPLEPVYPSVQPSRAEQHADALDVRDTRVLEHAPPGPCYEGLRNNVPTPLMRTK
FT                   LNAWPSGTPDFVSHVVMKKYIQDTSKKAGVDGVTIYGARVKKLCKQDGGWKVTWSTLRE
FT                   DDGSGVVQEEEHSETFDAVVVASGHYHAPRIPDIPGLPEAKALWPSRILHSKGYRRPDG
FT                   FENKNILLIGGGVSSTDIAREIGPIAKTVYQSTRNGEFDLSESVLPENGIRISEIARFE
FT                   LQNDKTLPEDAHLPLIVHLKSGQKLCGIDGIIICTGYHITLPFLPDYHDDVTSPADANE
FT                   TVLVTDGTQVHNLHKDIFYIPDPTLVFVGVPYYTATFTLFEFQAIAVAAFFSGVAQLPP
FT                   TEDMRAKYLARVKAKGSGRGFHSLRNVEEHYVADLLEWVNKARASRGLAAVEGHTKSWL
FT                   EAKEAQRERLKELLGGGTRRDSGVGEFPVLETCR"
FT   CDS_pept        join(234050..234493,234552..235093,235150..235330)
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263098"
FT                   /orf_name="AFUA_3G01010"
FT                   /product="Alpha-ketoglutarate-dependent taurine dioxygenase"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86384.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG176915"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI0000520592"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU3"
FT                   /transl_table=1
FT                   /translation="MAPAAIDPRIVDVAEPRKETLPLPPNARERLEKAGIDLSAGYPYR
FT                   PARPLYVDDVYNIRNYDRPHIDPGTRADPEKKALLSAAKEVIHLTKHIGTEIVGLQLKD
FT                   LNDKQKDELGLLIAERSVVFFRDQDISPQQQKELGEWFGEVEVHPQVPQVPGVPGVTVL
FT                   WPALQAAETPAAFRRPGGASRWHTDLVHERQPAGVTHLHNDTVPSIGGDTLWASGYAAY
FT                   EKLSPSFRQFIDGKTAIYRSAHPYLDRKHPEKGPVYVEREHPLVRVHPATGWKTLWVNR
FT                   AMTVRIVGLDKAESDVILGYLCDVYEKNIDIQVRFKWTPRTSALWDNRITIHNVSWDYE
FT                   GLEPRHGTRVTALAEKPFFDPKAPTRREKLGLLGPDEVEELANQLAKQ"
FT   CDS_pept        join(complement(236136..236417),complement(235568..236074))
FT                   /codon_start=1
FT                   /gene_family="HOG000179316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902818"
FT                   /orf_name="AFUA_3G01020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86385.1"
FT                   /db_xref="HOGENOM:HBG053940"
FT                   /db_xref="HOGENOM:HBG327260"
FT                   /db_xref="UniParc:UPI00005200F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU2"
FT                   /transl_table=1
FT                   /translation="MTAPSTRREHPKVKGAPDYDDPTYWDVKFATGKDVGEWLNSGEIL
FT                   IETTLSELDHRPQSSAIPRALHLGPGISKLGVKLSEAFRQRNWPGSCIVNVDFSAEAVR
FT                   IGRELESVKDSDLAMHWLQIDLRSWSDVAQLTNYAPFDVVVDKSTSDAIATSPSVTLTP
FT                   ESDTSSICPIISDILKGNVELTLSPVELLALHLVPLTQKGSTWVVLSYSNIRFDNLGYA
FT                   GKYWTVVSRTSLKAPQGQTSTFAHTPEVFHWAYVLRRNKS"
FT   CDS_pept        join(complement(240783..240954),complement(240060..240718))
FT                   /codon_start=1
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263099"
FT                   /orf_name="AFUA_3G01030"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86386.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123771"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051E92F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU1"
FT                   /transl_table=1
FT                   /translation="MAKLEPYRGDYYLWKYVPSIPAAVIFLLLFVCMTAFHFWKIWKTR
FT                   ARFCIPFAIGGLFEIIGYIGRIDSHGKTGQLGPYIIQSVFILLGPVLFAASVYMVLGRL
FT                   IRSIQAEKHSVIRVNWLTKIFVASDVLSFLIQGSGAGLMANGSRADMGNNIVIAGLVLQ
FT                   VLMFGLFMVTSFEFERRMHRAPGGHVLDADVPWKTHLHVLDAVSALILIRSVFRVIEYA
FT                   EGQDGYLLGHEWTMYIFDSVPMITAMALWAMWHPSVIQNAASRTHSQALDMRMG"
FT   CDS_pept        241866..242771
FT                   /codon_start=1
FT                   /gene_family="HOG000217387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263100"
FT                   /orf_name="AFUA_3G01040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86387.1"
FT                   /db_xref="HOGENOM:HBG053035"
FT                   /db_xref="HOGENOM:HBG331057"
FT                   /db_xref="UniParc:UPI00005200E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFU0"
FT                   /transl_table=1
FT                   /translation="MLHMELFHHLYTETFPELDRRKYADHFHSIMPHLLKAPYVVNELL
FT                   AFSALHLSTKHPERQGYYRTHAAQLQTHALAIFKETTLEVNQETCVPLFFFSAILGLHT
FT                   LCDVLVYRDNDFDQFVDKFVHCFRIQRGVRAICGKAWSLLHQSVVKPLLADGQSLYHFD
FT                   GRLGAGCEKLLRLVQAANLGATLTDIYKQAIEHLQTSTNALIAAGILAGSNHGNTAWPV
FT                   LVPPEYIDLLLQRRPEALVILAHYAILLHSCRDSWMFGDGGRFLIESIRDFLGPDWTEW
FT                   LEWPIKALDSPIEPLLQEFR"
FT   CDS_pept        complement(242858..244210)
FT                   /codon_start=1
FT                   /gene_family="HOG000179338" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207376"
FT                   /orf_name="AFUA_3G01050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86388.1"
FT                   /db_xref="HOGENOM:HBG053963"
FT                   /db_xref="UniParc:UPI0000520585"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT9"
FT                   /transl_table=1
FT                   /translation="MPTNEPGDVPPTYRIDLSRPPAERYVEVAKKYRNELRSLTTLFDS
FT                   LVESVAPNISLLWVKRLARLFLRRVYSDEETEEIRGISQATGIEMYLIVSLDVLLDALM
FT                   GCTSGAARTQDQETTPRMLHFRTLDWGMDALRRVLVRFEYVRSPDYETVLATNITYIGF
FT                   VGVLTGVRKGLSVSLNFRPNHDFSGWLGDLRFYGSHLLVMLGLRRSISSMLRQYIIVAE
FT                   DPRGPWFGRLLGVLARRRRRVEKPTLRSICQKVMRTPSTAAYLVLCDGAEAAVVEKDHR
FT                   TARMESSSSFIVATNNDFLGAELPSKDRDTDISFGAALTSGEPISMTDFIQDSKERRAC
FT                   MQAHWDKKVAQAGRLAHNVKPRHDPLRRTRSSRSRMADPPAGSTSASEGKESAKTSENP
FT                   EVAATPPEIIQWTAAYPTTNEMTHFSAVMDPTSGRVIWIRRFRDPLDFTIW"
FT   CDS_pept        join(244684..244691,244838..244863,244960..245075,
FT                   245250..245271,245349..245476)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902819"
FT                   /orf_name="AFUA_3G01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86389.1"
FT                   /db_xref="HOGENOM:HBG053971"
FT                   /db_xref="UniParc:UPI000051E484"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT8"
FT                   /transl_table=1
FT                   /translation="MERFSTQSTGQVIYRGYTRSSTVCLGPIPGPTASLPPSVCTITSV
FT                   VRSILYALFVRFRGDDANVELNTVEHVNSVLGLEEDGSTYQFHMKKSASLGHRI"
FT   CDS_pept        join(249405..249589,249647..249809,249860..250125,
FT                   250178..250451,250511..250774)
FT                   /codon_start=1
FT                   /gene_family="HOG000158828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056092"
FT                   /orf_name="AFUA_3G01070"
FT                   /product="Tyrosinase, putative"
FT                   /EC_number="1.14.18.1"
FT                   /function="metal ion binding"
FT                   /function="monophenol monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86390.1"
FT                   /db_xref="GO:0004503"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053980"
FT                   /db_xref="HOGENOM:HBG330207"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniParc:UPI000051FC77"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT7"
FT                   /transl_table=1
FT                   /translation="MRFTILSTIAALAAVAPTAAFSIDQWDVLAGKALVNQVLYHFSNP
FT                   DASKSCTPLTATVRREWGSLSKRERKEYTDAVLCLASKPSKLDPAFAPGARSRYDDFVA
FT                   VHINQTWVIHGTGNFLTWHRYFTWAYEQALRNECGYTGYQPYWAWNKYADDPRNSPIFD
FT                   GSDYSMSGDGSYIPHDGSEAAPGIVLTPGNGGGCVFSGPFKNFTVNLGPVFPSLKVPGI
FT                   VAQNGSGLDYNPRCLRRDISEDAASWTTTEHVLDLIEKQNNILDFQNRMQGDFPNGFLG
FT                   VHSGGHYTIGGDPGGDFFVSPGDPAFYLHHAAIDRVFWTWQNQDPKSRTYVVAGQTILP
FT                   SLVPDAPNATLDDIVDMGSALAPPQTIRQLLDTTGGPFCYVYL"
FT   CDS_pept        join(251368..251586,251655..252376,252426..252653,
FT                   252700..253483)
FT                   /codon_start=1
FT                   /gene_family="HOG000179371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263101"
FT                   /orf_name="AFUA_3G01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86391.1"
FT                   /db_xref="HOGENOM:HBG053749"
FT                   /db_xref="HOGENOM:HBG331135"
FT                   /db_xref="InterPro:IPR021709"
FT                   /db_xref="UniParc:UPI000051FA14"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT6"
FT                   /transl_table=1
FT                   /translation="MSPIDVPGEFKDELRDEDKHDDVPPSSPGLAGPVLRRDAGRNRTK
FT                   PAPKAIAETLTPGLSDEDLWMLIRRFNKAAANTASEDLDLNRAQDEQFPPEKLRITIER
FT                   FYTSVVVELVGFCRHIARLRSWKEPRRTAVFCAVSYDTEFLMSELDLMRAVQGYFIAWL
FT                   LDVVIFTLSGLLIALILCPPLRRALFPGASPASTDLENSTPGDPRTQDSIIGTSERHKG
FT                   EAAEREAQNLVNNVATIAMKSATGKYGQAVPEDAEEVAEPESLADVVDAAEGLDESVTA
FT                   ESQKPMKRKVANATDEIMRTMNDITDTYEKFCNLLSPTPPFITYAPRLRLAGIMATVCL
FT                   LSLVVSSNFIIKATAFTLGLGFFGGPIINYSIEYLNRKIPNWREHLDLQQTLLKGIPTN
FT                   AQLTLTLLRIGEINSSPLPPPPVTDDKESSSLIRSKARALIASNTTPTAQENSGSTNSS
FT                   TDHQTGPAPKQRKKWFLKVLRFVRRTIATAIKSHGAFDRAMRIANSAHTRTLLELLAKK
FT                   DWFAASTGPLKFEAKFQRKRGTAVIDSAQEPPVMYFTTTQSASIDNLKLESQKKGSVLF
FT                   QIPVSDITELKKTEGLGWKGKLIVELTAGSKEAADGLVISASESEQAYHLTGMKARDQL
FT                   FNRLIAIDAQFWESC"
FT   CDS_pept        253707..254777
FT                   /codon_start=1
FT                   /gene_family="HOG000179382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263102"
FT                   /orf_name="AFUA_3G01090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86392.1"
FT                   /db_xref="HOGENOM:HBG053062"
FT                   /db_xref="UniParc:UPI000051FEDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT5"
FT                   /transl_table=1
FT                   /translation="MTAPDIHPPNFTSCLDQTQSSLFSIIPPEIRREIFAYALAACEDT
FT                   KNPYSQDTYWTRPGYDAPRRTYTELLRSCKRVYQEAWFMPFTYAEHAFYLTWRDRAPKQ
FT                   LSPMAFQQCLDLIHQMHGKVEAGRIRIFAQLFMLEKGHAMTALLDMTHFYPRSITLTIR
FT                   YTDFWLWEENQPLYISAEWVNRICFPESVRRFSIDFESIERRKDEVEYIANEAAEKWFF
FT                   RRKDGRLLTADKADMSVSQWTGSSILNGKRWLRDEVRPGQLDYYVVTVVWKVSPELAEA
FT                   PLPTPCPTVEVPQDFHQPEPPFPAAACVFVTELEDANIALDTPAEKTWSLLEAHRRAME
FT                   ETDEAAELQDEGMWSD"
FT   CDS_pept        join(257504..257569,257625..257816,257870..257995)
FT                   /codon_start=1
FT                   /gene_family="HOG000048389" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207377"
FT                   /orf_name="AFUA_3G01100"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL86393.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG539104"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051E6EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT4"
FT                   /transl_table=1
FT                   /translation="MTPAMLLPSLRKFKCPWAHCEKSFNRKSDLCRHHRIHTNERPYHC
FT                   TVKGCNKSFVQRSALTVHFRTHTGERPHACNFAGCEKAFSDSSSLARHRRTHTGTKLYN
FT                   CPERTCHKRYDSPLVQQGARTDD"
FT   CDS_pept        join(complement(261028..261096),complement(260878..260979),
FT                   complement(260781..260817),complement(260403..260729),
FT                   complement(260324..260349),complement(259731..260267),
FT                   complement(259651..259678),complement(259481..259596),
FT                   complement(259397..259428),complement(259188..259335),
FT                   complement(258945..259137),complement(258836..258894))
FT                   /codon_start=1
FT                   /gene_family="HOG000223964" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263103"
FT                   /gene_name="gua1"
FT                   /orf_name="AFUA_3G01110"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /function="ATP binding"
FT                   /function="GMP synthase (glutamine-hydrolyzing) activity "
FT                   /biological_process="GMP biosynthetic process"
FT                   /biological_process="glutamine metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL86394.1"
FT                   /db_xref="GO:0003922"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006177"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="HOGENOM:HBG049690"
FT                   /db_xref="HOGENOM:HBG391775"
FT                   /db_xref="HSSP:1GPM"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="UniParc:UPI000051EDBA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFT3"
FT                   /transl_table=1
FT                   /translation="MAEEQNPSATFDTILTLDFGSQYTHLITRRLREIGVYSEMLPCTQ
FT                   KLADLPFKPKGIILSGGPYSVYEDGAPHADPAVFELGVPVLGICYGLQEIAYRLGKDNV
FT                   VAGTAREYGHADLNAQRLDNQGHVDKLFAGLEEHVKVWMSHGDKLVKLPEGFHTIATTA
FT                   NSEYAGIAHETKPVYGIQFHPEVTHTPDGAKLLRNFAVDICGANPNWTMSKFVDQEILR
FT                   IRKLVGETDHVLGAVSGGVDSTVAAKLMKEAIGDRFHAVLVNNGCMRLNECETVAETLN
FT                   KHLGINLTVVDASKRFLDGLKGVTDPEKKRMFIGATFIDVFEEEAEKIEALAENSGAKV
FT                   KWFLQGTLYPDVIESISFKGPSATIKTHHNVGALPKRMIEGQGMKLIEPLRELFKDEVR
FT                   QLGRELGIAHELVMRHPFPGPGIAIRVLGEVTPERVDIARKADHIFISMIREAGLYDKI
FT                   SQAYAALDPSKAVGVMGDKRVYAEIIILRAVETTDCKLTLGIDGDFVLRYIISVMTARA
FT                   FPFDNEFLSKCATRIINEVHGVSRVLYDISSKPPATIEME"
FT   CDS_pept        join(262405..263112,263162..263387,263434..264038)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263104"
FT                   /orf_name="AFUA_3G01120"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86395.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EDBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT2"
FT                   /transl_table=1
FT                   /translation="MDCRASRSTGAAAMSCEKSICPLDLEKNLVVQVENPTSGCFVTDY
FT                   VTSHVVDWDGPDDFARPVNWHKKRKWLNVTSVAFLTFLTPLASSMVAPAGGLVIETFNI
FT                   TSESLASFVVSIYLVGFAVGPLVLGPLSEIYGRLRIYQACNAVFIVWNVACAVAPNVGS
FT                   LLAFRLFAGIAGSCPLTLGAGSIADLFVPEERGAAMSIYSMGPLMGPVVGPIAGGYLAE
FT                   AAGWRWIFWVISMAGGAVFAFSLVFQTETYEPVLLQRRVDQLRKEAGDMTLRSKLAPNI
FT                   SARDNFIRSIVRPTKMLFLSPIVAIFSVYLGIVYGYLYLLFTTITPVYQTTYQFSQGAA
FT                   GLTYLGIGVGSLIGLLIFGTISDKILIYLTKQNDGVREPEFRMPPLIPGSLFVPIGLFW
FT                   YGWSAEKQLHWMMPIVGTGFVGFGMLASFLPIQTYLVDAFSEHAASVTASMTVVRSLIG
FT                   AFLPLAGPAMYARLGLGWGNSMLGFIALTMLPLPVVFYYYGKKIRTYPAFQVTF"
FT   CDS_pept        join(complement(264491..264841),complement(264240..264431))
FT                   /codon_start=1
FT                   /gene_family="HOG000179404" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263105"
FT                   /orf_name="AFUA_3G01130"
FT                   /product="Cell wall protein, putative "
FT                   /protein_id="EAL86396.1"
FT                   /db_xref="HOGENOM:HBG053092"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI000051EDE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT1"
FT                   /transl_table=1
FT                   /translation="MVAIKSLFSALVATALISSTSALPVPNTVNDVVHSLDDTANKYTD
FT                   LDNAIKAFDGHPAGYTTITEREATVEVSLHRAIDAAHATASLSVEDSKFVMQALAKPYP
FT                   TFMGNLLADIVAKKPQVNDIGKSDDMLRILKNLSVLSSELPNALEKIVDAKDAEEIDGG
FT                   EKWVQGLFADAIKAYSQ"
FT   CDS_pept        join(267093..267268,267505..267712)
FT                   /codon_start=1
FT                   /gene_family="HOG000048388" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263106"
FT                   /orf_name="AFUA_3G01140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86397.1"
FT                   /db_xref="HOGENOM:HBG053101"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="UniParc:UPI000051FEDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFT0"
FT                   /transl_table=1
FT                   /translation="MFSNAKKLVWLSEEVAQHKVRGRHQASDTEGQKIQNTKAQTPLRT
FT                   KATAVNIALINFLGQHPGPTPGTEEPMVASVLASMITDFGDIYGNNMSIAKKLNVSDCE
FT                   QNIPNCRLQGGAWKYEHVSFEPA"
FT   CDS_pept        268275..268922
FT                   /codon_start=1
FT                   /gene_family="HOG000217689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902820"
FT                   /orf_name="AFUA_3G01150"
FT                   /product="GPI anchored cell wall protein, putative "
FT                   /protein_id="EAL86398.1"
FT                   /db_xref="HOGENOM:HBG053108"
FT                   /db_xref="UniParc:UPI000051E6E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS9"
FT                   /transl_table=1
FT                   /translation="MHSAFIVLAALAAAVFVEGTDVQVFQAGPTTLPLHAVKASVVNAN
FT                   AVATTLAIKCEGNVCTPGDHCGLCSPFTITQGPSTYSVSAVYSASVGGVEETHTVVQDC
FT                   DITSSTELATCTLSAKVEVSALGRKTATSSSATVTFHSDDIWYTPVLVTAGAEKLTASR
FT                   ATQSVSETTQTASTATQTAGNNDAVAVNAAPGNMGLGQVAVVVVAAAAIGLW"
FT   CDS_pept        join(complement(278054..278940),complement(277615..277983),
FT                   complement(275889..276191),complement(275712..275836),
FT                   complement(275321..275661))
FT                   /codon_start=1
FT                   /gene_family="HOG000048387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056093"
FT                   /orf_name="AFUA_3G01160"
FT                   /product="Iron-sulfur cluster-binding protein, rieske
FT                   family domain protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="cellulase activity"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="EAL86399.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053115"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000051E6F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS8"
FT                   /transl_table=1
FT                   /translation="MTEYDRPFSIELPAKRQAVTMAATVASWLGYIPSLAGDKELPDEP
FT                   PKALPASWYYSPEIYQLERRAIFSKRWILVTHKLRFTKPGDFLRFEEAGFSFVLCLDRE
FT                   GNLNGFHNICRHRAYPLVSEDEGNVKILSCKYHGWSYSLNGKLAKAPKFEVVPGFQKEN
FT                   QSLFPVHVHTDALGFIWVNLDSSPNPVPWEEDFDGVDRQERFQRFDFTQYKFDHTWQMT
FT                   GDYNWKTLADNYNECYHCTIAHPDVARLADLSYYYTVSTPGHIQHFSRPKPDKVDEDIQ
FT                   NASTYYFPNACMTVSPHFFYMMRCVPTSATSCSMEYEVYRHIEASDEDFEYIDSFFKRV
FT                   LDEDKHLCNAAQKNLNAGVFVNGQLHPDLESAPLFFQNTVRSLLKSHSDEERKINREIW
FT                   PARQHSAGQATAEDVAFCLGHYNFNMISFRQCLAIAALPLAHTALALNDISSRAQSATN
FT                   LCGDNDYIILESSPWIVYNMLYNAAQMVGTQCTNYDGMTTSDSGTKEVLWSSVTDIDYV
FT                   ASTNNVPKGYSFVGLTQNLETKLSAISSIPAVYNWTRTNITEFKGNICFDFMTNDVKGD
FT                   STSSSSRELMLWLQYEGGQLPIGWTNGPAATIDNLFGTSWTLYEDINTDTGITVSTLMP
FT                   TKQFEGSFSGDLKNWLLAMADLGRFTESTYVNVGNAGYL"
FT   CDS_pept        join(279744..279959,280012..281046)
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263107"
FT                   /orf_name="AFUA_3G01170"
FT                   /product="Cystathionine beta-lyase "
FT                   /function="lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL86400.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051E6FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS7"
FT                   /transl_table=1
FT                   /translation="MRSINASENRSKFIMTAEALNNALPDFHMATRAIHADDFVSPHRA
FT                   IAPGIHTAVNFRYARDPDELVPEENKDPNAPFDSHIYSRYTAPNANRLEVLLRSLMGGE
FT                   VITYSTGLSAFHAMLILLNPKRIFIGEGYHGCHSVVDIIHRLTGIQKLDLTQIDQAGPG
FT                   DIIHVETPLNPTGEARNLAYYRAKASEKGAYLTVDSTFAPPPLQNPLEFGADIVMHSGT
FT                   KYVGGHSDMLCGILVIHPRRVKEGWLKTLRTDRQYIGSVMGSFEGWLGIRSARTMQLRV
FT                   TRQAQTAERLAKWLQDQLKDETSPIAKVLSHIQHASLQEDDLKNGWLQKQMPGGFGPVF
FT                   AVWTKNPEHARRLPSRMFIFQHATSLGGVESLMEWRAMSDARCDHRLLRISCGIEEFDD
FT                   MKADILQGLESLLRDFP"
FT   CDS_pept        281528..282673
FT                   /codon_start=1
FT                   /gene_family="HOG000236097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902821"
FT                   /orf_name="AFUA_3G01180"
FT                   /product="Sarcosine oxidase, putative "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86401.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG473563"
FT                   /db_xref="HOGENOM:HBG589227"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000051F531"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS6"
FT                   /transl_table=1
FT                   /translation="MDHFDVAVVGLGVLGSGAAYYAAKKGAKVIAFEQFELGHVRGASH
FT                   DTSRIVRTSNFAPEYVALAKSAYKDWAELEKITGYQMLTTTGGVVFFAPDSPTSASDFT
FT                   RSLDTHDVPYELLDAQEVKRRWPQFNIPQSVSTVYTADSAIVHAAKTVSTLQSLARSHG
FT                   AILKDNTPVERLIPQASGGVIIETPKGQFHAGKVILATDAWINKLLAPLSVHIPVSVMQ
FT                   EQVTYFKPTDAGTFEPDRFPVWIWHGANCFYGFPCYGEPTMKAGRDYSNNLMTPEQRTF
FT                   VHSPQLLEQLTSFMNGFIPDQDRQPLRTITCQYTITPDRRFIISPLKNYPDIIVGLSAA
FT                   HAFKFAPAFGRVLAELAVDGRTDEDISLWGIPKGATRNEKL"
FT   CDS_pept        join(complement(284899..285158),complement(284479..284827))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263108"
FT                   /orf_name="AFUA_3G01190"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /EC_number="2.-.-.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL86402.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG053134"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F54A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS5"
FT                   /transl_table=1
FT                   /translation="MTVVRPMSRMMKRMLSLRTKPLQFPPAQCAPPIPQHELVDEEASP
FT                   AYNPKYFYPAKPGELLANHYQLLVKIGWGTRSTTWLAKDITRYRWQPERFVTLKIINNR
FT                   SLDEAYRERDIEEHISRQNPSHRGRAIIRTHLDSFEVTSSEGSHLCLAYEPMREPLWIL
FT                   QKRFVDQRLPLPIAKAYLLILLAGLDYLHSECGVVHTGR"
FT   tRNA            complement(289692..289763)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        complement(292868..293044)
FT                   /codon_start=1
FT                   /gene_family="HOG000179416" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263109"
FT                   /orf_name="AFUA_3G01196"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27272.1"
FT                   /db_xref="UniParc:UPI0000F51CBD"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z1"
FT                   /transl_table=1
FT                   /translation="MFITRGIPLVNFAVASSALAFQVFVLYPWHNQLDAEFKSLKEEHI
FT                   RVLNRMSQRTISQ"
FT   CDS_pept        join(296417..296614,296665..296701,296749..296816,
FT                   296871..297244,297294..297364,297420..297661)
FT                   /codon_start=1
FT                   /gene_family="HOG000158916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207378"
FT                   /orf_name="AFUA_3G01200"
FT                   /product="Integral membrane protein Pth11-like, putative "
FT                   /protein_id="EAL86403.2"
FT                   /db_xref="HOGENOM:HBG053139"
FT                   /db_xref="HOGENOM:HBG324080"
FT                   /db_xref="UniParc:UPI0000F51CC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS4"
FT                   /transl_table=1
FT                   /translation="MSLDQVSGNGTPGDFQHPNQNLRRSIIIALYFAFILSTAAVVLRL
FT                   VARKINGTRLYLDDYLILVALLFKYGCSIGVTILLFNGLGSHIDMIPEKNLEVYYQIGW
FT                   SNSFVYTGCILFVKLSILALYKRLFSVPRMIIFANAIAAFVILWALGIFLVGALMCLPV
FT                   EKFWKPSIEGSCIDANSFYYGQQIPNILTDLIILIMPLKVVWALPISKTQRLLLSGVFM
FT                   VGGLTLIFDIVRLVAMIEFTKAGPDITYNQVPVVVWTCIEAAVGITAACLPNLKPLFKV
FT                   AHRQFWSRIGSPSKEERSRRSHGLSDATTLYAYATQTQYSHHTECTKA"
FT   CDS_pept        298199..298960
FT                   /codon_start=1
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263110"
FT                   /orf_name="AFUA_3G01210"
FT                   /product="ThiJ/PfpI family protein "
FT                   /protein_id="EAL86404.1"
FT                   /db_xref="HOGENOM:HBG301781"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI000051E93C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS3"
FT                   /transl_table=1
FT                   /translation="MTGKKILIILTDAKSFPLKKTSGPDAGKTVEQPSGFFLMELAKPL
FT                   EKILAAGYEVTFASPKGLEPTPDPLSESLAAFAGNFYERRRENDLIDRMKRENGFSRPR
FT                   PLGTISDAELDSFAGVFIPGGHAPLSDLGSDKEVGRVLRHFHAKKKPTASICHGPIAFL
FT                   STKQAGDGSFIYKGYKITCWSDAEEKVMETMFGGEVKKVESSLRNEGAEMVEGPREKVG
FT                   NITVDRELVTGGNPLAANALGDQFLKMLSVH"
FT   CDS_pept        join(299545..300188,300240..300558,300611..300967)
FT                   /codon_start=1
FT                   /gene_family="HOG000179427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750786"
FT                   /orf_name="AFUA_3G01220"
FT                   /product="Aspartic-type endopeptidase, putative "
FT                   /EC_number="3.4.23.18"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL86405.2"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG053151"
FT                   /db_xref="HOGENOM:HBG324082"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI0000F51C71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS2"
FT                   /transl_table=1
FT                   /translation="MHFSIGSLFLYLIASASCTAASPQYIQRSRRTPFTTSTSKPSAFT
FT                   NPSTDTATTPYVLELTKINNKGNARSAVELNSQVRSGSANLVSFAEGVGFATSINIGNQ
FT                   TFEVVIDTGSSDLWVVRDGFICIDPVSRKEVAQSECRFGPAYAPNTTFHEVVGEFVDIK
FT                   YADGEILSGVIGTENVTLAGITVNQTIGVMDYAGWYGDGVTSGLMGLAYSSLASAYTTN
FT                   NRQPRLYNPIFATMYEQGLIDPIFSMVMNRNASNGTAAGYLTLGGLPPVDINGNFSTTP
FT                   ILITNIKGYPKDYDFYAVNIDGVALGNRSLPEAAGGIQYIIDSGTTLNYYPTPVADSVN
FT                   AAFIPPAVYNDYDGAYVVDCNATASVHGVMIGGSTFYINPTDMILPGGMDNSGNKTCIS
FT                   GINAGGDVGQGIFVLGGTFLRNVVAVFDVGAAEMRFAASA"
FT   CDS_pept        join(complement(302904..303234),complement(302589..302844),
FT                   complement(302287..302535),complement(302028..302239),
FT                   complement(301378..302004),complement(301161..301328),
FT                   complement(301080..301096))
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263111"
FT                   /orf_name="AFUA_3G01230"
FT                   /product="MFS sugar transporte, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86406.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG053158"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005207EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS1"
FT                   /transl_table=1
FT                   /translation="MRTQDVTPYPHCGSQSCRSLALVPSVVVYKSVISISRHDHRGYQA
FT                   YSLFTTAKYVNSEARQEALLRAHWGMADPLDHSKYREFETNSILRREQIACATDMTLFG
FT                   YDQGVFSGVVVTEDFLVVHDLVGPTKTKALSTVTAIYDVGCFLGSILAFIVSERLGRKK
FT                   SILLGTTIMAVGTILQASSYSLAQMFVGRVILGIGNGINTSTAPVWQTETATVKWRGKL
FT                   VILEMALNVSGFALVNWINYGLSFKGGALAWRLPIALQFFFIFILYATVPWLPESPRWL
FT                   LSHGHNEQALDVISRIEAKPVDDPYIITQYNEIEYSINYERENAVSWTDLLLRRQKTND
FT                   TKTLRRILLAVPRQVSLQLDGHWLTVHRNQYHVLLPSSGADQLCRPVKQHVTTPQCLQR
FT                   DILLCVCLCSSHHGGAVRSKRPNADVDLWPVCLFPDHHYPPSICGERPKVWYRFSGILL
FT                   SVLHCVWNRHAGCSLAVSDGDQFSSYADEGCGCLVCDELVCYYPLSGHCVCIFTMHRIT
FT                   NFVIVEITPIGIQNIGWKFWIVWTITNAASLPIIYYLYPETANRTLEDLDAYYRSNPPL
FT                   IVTGDPDAISTGRPLKYIQHEDEELQRQIKQRQATGEEDRLKR"
FT   CDS_pept        complement(303990..304430)
FT                   /codon_start=1
FT                   /gene_family="HOG000217692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263112"
FT                   /orf_name="AFUA_3G01240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86407.1"
FT                   /db_xref="HOGENOM:HBG053164"
FT                   /db_xref="UniParc:UPI000051F2B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFS0"
FT                   /transl_table=1
FT                   /translation="MFSFRPVNLPPHVLLTSTTVIGLGLYISLFRTSPLKPLTGRDVLV
FT                   PAPSTSRIADTNALLGVVACALQLPYFLSSYMPIEKNQWLHVTVPIRLFVTTALGVNVL
FT                   LRGRRMSEEGFWEFLALRVTDFVGAVMLGWELGRFDGMVSGF"
FT   CDS_pept        join(305174..305958,305974..306295)
FT                   /codon_start=1
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056094"
FT                   /orf_name="AFUA_3G01250"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86408.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053171"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51CB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR9"
FT                   /transl_table=1
FT                   /translation="MTIDSDLDQNSAHSIVVESVNPDGMSLDKSGTELYNAAVAFCRYE
FT                   SEQQLHLHTAHHRLSIPDLHIMASAAQTQCGNRPLLATTEICAGGTYIVTGANTGLGFE
FT                   AAKHLVGLEAAKVIVAVRNISAGEKAKKDIEESTGRIGVAEVWPLDLASYDSVKTFAQK
FT                   ATTELDRIDAVIENAAVAVSERVFAEGHSMSVTVNVLSTFLLAVLILPKMRETAERYGI
FT                   VPHLTLVTSLVGFDAKDLWDKIKDDPVNKVDGDDIPPMRTRVQTCLSGAEVTDEISTFQ
FT                   GLDNHGTTSSCTLLPVDRTGVVLNLVCPGLCKTDLSRNAPAQFREGLTERLEEYGRTAE
FT                   DGSRTLLHGAVAGNESHGCLLHSCEIGE"
FT   CDS_pept        308786..309535
FT                   /codon_start=1
FT                   /gene_family="HOG000217693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056095"
FT                   /orf_name="AFUA_3G01260"
FT                   /product="Acetyltransferase, GNAT family family "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL86409.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG053177"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00005207EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR8"
FT                   /transl_table=1
FT                   /translation="MTHRKYIPKPYTTPPQQMTRKSCYLEPTAAMSNIVLIPQEFPTVK
FT                   ERDKIVDLYKHLRLAGLKQDPEAFSATYETEAEFPHEKWLARIENPQARTFIALDDGET
FT                   VPSTGNALTALLSSEWLGTVTIVGPRLAFSSEIDLSAPWRVFEEGDRYTTPQADDRNVV
FT                   AVYMIAGMFVLPASRGMGNGRRLVEEAIRHTRGASPATEQTLLVLLVEANNEAARKLYE
FT                   RCGFQESNTEVVFGGQQTVGMVLNNGK"
FT   CDS_pept        join(310155..310210,310376..310419,310477..310620,
FT                   310689..310973,311032..311149,311207..311387)
FT                   /codon_start=1
FT                   /gene_family="HOG000213016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263113"
FT                   /orf_name="AFUA_3G01270"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /biological_process="ceramide metabolic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86410.2"
FT                   /db_xref="GO:0006672"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="HOGENOM:HBG053183"
FT                   /db_xref="HOGENOM:HBG324090"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniParc:UPI0000F51CC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR7"
FT                   /transl_table=1
FT                   /translation="MTLGGSETPFWGPITANSKYAAEFINTLTNVVYVIYAIYGLYHLW
FT                   QKPNVGFLRTVPYLGLMAVGLCSALFHISLNYHTQMLDDLSMMFTTTPVLHRVMTASAS
FT                   PGVTLIVGIVLGSTLLALVIYHLKTDELLLHSLFFVGSVTVIGVFTMRLINARTRAGSE
FT                   ARRQIWGMVRFGAGIFNLGYWLWMVDGWMCSYLKSTRQTVGLPWAFLLELHGCHTESAG
FT                   GTYVREGIGAYIFIAIIDHLVSGDNHKDIPRSLAWPAPWAAQSIFAGKGNNKI"
FT   CDS_pept        312071..312997
FT                   /codon_start=1
FT                   /gene_family="HOG000179092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750787"
FT                   /orf_name="AFUA_3G01280"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86411.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053190"
FT                   /db_xref="HOGENOM:HBG330453"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0000520327"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR6"
FT                   /transl_table=1
FT                   /translation="MISIGTHRLYLSISGPPRHNPPDPIVVFIAGAGDVASSYCAVQRL
FT                   VAPFSPLVLYDRSGLGRSESNPNAPSPTAMSAAAELHTLLKTANIPPPLILAAHSYGAI
FT                   IAREYLHSYSSDVAGMVLMDASTERNIELFQNPDLDLSAMIGNLKFSEVTGLRAAAQLS
FT                   REEWRVRAIDTARGVATSQAEAMVREEVCRALAEKEQFKKQALGDRPLSVIRCNGLMDY
FT                   RRLYEKAVEAGNGTDAQRAAFHELLEKWDGVDREMQEEQLRLSSRSRMVHLPDCGHNVH
FT                   MIRPEVVADEVRWVREQILGQKIESAL"
FT   CDS_pept        316915..318063
FT                   /codon_start=1
FT                   /gene_family="HOG000217694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263114"
FT                   /orf_name="AFUA_3G01290"
FT                   /product="AMID-like mitochondrial oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86412.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053199"
FT                   /db_xref="HOGENOM:HBG331392"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000051E92C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR5"
FT                   /transl_table=1
FT                   /translation="MTSTKTTVVIIGASFAGAPIAHSLLKDVKTVRVILINPSPTFYFC
FT                   IAGPRIVAKPTAFRPEQYLIPIESAFKKYPSGSFEFIQGRATAINPEDKSVIVDGQTTI
FT                   QFDYLVIAAGSTTPSTTRSDIPIPFKQSNADNMETLIKNAQQAISAASQIVIAGAGPIG
FT                   VELAGEVAEAAQKQGKSVKITLVSASDRVLPMLKTSGSKAAETLLTQKNVTIISSCKVT
FT                   DAVLSTNGTWNLSLSNGKQLSADLYIPTTGTLPNSSFVPQQWLDTHGWVKVNQELRVQG
FT                   GQNAPLPVYAAGDITNNSMRLSFKATEQAAVVAANIKNDILGSKYKRRVYDEGDSIMMM
FT                   VPVGASGGTGQLFGMTPWSFMVKAIKGKDFFVSKAPSFIAAS"
FT   CDS_pept        join(complement(320461..321038),complement(319812..319998))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056096"
FT                   /orf_name="AFUA_3G01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86413.1"
FT                   /db_xref="HOGENOM:HBG053207"
FT                   /db_xref="UniParc:UPI000051E91F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR4"
FT                   /transl_table=1
FT                   /translation="MSDKRSTLSKLKKSFRIPIRLRRNRHEEAIDALEGPLPPFLQAPP
FT                   PRADVQVLQKEWQFKERRTDLIEHLDSLYEKAYEFDKPLVDPTAYNKLKIRCETLDLGD
FT                   DGECENGIDVPNFFVPFPLETLMEHRIVTPDEETKRDYEAHEDIFDRTKNGFESRAPYF
FT                   RLIWHFECFRRSGIPDGPGRLIDITVWRKQLYDFSTPETLSSSTTLFMQWMASKTGGNT
FT                   SGFPLEDFEPFEEDDDTELFGKKEIEKISDAP"
FT   CDS_pept        join(322936..323009,323065..323296)
FT                   /codon_start=1
FT                   /gene_family="HOG000217695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263115"
FT                   /orf_name="AFUA_3G01310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86414.1"
FT                   /db_xref="HOGENOM:HBG053214"
FT                   /db_xref="UniParc:UPI000051F2A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR3"
FT                   /transl_table=1
FT                   /translation="MQETAEAIGWLKQQTGGLPQLKDASRLIIYQGRHEVFLTLMTPGT
FT                   RYVEYLETTIPTTPEPETFLKLKTFGPRDINQRPDLEDLCPTLISLLLAAEEAAQA"
FT   CDS_pept        323988..324929
FT                   /codon_start=1
FT                   /gene_family="HOG000179103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207379"
FT                   /orf_name="AFUA_3G01320"
FT                   /product="Homocysteine S-methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="EAL86415.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="HOGENOM:HBG053218"
FT                   /db_xref="HOGENOM:HBG421117"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI000051F047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR2"
FT                   /transl_table=1
FT                   /translation="MALPQLLSPKPFLTECGMETSLVYKDKVHLPCFSSLPLVDSDSSR
FT                   KLISHYYDSYISIAAANGTGIVLDTRTWRGATPWAQPMGLSADKLLELNRAAVRLAKEA
FT                   RNRAVGGENNIPVVISGTMGPLRDAYVDTSELITLEDAREGYREQVEVLADAGVDMLAI
FT                   MTVTNLNEAIAVVELAKEVRLPVVVSFSIESDGRLLGGRSLGSAIRTVDEKTGGSVVYY
FT                   GVNCAHPVRISAALRDVPEDVRGRIGLIKGNASLKSHDELDNSETLDRGDISVFTDGFE
FT                   GVLPLVPNVKVIGGCCGTDEEHLEAVAKRCIK"
FT   CDS_pept        join(complement(325813..326023),complement(325459..325766),
FT                   complement(325057..325413))
FT                   /codon_start=1
FT                   /gene_family="HOG000180646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263116"
FT                   /orf_name="AFUA_3G01330"
FT                   /product="Class II aldolase/adducin domain protein "
FT                   /function="metal ion binding"
FT                   /protein_id="EAL86416.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG093762"
FT                   /db_xref="HOGENOM:HBG289811"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniParc:UPI000051F527"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR1"
FT                   /transl_table=1
FT                   /translation="MAPPTATETVPSNVTIQSRESSQAAGAEKAKVKMAMPKQPVFENK
FT                   MEEREYLKGRLAAAFRIFGKYGYDEGVAGHITLRDPVEPDTFWVNPFGVAFSQIKASDL
FT                   IRVNHEGKVIDGGEVRLLNAAAYMIHSAIHAARPDVVCAAHSHSLHGRAFCTLGRPLDI
FT                   ITQDSCAFYNDHIVYKQFNGVVLAEEEGKNIAQALGNKKAALLQNHGLLTVGRTVEEAV
FT                   FWFVSLEKCCYAQLLADAAAAGRGGQTIKIDDADAAFTYKTVGTPMAGWFSAKPMFDVI
FT                   HQETNGDYLK"
FT   CDS_pept        join(complement(326909..326992),complement(326485..326841))
FT                   /codon_start=1
FT                   /gene_family="HOG000256797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902822"
FT                   /orf_name="AFUA_3G01340"
FT                   /product="DUF636 domain protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="EAL86417.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="HOGENOM:HBG437085"
FT                   /db_xref="HOGENOM:HBG684755"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI000051E48E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFR0"
FT                   /transl_table=1
FT                   /translation="MSQKSYTGTCLCNAVTYRIDLPDSTTPKVILCHCINCKRYTGSGF
FT                   SANIAVPKTSLHWTKGQPKLYVDKSERGTGVPRMFCGDCGTPFTSEPSGQDEVIIIKTG
FT                   TLDDPYRDECGELAMEIWCVRKDKWVDQMKDESITRLDKSMG"
FT   CDS_pept        join(complement(331652..331897),complement(331412..331601),
FT                   complement(330149..331361),complement(329856..330057),
FT                   complement(329544..329774))
FT                   /codon_start=1
FT                   /gene_family="HOG000179114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902823"
FT                   /orf_name="AFUA_3G01350"
FT                   /product="Proteinase, putative"
FT                   /protein_id="EAL86418.1"
FT                   /db_xref="HOGENOM:HBG053242"
FT                   /db_xref="HOGENOM:HBG327023"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="UniParc:UPI000051F2D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ9"
FT                   /transl_table=1
FT                   /translation="MESSSLQNIKTDSNGPMVLKKQNGSSRPSSPIPVGRQNKARPITL
FT                   ALMGLAAFLWLILPDAVPRSTAKGENNARPPAFSWDQITPSNSLEYHDCFDGFQCARLE
FT                   VPMDYHRENGRGRQMAIAIVRLPAKIPVTDSRYGGAVLINPGGPGGSGVEQALLFGRDM
FT                   QTIIDGETDPALPTGPANLSARYFDIIGFDPRGVNNTTPGFSCFPDSFSQRNWELQVEA
FT                   DGMLGSSDDSLMRNWQRAVALGGACSKALQYAPEGTDEALGDHLNTPPVARDMLEIIER
FT                   HGEWRERQGQTEQRMYDRMYGYDQQQSIVARTKWKRGHEKLLYWGRSYGTVLGSTFATM
FT                   FPDRVERVLLDAVVDVDKYYTGKGPDVIADADAIFDRFVVYCDAAGLDGCPFYRHGGPA
FT                   AIKAAYLELEAVLYNASVPAAPSATRGPEVITWTDLKTVLRYSVYQPLFVFPLLAHYAK
FT                   SLSEGDGSPMADFKQRSRSPSCPSDQCLQTGPWSGECFEKGSSELYAMSAILCSDAPYL
FT                   RDMDQARFQEAWASLKARSFTLGDYWAAVTALGPVHRQYISSNSSCEQYSGSSHSVEKA
FT                   GIRSRVLSNSTTMLTVSIICSAKRMSEKFPGSVVLQQDSEGHTTLAAPSLCVGKAIRTY
FT                   FQSGVLPDPGMVCGADLKPLLGESGSVHAMNAADKTMYDSLMNMVAQANSLTRRLPFA"
FT   CDS_pept        join(333213..333397,333526..334900,334956..335103,
FT                   335277..335343,335383..335443)
FT                   /codon_start=1
FT                   /gene_family="HOG000217697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750788"
FT                   /orf_name="AFUA_3G01360"
FT                   /product="Siderochrome-iron transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86419.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053249"
FT                   /db_xref="HOGENOM:HBG327266"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520103"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ8"
FT                   /transl_table=1
FT                   /translation="MGPDPSIRKTGLIEDRLSSPKDGQDKSHNEVRELHDELACVTRIE
FT                   VIGSVISPRSKYILYAGELDNSTVSTYRNFAASEFGQLSMLATLNTVTSVVAAVSKPPI
FT                   SKLSDVLGRAETYIITITCYVLSYVLCASARSLDTYAGGCVLYALGQSGTSILNAIVIS
FT                   DISSMRWRGFVYNIIYLPFLVTPWVSAFIVENVVNGIGWRWGIGMFAILMPSCASIIII
FT                   SLLVFQHRAKKTSSVVYHRPSVHGFCSGIDLGGIAILTCGFSSLLIPTTLAATTTSRWK
FT                   TPWIDALIVLGAVLLACLYPYEKYIARNPVFPVRYFHTLSVLVPVALACIDNIGFGTTH
FT                   TYLYAWSMVSHNFSPRNAQFLSWTSGVIQALAGMCIGLLMYRLRRYKWIAVAGAIVRLI
FT                   GYGLMIRLRTNTSSLAELFITQLIQGLGSGVIETVAIVAAQVSVPHSELAQVTSLVMLG
FT                   AFVGNAVGSAIAGGIYTGKLRERLQVRLGSAIGEARLDQLYNSITGTLPMWGTWQRVAV
FT                   NQAYSDVMGSVVTNSTWNTAKLRSQAVTFVMQPWRSPFLLSFLPCYCLTATWVLHKQID
FT                   MDIDFPTQRSNCHVFIHRLNYINLLGVQRERSKDA"
FT   CDS_pept        join(complement(339057..339241),complement(337589..338930))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902824"
FT                   /orf_name="AFUA_3G01370"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86420.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG326782"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FC8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ7"
FT                   /transl_table=1
FT                   /translation="MGEQITDKDLLGEKAEMSHEEVAQLAELTEEEKVIETKLRRRLDC
FT                   TIMPLVILVYLMNYIDRNNYPAARLQGLERDLNLSDADYQTGLSILFVGYILMQVPSNL
FT                   ILNYMGRPSLYLGFFTSAWGLVSLLTSQVKSFGGIVACRFILGLVEAPFFAGVLFYLSK
FT                   WYTKKELALRMSIFYAGSLLSGAFGSLIAAGILKGLDGKNGLAAWQWLYIIEGAITIAV
FT                   GIAVMLFLPDFPSTWKRLSEEERHVANRRLAIEAADADVDEAGKMSQIKGLKLAFSDIK
FT                   TYVLAIAYMSITGASGFQNFFPTLTSTLKYDHFISLLLVAPPYVFVVFYSMAHSHLSDR
FT                   FGNRFWFFFYPIPVTIIGFIIFMTTDSFGPKYFSFFLMNIIFAQNGTIYAWIGNAIPRP
FT                   PAKRAAAYAFINSIGNSASIWTPYTYRKQDFPHYRPALGVCIGLQTLGGIMAIIMYFHL
FT                   RSLNKRLERLDDTEVTLTDKEIRRLERTAEIEGIDLAAARRLQKGFRYIV"
FT   CDS_pept        join(348200..349948,350028..352037,352106..352621)
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902825"
FT                   /orf_name="AFUA_3G01400"
FT                   /product="ABC multidrug transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86423.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000F51CB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ4"
FT                   /transl_table=1
FT                   /translation="MEDQGHLPSEPRALFDRRDDTDSTNTALDETDLSRTPLQDTSHTP
FT                   HAEDWSLMPDLKKQHDRNVASGFRRRELGVTWKNLSVDVVSADAAINENVLSQFNIPQH
FT                   IRESRNKAPLRTILHESHGCVKPGEMLLVLGRPGSGCTTLLRMLSNHRLGYKAIRGDVR
FT                   FGSLTPEEASKYRGQIVMNTEEELFFPTLTVAQTLDFATRLKVPFNLPDGVTSPEAFRQ
FT                   ETREFLLKSMGISHTSDTKVGNEYVRGVSGGERKRVSIIECLATRGSVFCWDNSTRGLD
FT                   ASTALEWAKAVRAMTDVFGLSSIVTLYQAGNGIYDLFDKVLVLDEGKQIYYGPMSQARP
FT                   FMEEQGFVCREGSNVADFLTGVTVPTERKIRPGYENRFPRNADELLAAYEKSPIRAQMA
FT                   IEYDYPDTESTRERTEEFKLGVLDEKAKRLSKNSPFTVDFLQQVKACIIRQYQIIWTDK
FT                   ATFAIKQISTVIQALVAGSLFYNAPDNSGGLFIKSGALFFSLLYNSLLAMSEVTDSFSG
FT                   RPVLIKHKYFAFFHPAAFCIAQIAADIPVLLFQISMFAVVVYFMVGLTTSAGAFFSYWI
FT                   IIFVATMVMTALFRAIGALFSTFDGASKVSGFLISALIMYCGYLEPYHAMHPWFIWIYW
FT                   INPLAYAFDALLSIEFHNKIIPCVGNNLVPFGPGYDDTTFQSCAGVGGAVRGMTYVTGD
FT                   QYLASLTYSYSHVWRNFGILWAWWALFVAVTIIATSRWKSAAEAGNSLLIPRETVAKHH
FT                   AVVRKDEEAQLNEKAGHKGTGTDSEAQSNVDQHLVRNTSVFTWKNLTYTVKTPSGDRVL
FT                   LDNVYGWVKPGMLGALMGSSGAGKTTLLDVLAQRKTDGTIRGSIMVDGRPLPVSFQRSA
FT                   GYCEQLDVHEPFATVREALEFSALLRQPRHIPREEKLKYVDVIIDLLELHDLEHTLIGR
FT                   VGAGLSVEQRKRVTIGVELVSKPSILIFLDEPTSGLDGQSAFNTVRFLRKLADVGQAVL
FT                   VTIHQPSAQLFAEFDTLLLLAKGGKMVYFGDIGDNAQTVKDYFARYGAPCPANVNPAEH
FT                   MIDVVSGHLSQGRDWNQVWLESPEHSSASRELDSIISEAASKPPGTVDDGYEFAMPLWE
FT                   QTKIVTQRMSTSLYRNCDYIMNKIALHIGSALFNGFSFWMIGDSVADMQLKLFTIFNFI
FT                   FVAPGVINQLQPLFIERRDIYDAREKKSKMYSWVAFVTALIVSEFPYLCVCAVLYFVCW
FT                   YYTVGFPSDSDKAGAIFFIMLCYEFLYTGIGQFIAAYAPNATFAALTNPLILGTLVSFC
FT                   GVLVPYAQIQAFWRYWIYWLNPFNYLMGSMLVFSVFDTDVKCKEGEFAVFDTPNGTTCA
FT                   DYLSTYLQGVGSRANLVNPEATSGCRVCQYRYGSDYLYTINLKDYYYGWRDTAIVCIFV
FT                   LSSYALVYALMKLRTKASKKAE"
FT   CDS_pept        join(complement(360713..360985),complement(360578..360664),
FT                   complement(360453..360510),complement(360063..360402),
FT                   complement(359488..360013),complement(358817..359435),
FT                   complement(354101..358737),complement(353734..354054),
FT                   complement(352856..353677))
FT                   /codon_start=1
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056097"
FT                   /orf_name="AFUA_3G01410"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL86424.2"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG052093"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0000F51CC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ3"
FT                   /transl_table=1
FT                   /translation="MPINSFEGTGEPVQLPSAPDVDIEDGASNSLDDASMSIAIIGMGF
FT                   RGPGDASNVEKLWKMILEGREAWSQIPESRWNSDAFYHPDHARHGTINVQGGHFLTEDV
FT                   SLFDAPFFNMTSDEAAAMDPQQRLLLEVTHEGLENAGIPLPEIMGSQTSCFVGSFNADY
FT                   TDLLLRDPDAIPMYQCTNAGQSRAMMANRVSYFFDLKGPSVTVDTACSGSLVALHLACQ
FT                   SLRTGDAAMAIAAGVNVILSHEFMSTMTMMKFLSPEGRCYTFDEKSNGYARGEGIGCLI
FT                   LKPLKVAIRDKDPIRAVIRGSGSNQDGRTPGITLPSGASQEALIRHVYNMAGLHPHDTE
FT                   FVETHGTGTQAGDPIETGALARVFCVGRNSDKPLRIGSIKTNVGHLEGTSGVAGVIKAV
FT                   LMLENRIFLPNRNFTSLNSRILLDEWKLKIQLDPEPWESSTPHRVSVNSFGYGGSNAHV
FT                   ILEDTYGYLQSHGLQAPVGKPRTPFLKEALEPSQKPHSRHDESPIRTRLFMLSGFDDHS
FT                   LAKQIENIRVYLRERESIADDQFMSNLAFTLNHRRTTLMCRTAVNGSSASSVIKALGGS
FT                   IRVRKATRKPVVGFVFTGQGAQWCGMGRELVKAYPVFRQSMERIDAHLIRLQAPFSALG
FT                   EILENQDASRLNHPLHSQTICTALQIALVDLLSSWGIEPDSVTGHSSGEIAAAYTIGAL
FT                   TMEDAISVAYYRGVAASKLLHNDEVKGGMLAVGVSPAQIAPFLDTLKSGKAVVACINSP
FT                   SSITVSGNVDAIDELEKVLKEKEFFCRRLVVDVAYHSHHMELVGGEYLDLISNIRPQTG
FT                   SKSGKHPVSFFSSVTGAGVEASDLGSQYWTRNLLGQVRFVDSVRALCFETGTQKSMFAA
FT                   LNNRRVRRPNGARKVNVDILLEIGPHGALSGPIRQILKEDNKLNSAGLQYASVLTRKAD
FT                   SVTTALEIAGTLASLGSQVNFSAINDPLVETLDTQVIVDLPPYAWNHSRPYWAESRIST
FT                   TFRKRKHPRIDPLGALDRLSCPFEPRWRNFMRVSEIPWLKDHKIQSNIVYPAAGYIVMA
FT                   IEAASQHLLDQYGNKDMSAFILRDIEIKAALVLQENSAAEVMTSLRAWQGSTKASERLY
FT                   EFNVYSVTAENRWTEHCRGLVGASDLSLDTEYETSSQVPKQASDLSVIDTSTFYEKLAS
FT                   IGLEYGPCFANLTHANQTGNLCFAEVTIPDTAAVMPMNFQYPHLIHPCTLDSIFHTVFV
FT                   QTNVGDDPAIPVHIDQLSVSRSAEHSPGTRMHIETHIEKRTRKSIVASITVINSNDTIA
FT                   MSIKGLRCKHLKNSDPKDMVNPTERLGYMLTWKADSDLLSKQDFSTVFTEDNHHTQESA
FT                   KRQLLEGCAFSYIRKAIQDLEPANKEGLHPRRREQLDFFVDRTQNSRLVASSVTNNADI
FT                   QALSASGPEGRLLTAVGEQLSTILKDSKFSNIDMDLSIWEQYWDTIRLSPVYEKLASYL
FT                   ELVGHKNPMISILEVEGTFGQASQDHLERLLGNNGHGPLCREYTITHEGQSIPEHFSPV
FT                   VSKWKPLLKVKELNLNQSPEAQGFSKYQYDVVLAPLGLCTVPAKLQALRNIHALLKPQG
FT                   HLIVVDPIARHDNLTESVIFANSLGCWPEGRFGYTLEGWNLVLSAAGFSEAEDASIPRE
FT                   GRFMMITRPLHGQSIPKQSILIISEDDDNGIDLSALQDSLSPMSSDIEIADFTHAKPKG
FT                   RVCIILSALSRHLMADPTPDELEVSKQIFLKASGVLWVTRGATISPVTPDGALATGFVR
FT                   TSRSESGIERIVTLDLDGRKPLSSHHAAEIICKVVRERILTDGNGQSDTEYAERNGVLL
FT                   IPRVAENQAFNRCLAASQETQTTNLEKFHQEGKFLKASISDASQEGEVLFVDHSKGNDI
FT                   PEDHIRVQIYAVCIDKQAANALEEQDTSQELAMGFGASGIVHSVGGAVLDFAPGDRVAC
FT                   LAQGAVANYQQEQALAFQRLPEGLSFEAAAALPAAYCTALYALQNIGRVVSTNRVLVYG
FT                   ATATVGQAFAELCLNIHAYALFVVRAEKDKHSLCSTIAVPGDRIIVNENGAHLRRLLRK
FT                   EYQPFDLVVNFESRDNETLQMLCRLVGTGGKFIHLYRDNRWNQRTLAIPKLENDIVFAT
FT                   LDIQKLLRARPTLLYKIWGDVMRMYRAGHIRGSNVLETYSISDMRDALNVLELGELDSL
FT                   VLAAKPEDLVKVMTPKPQAALLRADASYILVGGLGGLGRATALWMADNGARTLIFVNRS
FT                   GLSSQAAQETARDLKQKGVRVIIHACDISDSKKVKKMVIELERNAPPIRGVIQAAMVLR
FT                   DTHIEKMTIDDYLSVLRPKYFGTWNLHRHLPADLDFFVMLSSISGIIGNATQAAYAAGS
FT                   TFLDTFAMYRNSLSLPAVSLDLGVITDVGYLAGNRALEAKMAHQGFHSTDTATLMSLIA
FT                   ASIRAPFGEGGTSQIITGLGEWREGQSLGNFDAPLFAHFRRQFQQKSEEDQSDECIGKL
FT                   HENLRAVNNLEEASGVIYSALSGKIAAHLSVPIESIDASHPITEYGIDSHMAVELRNWI
FT                   AKTMESTVPILDILASSTLLDLAGKIASKSRVVHVEE"
FT   CDS_pept        join(complement(362004..362051),complement(361934..361952),
FT                   complement(361276..361886))
FT                   /codon_start=1
FT                   /gene_family="HOG000179054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263117"
FT                   /orf_name="AFUA_3G01420"
FT                   /product="DUF341 family oxidoreductase, putative "
FT                   /protein_id="EAL86425.2"
FT                   /db_xref="HOGENOM:HBG053292"
FT                   /db_xref="HOGENOM:HBG324111"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI0000F51C7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ2"
FT                   /transl_table=1
FT                   /translation="MPLKLLCLHGWGTNTKILQSQLNGLMTELRRDNTATFHFVEGDID
FT                   SVPGPGIAGFYDGPYYSYYKFPRSLSDPDGSEEESLLEAYNLLYDIIDEDGPFDGILGF
FT                   SHGGTLASGFLIHYAKTYPHEPPLFRCAIFINSLPPFRMDSGENIVIDSDLDGYIKVPT
FT                   VSIAGAKDPLFEYSLALYRLCDPSRSTSIVHSKAHDIPNDKKNVALMAAGIRKLAIEAL
FT                   AIW"
FT   CDS_pept        join(362767..362869,362968..363398)
FT                   /codon_start=1
FT                   /gene_family="HOG000224659" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263118"
FT                   /orf_name="AFUA_3G01430"
FT                   /product="Benzodiazepine receptor family protein "
FT                   /function="receptor activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86426.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG369343"
FT                   /db_xref="HOGENOM:HBG753165"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="UniParc:UPI000051F2BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ1"
FT                   /transl_table=1
FT                   /translation="MPWSFTLPQEFFTSPVLAVATPIGVGSLVGYLVNSHTKELYSRLR
FT                   QPPLRPPAWVFGPVWTVLYGMMGYAAHHATASTTLLTPATAVASFQTLYTTQLVLNYLW
FT                   MPLFFGARKPGWALADIVALGGTVGKLMAMWWDFDRTAFWMMLPYAGWLCFAAYLNVSV
FT                   GWLNNWDFDSRDGR"
FT   CDS_pept        364638..367175
FT                   /codon_start=1
FT                   /gene_family="HOG000171322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902826"
FT                   /orf_name="AFUA_3G01440"
FT                   /product="DUF1212 domain membrane protein "
FT                   /protein_id="EAL86427.2"
FT                   /db_xref="HOGENOM:HBG053306"
FT                   /db_xref="HOGENOM:HBG324120"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniParc:UPI0000F51C58"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFQ0"
FT                   /transl_table=1
FT                   /translation="MSETHHDNESYELLTNPESLEPTAIENRNRHDRSLSQPANAEARE
FT                   SHHLGLPGELSRPHRVRFRSISQHRDVDNTDTTEKVYSNSSDSSTRTLLNSAPRATDVT
FT                   DMLKAEQFDDETDISSRYDGSGYTSANYPPSTPERISEDSTTRERTPNRSKSVKQRWRE
FT                   AGQLIRQKTVRLGERLGRPLDDGEALGASLLPEDLEGGMPIRRVHSQYRMPAGDDTDDE
FT                   DRPNPSAEAHRLVRRMTQHTNLRHRKPKPAYQRSGQSTPERPSSWYDSYRPLSFSGGGG
FT                   ILSQLLKLQAAQNEKDGLSATDDSDNGSPMSSGATTPKSGSATPKSGAATPKKEKVKWY
FT                   KKPHHRSTASLVEASMNLSRATLPSSADVLSMTQQKRGKKKAYRKHRLEDEIKVTVHIA
FT                   EILARHRYIMQLCRALMRYGAPTHRLEEYMTMTARVLEVEGQFLYLPGCMIMSFDDPVT
FT                   RTAEVKLVRSTQGVDLGRLAETHNVYKNVVHDLIGVEEAIQELDEIMKRKPRFNKWILV
FT                   PVYGLAGAAVGPFAFDARPIDMPIIFILGSLVGLMQHVISPRSTLYSNVFEVTAAVLTS
FT                   FLARAFGSIRITVDGQKQFLFCFSALAQSSIALILPGFMVLCSSLELQSHQMIAGSIRM
FT                   VFAIIYSLFLGYGITVGTTVYGLIDGNATSETTCRDLSIYGSKYIQHFIFVPIFVICLA
FT                   VINQAKWKQVPVMIFIATCGYITNYFSTTKLGSRSEVANTVGAFTLGTLGNLYSRLWHG
FT                   HAATAILPGIFVLVPSGLASSGSLIAGINYANQVRENLHKSGNGTDTSSQDTSIASLGF
FT                   GMIQVAIGITVGLFIAALVVYPFGKRRSGLFSF"
FT   mobile_element  complement(367641..367949)
FT                   /mobile_element_type="transposon:MuDR_A_B transposon
FT                   family"
FT   CDS_pept        join(complement(369476..370038),complement(368853..369415),
FT                   complement(368751..368788))
FT                   /codon_start=1
FT                   /gene_family="HOG000281451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750789"
FT                   /orf_name="AFUA_3G01450"
FT                   /product="3-methyl-2-oxobutanoate dehydrogenase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86428.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG450176"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI0000F51C8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP9"
FT                   /transl_table=1
FT                   /translation="MASLRPSVKRLLRQPPCRLYSGAPSSSSRLNLPIDYKSTPLLHHT
FT                   SSSLSSALELPGSTTSKSLNLYQAINSALRTALATDNRVMLFGEDVAFGGVFRCSMDLQ
FT                   TEFGSERVFNTPLTEQGIVGFAIGAAAQGMKPVAEIQFADYVFPAFDQIVNEAAKFRYR
FT                   EGGTGVNVGGMVVRMPCGAVGHGALYHTQSPEALFAHVPGVQVVMPRSPSQAKGLLLSA
FT                   IFQSNNPVIFMEPKILYRAAVEHVPNEFYTLSLNKAEVVKPGNDVTVVSYGQPMYLCSE
FT                   AIRAIEKDMGASVELIDLRTIYPWDRQTVLDSVKKTGRAIVVHESMINYGVGAEVAATI
FT                   QDGAFLRLEAPVKRVAGWSTHTGLTFEKLILPDVARIYDAIKQTLEY"
FT   CDS_pept        join(complement(370927..371772),complement(370426..370845))
FT                   /codon_start=1
FT                   /gene_family="HOG000179043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263119"
FT                   /orf_name="AFUA_3G01460"
FT                   /product="Salicylate hydroxylase, putative "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86429.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG005382"
FT                   /db_xref="HOGENOM:HBG326141"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000520104"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP8"
FT                   /transl_table=1
FT                   /translation="MTSTEKQFTVAIVGGGIGGLALAAGLLRRNVPVQIYEAAPKFKEI
FT                   GLGLTIGPAAHRAMPLIDPQIRHVYDSLITTHADSPGYERFKQTWFEVVWASGPKSGQV
FT                   LMNLKALPSGQTTVRRADFLDALVGLVPPEIAHFGKRLIRLVESPTGVHLYFEDGTSAS
FT                   ADVVVGCDGIHSKVKEFMLPDEYEQTMPRYSGMYGYRAVLDMETMVEAVGDHRARVATM
FT                   YVGDGAYGISYPIMHAKKVNVGLYVLHDMWDDAAWVRQASKENMARDMKHMGEYVNRLV
FT                   EWAIFDHPHLSTFARSRIAILGDAAHASTPHQGAGAGQAIEDAHVLAELLGDRRVIEAR
FT                   DVLAAFQAYDEVRRPRSQRVVTSSKENAYLLCLHLHGVEHDEEKLRTTFQERLRWLWDI
FT                   DIQDQAERARRIMLKKMQNSSS"
FT   CDS_pept        join(372686..372984,373041..373096,373147..373206,
FT                   373262..373333,373379..373462,373514..373698)
FT                   /codon_start=1
FT                   /gene_family="HOG000217698" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263120"
FT                   /orf_name="AFUA_3G01470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86430.2"
FT                   /db_xref="HOGENOM:HBG053328"
FT                   /db_xref="HOGENOM:HBG324122"
FT                   /db_xref="UniParc:UPI0000F51C57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP7"
FT                   /transl_table=1
FT                   /translation="MHYAYISIPLTLALGVTASMPADSWVFGNSLFYLGPPTGASITKA
FT                   TYSLVPPDVPSGVKVSSPSDQVWVSVWVGASSTNGDANANLYQPLLNWSPDQESQGCSA
FT                   NSTEWCVAASTYTPDGQVGQTYVPVPPQTNLDFEISVENNKVYQTVTVNGEVVSQQSDA
FT                   LDNDLKYLYSSNECYTGSGNCGLLQGYKITNVTVTLSAADESFGKTMALFSCTDAGFAT
FT                   TDNGRTWYTDYIAIQEIAFDSSSDASVQE"
FT   CDS_pept        join(complement(375307..375819),complement(373921..375237))
FT                   /codon_start=1
FT                   /gene_family="HOG000179032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263121"
FT                   /orf_name="AFUA_3G01480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86431.1"
FT                   /db_xref="HOGENOM:HBG053334"
FT                   /db_xref="HOGENOM:HBG554130"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="UniParc:UPI000051FC78"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP6"
FT                   /transl_table=1
FT                   /translation="MPSWTRTPACFRRQFSRLPGPSPLSSSRSRFSGLIFTVAGVVISL
FT                   LYLFYVFVVPQLLRFRLRLDLSPYDLGFYGLGPSRSYASFEYESPVVEITEWASGCDSR
FT                   YTFLAPRGDSVAHPGPVILDADGELVWMKYNWDTTQDFKVQRYNGADYLTYWEGTEVES
FT                   RGSGSWYMLDSTYTQKYQISPIGNFGGGDLHEFHITEQGTALVTVYDPIPADLTSIGGP
FT                   ELGWILDGVFQDIHIETGELLFEWRASQHYPVTSSYEALDGAGKDRNNAFDFFHINSVD
FT                   KDEQGNYIVSARHLHAVSYIDHVTGNVLWTLGGKLNEFTDLSHGQATNFAWQHDARWHA
FT                   NNTITLFDNAAHSNSDPDSESRGMVIQLDLSQRTAELLAAYYHPQQMRSVSQGNVQILD
FT                   ESGRVLVGWGHSAAFTEYTADGDLLCDVHFAASAFFSFGRVVSYRASKSTWVGRPLTIP
FT                   DAAVMGDRVYVSWNGATEVVAWRLEVWDARAVEGSTFDVVAQFAKTGFETVIEIPEELG
FT                   SPLFRLAALDAEGNALGYTEILQKDQGVDVDELLDLHNWIVAAAFIISVGGLLLGLYQC
FT                   CGCCQILPRCRRRPNEYQLVAFGDNDNGENDPV"
FT   CDS_pept        join(complement(380193..380404),complement(380012..380139),
FT                   complement(379803..379962),complement(379234..379750))
FT                   /codon_start=1
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263122"
FT                   /orf_name="AFUA_3G01490"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86432.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520594"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP5"
FT                   /transl_table=1
FT                   /translation="MTPSLLPESHYGDVVASMKPPSNDPQIIQTPLRNPSLQVTADHQL
FT                   KFVEAPVYAPRRGEVLLQIKATGICGSDIHFWKSGRIGQLVFEGDCIIGHEAAGVVLRC
FT                   GEGVTKFKPGDRVAVEPGVPCEQCFLCNDGRYNLCEDVQFAGVYPYAGTLQRYKVHPAK
FT                   WLHKLPDGFSYAEGALLEPLSVVMRGIQVARLNLGRGVVVCGAGPIGLIALAAARASGA
FT                   HPIVITDVELRRLAFAKEIVPSCITYQVDLAKDAQDNALAIRALFGDSEYVAPEAVLEC
FT                   TGVESSVCTAAYTARRGGVVVVIGVGKATMNNLPFMHMSLAEVRFTLNLGRIRANDG"
FT   CDS_pept        join(381071..381220,381286..381500,381558..381876)
FT                   /codon_start=1
FT                   /gene_family="HOG000048384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263123"
FT                   /orf_name="AFUA_3G01500"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86433.1"
FT                   /db_xref="HOGENOM:HBG053341"
FT                   /db_xref="UniParc:UPI00005205A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP4"
FT                   /transl_table=1
FT                   /translation="MMGKLEHRPDNAFANVRSTLIVIAIVSFPFNLTGIFIANGQTASI
FT                   NQLVALSSSGLSSLMLLYWYRRYPAWPVSTAGVKVIITDLFFAIYLTVIYFTMLLVDRF
FT                   VSQHVVCVYGNLACLVSGLFHTYAVLRAAMVRYKAYLARVGRPKIVAFCPACSCSSKYQ
FT                   ITDGDQETGVTVLPMSSELIDTESDPLMGGDRAPFRASEDTAVSLGSRFTVKTFTGSLA
FT                   EDPSK"
FT   CDS_pept        join(complement(385372..385884),complement(384774..385211),
FT                   complement(383456..384727))
FT                   /codon_start=1
FT                   /gene_family="HOG000217699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750790"
FT                   /orf_name="AFUA_3G01510"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86434.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053342"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005207EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP3"
FT                   /transl_table=1
FT                   /translation="MPVFIWQRDLSLLGAQNSFFGLRTPTAVSLLLFPQLPRTHPLSHA
FT                   EYATMTPSTDDQKFKGYSCLTCRQRKVKCDRRAPCCNCIKADKQCTFVPPARGKRKRTK
FT                   PPREGLHAKLERYEKLLSLHGIKTEPSDDLDDSGSESDACMDEDVNTVDTPRSTLEETK
FT                   PKLIIREGFQHPEAGGPVDEPLSDQNALFFGQNEKVEDLASLHPPVQILPKLRDIYADR
FT                   VDPLVKILHLPTFLATLENGLRHPSGRSDSLEAIMFAFYLAVVSTLDEDECQDLFGVSE
FT                   AVIHSRYRLATRQALVNAGFLSTSNPLTLQAYVLFMMCVRKSYPCDTLFVLSGVSIRLA
FT                   RKMGLHRNGSLLGLSPFDAEMRRRLWWHLVHVDFLLADVLGTRPSMDISCADTKTPLNV
FT                   HDADLHPDMTDLPPERHGITNISLCLIRYQIMVSLHDFSTSSPADMRWEVLLGPNVPPA
FT                   KKDHIISQIEDHLEQKYLRYCDPANPLHTFVSIITRFSICKMKLVAHNPRQFACSPPKD
FT                   LQAERDIVFANATKLLEYVALVQGGHCGLEKYTRQIGTSALWNAMLYMLIEIRHRGTGP
FT                   EVDRSWQLIGVVFSCPRIFGRTPPQVDTVLRKWTLEVWDHYVATSKIEGLPEPLTPEYI
FT                   NEIRRWIRSRGDLSRNEPRAADRDPVAEPSFGCAQVPYDGHERLPGSGTLDSYEFDDIL
FT                   SFEMDPNEWIQWEQLVAGGAAPECAYTCSRERLESSSSNPNSNGRK"
FT   CDS_pept        join(385999..386124,386177..386794,386849..387022,
FT                   387080..387805)
FT                   /codon_start=1
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750791"
FT                   /orf_name="AFUA_3G01520"
FT                   /product="MFS multidrug transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86435.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG032742"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EB94"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP2"
FT                   /transl_table=1
FT                   /translation="MSEEKPLNAAKDQDKDDIVYPTGLKLALLMTSIFIGMFLVSLDRL
FT                   IISPAIPQITDEFHSAGDIGWYGTAYLLTNCAFQLLFGKVYTVFSIKATFMTSIVLFEV
FT                   GSALCGAAPNSIGFILGRAIAGLGSGGIFAGALTVIVYALPLHKRPKYQGAFGAVFGVA
FT                   SVAGPLVGGAFTTNVTWRWCFYINLPLGAVVIATTLLFFEIPDHQNAPKPLKGKLRQLN
FT                   GLGVLTIMPGVVCLCLALQWGGSQYAWGEGRIVALLVLTFLCLIAFVLIQVWKPEQATL
FT                   PPRVFLQRSIASGFWASCCFGAHMIPTVIYLPLWFQVIDGVSAVDSGIRLLPMLLSLVV
FT                   ASILTGGLVSRIGYYTPFLMLGIVLSSIGAGLLTTLGVHTSSAKWIGFQVLYGFGLGTC
FT                   NQIPNMAAQTVLPREQVAIGASLMFFAQQLFGAVFTSVGENVLSNQLAKRLAISSQTVQ
FT                   NTGATQLLEHVPVDDRVASLGAYNDSLQVVFQVGLIMACLAILGAVPMEWRTVKKEQLS
FT                   STSDRNDGQAEEGAPGNAQSTMDYKQGTVN"
FT   CDS_pept        388213..389691
FT                   /codon_start=1
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207380"
FT                   /orf_name="AFUA_3G01530"
FT                   /product="Phosphatidylglycerol specific phospholipase,
FT                   putative"
FT                   /EC_number="3.1.4.-"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="EAL86436.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG051318"
FT                   /db_xref="HOGENOM:HBG603039"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI000051FA2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP1"
FT                   /transl_table=1
FT                   /translation="MQPKAVQDAHASFPAGKHAADETEHLLPHDPPAEINIWGSRRRPR
FT                   SWWALVAISLLLLTMTVLSLAVFFTLGFGAGAAPHVPHGRLSSPIKNVVVLVQENLSFD
FT                   NYAGGLTYSPSIDGLVNRTYCNPANISDPHSPMVCAQPTAKNIAPDDPDHSITGGNQQV
FT                   YSTYHPDSDFDAPNMQGFVAEQIAAYGIDGNLSRAGEVINYYTPEHIPVFNAMAENFVL
FT                   FDRWFAAVPGPTNPNRAYLTSGTSHGHGTNDPDFDRSALPQRSIFEQLSEHNISWINYS
FT                   NTTGFLPDALFYRWTAVSGLGETNVRPIDQFYRDAKAGTLPQFTWINPECCSYMSFHPP
FT                   SPINMGEGWIKSVYEALRSSPQWHETLFILTFDEHGGFADHVPPPENVPAGDDLTYTET
FT                   ARDGKPSTFAFDRLGIRVPTVLMSPWVGKGVVQNRPADGNGEFTHTSILKFVADLWGLE
FT                   YLSPRVAWSASFAHLITDTFREDTPATLPEPADF"
FT   CDS_pept        join(391333..391521,391588..391704,391740..392000,
FT                   392054..392842)
FT                   /codon_start=1
FT                   /gene_family="HOG000163872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207381"
FT                   /orf_name="AFUA_3G01540"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86437.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053343"
FT                   /db_xref="HOGENOM:HBG324490"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520105"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFP0"
FT                   /transl_table=1
FT                   /translation="MMATNELESVPPVLFKETFSHIPTSSDDLSDDIDEFDDSRLPPVD
FT                   GGYQAWLFLAACFMVEGIDSHNRSGSLRTIIELMSHFRTRLRLRPLGPAQWSDRYSSGL
FT                   AYLPTPIVIAIMFAFPRARRWFSTAGFVIMCLALGLSSFSTSVTHLIMSQGVAYGIGGC
FT                   LAYTPSILFLSDWFVEKKGLAFGIVWSGSGLTGIIFPLILQTLLNQYGWQTTLRACSIA
FT                   LFLLAAPFMTFHKPRVPIRHSHLRQLSLRFLWDKVYLIYQLGNTMQAIGFWIPSIFLTS
FT                   YARTLGASDFLASLTVTLFNLMTVFGCIFTGYLADRHHVTKCILLSSAGAVASVFLLWG
FT                   LANHIATLYAFCIVYGFFAGGYSSSWSALSHEVQKSERSAHVSMVFAFLETGRGVGNVI
FT                   SGPLSEALLKVGGWKAGAFGAYGSEYGVLVVLTGVTAFLGGFASMARMFRWI"
FT   CDS_pept        join(complement(394577..394802),complement(393032..394512))
FT                   /codon_start=1
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263124"
FT                   /orf_name="AFUA_3G01560"
FT                   /product="Amino acid permease (Can1), putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86439.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051FC8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN8"
FT                   /transl_table=1
FT                   /translation="MAVQDNLTSDAKGLEVSSAEKRRRLADKVRFRSSKVNSLRGDHHS
FT                   DEESNEEVQESETPDLKRQLKDRHLQMIAIGGTIGTGLFISSGTAIAHAGPVGALIAYI
FT                   FVGTIVYSVMTSLGEVATYIPTAGAFTSYTTRLVDPSLGFAMGWIYWFNWASTYAVELT
FT                   ASGMIIQYWDEDLSIAIFIGVFWVFITLINFLPVGFYGELEFWFSAIKVLTVLGFMIFA
FT                   ICIDAGVGKQGYLGFHTWKDPGAFAPYLIESNVNTAKFVGFWAVLIQAGFSYQGTELVG
FT                   VAAGETENPEKTVPSAIRKTFFRILIFFVLTIFFIGLLVPYDNPNLVTDTSNASASPMV
FT                   IAANLAGVQVLPGLINAVLLTVVLSAANSNVYSGSRVLLGLAREGFAPQWFAKVTQRGV
FT                   PYISVAFTAAFGLLGFLNLSESGGKVFNWLVNISGVAGFICWASINACHIAFMRVLAAR
FT                   NISRDTLPYKAIWQPWLAYYGLFFNILIIFTQGFTAWIPTFDVSDFFVAYVCPILFAVL
FT                   YLGHKIVFRTKFVDPLEADLDSARVETKSTSWETSAPNKGWFERVKGRFIG"
FT   CDS_pept        join(complement(397671..397771),complement(397473..397592),
FT                   complement(397206..397422),complement(396620..397156),
FT                   complement(395957..396560),complement(395705..395903),
FT                   complement(395503..395561),complement(395356..395459))
FT                   /codon_start=1
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263125"
FT                   /orf_name="AFUA_3G01580"
FT                   /product="GMC oxidoreductase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="EAL86440.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG298145"
FT                   /db_xref="HOGENOM:HBG734713"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000051F794"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN7"
FT                   /transl_table=1
FT                   /translation="MKLQVDLDPLLKLGDQTSKTDRSAAWVRLATRKIGGTSGCVVAGR
FT                   LAENPDIKILVIEAGQHNRELENVHMAGGWSNNFDSETDWNLITKPMPGVDNRQVKLSR
FT                   GRFLGGSSGCNGTLCIRGAKQDYDDWELEGWSGEEFFAAMRKAETFHTKPWFKADENSH
FT                   GYSGPLHTEPHDLAPIANLLMDSFVSQGLPLHHDMFSTGDIPHGCGHVPRTVYKGIRTT
FT                   AADYITKEYHRNNGTIQTDTTVDRVVLEQGPDGLRATSVITQLADGTPRTFHARKEIIV
FT                   SGGAYCSPAILMRSGIGARAELDQHGIPCQVDLPGVGKNLLDHLIVFMFYETEKEGLTN
FT                   DFHVYHDNNFAKTYQQWKEHKSGFLSTFPFGCFAFARLDDRLKDEPLWRDAPRQPGRDP
FT                   MGLTPKQPNIEFFTTECYGGPKQYNQFPVDKKHAFSMIAELFAPKSRGTVTLKSKDPKE
FT                   NPVIDCNYLSDPLDLLVLTEACRFGNEIVMNGAGTKDIVKGSWPPNLKHHTYKTREEWI
FT                   PYVKEHATTCYHAAGTCAMGKDGDSMAVLDNKLRVRGVAGLRVADCSVMPTLHGGHTQM
FT                   PAYGIGERCADFIKETCFRFFAKKEVNCCRIEKKLDDLQSHALPLSYQSWSGQSGKYCA
FT                   ISFKNREQRKL"
FT   tRNA            395422..395493
FT                   /gene_name="tRNA-Cys"
FT   CDS_pept        join(399965..400123,400191..400218,400309..400442,
FT                   400490..400626,400684..400738,400792..400857,
FT                   400928..401064,401123..401381)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263126"
FT                   /orf_name="AFUA_3G01590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86442.1"
FT                   /db_xref="HOGENOM:HBG053346"
FT                   /db_xref="UniParc:UPI000051E92D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN5"
FT                   /transl_table=1
FT                   /translation="MAQATPFQKEAWTEYGIGVLIILGRIFARWKVVGVKNWQGDDYFA
FT                   ILALLFWTAELTMLELIAGRHDPGPGQESCHRLQVSACWMGVLCDTHLVSQGLHVILLQ
FT                   PLDTGSHTAEARQDQRGAVRVVLCRGHLHHFLPLPSDTKALADIPGSRRPLHCRPNQLH
FT                   RPRRNQRLHGCRPCLDSRSPARQSPISIAPKTRHRRPPLWRCLRHVRRPPPSSAASSPC
FT                   EASTASTPAPSGPSAKPSLHSSPSTPPASNPSSAPPSGSAPPKTPPPKTHIATAKAAAT
FT                   PSPSLANPNPIPSCRTRVNWATTPATSSSSASSERMGRHTSMM"
FT   tRNA            complement(401862..401933)
FT                   /gene_name="tRNA-Cys"
FT   CDS_pept        join(complement(403952..404032),complement(403309..403901),
FT                   complement(403196..403257),complement(403062..403140),
FT                   complement(402900..403009),complement(402521..402849))
FT                   /codon_start=1
FT                   /gene_family="HOG000178977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263127"
FT                   /orf_name="AFUA_3G01600"
FT                   /product="Salicylate hydroxylase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="electron carrier activity"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86443.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053347"
FT                   /db_xref="HOGENOM:HBG324126"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="UniParc:UPI0000F51C60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN4"
FT                   /transl_table=1
FT                   /translation="MKVIIVGGGIAGLAAAIGLRRADHRVQIFERSSFLREVGAAIHVQ
FT                   PNASRILSDWDFDPKRARFVTGLRTMVVPGTSLTSNVGVDCSHFVETYGAPWYLAHRVD
FT                   LHTELRRLATTPDGPGFPAETILRSEVVGFDAENGSVTLTDGSVHQADLVVAADGVHTT
FT                   AIHQVIGHATPAVATGSAAFRFLIPTEDIQGDPETAHLLEDGLMRIYVAEGVRRLIWYS
FT                   CADNTVENFVGIHLYEHGDGQKEDWNLSADVSDVLAQYHDFHPTLLRIIKKATSIKRWP
FT                   LLYRDPIPTWSRGRLVLIGDAAHPMLPHQGQGGAQAIEDGGALGEIFARMPDHPTLDEI
FT                   RDRLALFEKVRVHRASVVTIFSNAGQDQGWKIKERAQQYMPAGAKIPSSPLEFMEHNFR
FT                   CDVLEESRRQLESYLSGR"
FT   CDS_pept        complement(405560..406225)
FT                   /codon_start=1
FT                   /gene_family="HOG000178443" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902827"
FT                   /orf_name="AFUA_3G01610"
FT                   /product="Putative uncharacterized protein "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL86444.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG053348"
FT                   /db_xref="HOGENOM:HBG324829"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051F2BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN3"
FT                   /transl_table=1
FT                   /translation="MQSSSIAAKCLLEPVNLHNTDQFAELQRQRTICGWFSDPQTIQKW
FT                   KQKQQENLKALFWITIPDPSTSDGNGSLLRAGHIALDAYCDPPDPDLACADKSVLTISS
FT                   FFILPEYRSYGLGRHAMRRIEEIAVVEPYGSPRCRFVTLNAQSKRYLYDEGPEWRGLWA
FT                   RLGKEPPAFSIQEWYESLGYVSWKEEPLYEEKTLDGEVVKLWEAFMRKEVQSETSVDQ"
FT   CDS_pept        406840..409302
FT                   /codon_start=1
FT                   /gene_family="HOG000217700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902828"
FT                   /orf_name="AFUA_3G01620"
FT                   /product="Ankyrin and HET domain protein "
FT                   /protein_id="EAL86445.1"
FT                   /db_xref="HOGENOM:HBG053349"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051EDD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN2"
FT                   /transl_table=1
FT                   /translation="MSRITPRTHQTYDYEPLPSPASIRLLRVDHKDPDGLLHCTIKNVD
FT                   LRDEPLYHAMSYTWGNPHSELAQVQETRDRYSDNYPPEHRECVSVKGKLLYITRNAYDA
FT                   LLSVPRDAWAQCCNRGDRRKLLRTSLHWASIAGKEDLIEPLLCSGVDVNVRDEWGVTPL
FT                   SYAAQVGSREGVELLLSAGADAGIVDNRGNTPLDYARQGNYQGIIQSLEEVMQKGGRLE
FT                   PRVDWPEGPERWCWIDQICINQDDIAERGAQVAIMDQIYKNAAFTHVWLGPEDAYTDTA
FT                   IKTIEKLDTAAGDFIQSKEIHPYREQPEEIYAAARIPHVSMEEWTSLAALFQRPYFRRL
FT                   WIIQENVLSGVIMGYCGPREIPWKAFHTVAQQIYFRQELLGRPTSTAFIAPHRPVAALE
FT                   SEMVYLTQWRERLQKGDEATIPRELSLENLIFDTWTFNATDPRDKIFGLYGLLREGGTV
FT                   DWRPDYSQSVGEVFARATKQIIQKAGELRILSAVHDESLRTIMNLPSWVPDYSANFCNM
FT                   MCANHHAAGDLPMVSITGSSWNKLPVTGVRFDSVLAIGNTTSGPGQMSMFFDQRWLELA
FT                   LLLPVPYPTGKTRTEAMWRTLCADQALDGSMPAPPSYGDMFRTMVCSLVCVKAAAEKDP
FT                   DNVVDLLSAAYHVRKTWSSPPLGELSVEELIAAVADPETNLSQPDCQTLTHLLHKLQFL
FT                   GVAEDQCFTPSIEEVEKAYYSSSWLPWDESETLQLPAEGQEFYNALRRKHGRRRLFVTA
FT                   NRYLGLGPASMVIGDEVWVLAGSGAAMVLRATEIGGEFRLVGAAYVHGIMNGEHIGDDV
FT                   KLQTISLV"
FT   CDS_pept        join(complement(410260..410425),complement(409666..410210),
FT                   complement(409422..409607))
FT                   /codon_start=1
FT                   /gene_family="HOG000217701" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263128"
FT                   /orf_name="AFUA_3G01630"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86446.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123771"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051EB81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN1"
FT                   /transl_table=1
FT                   /translation="MHLPREYKLSYYRYSPSVGAAVLFAVLYSIIFVLAVFQWIRYKAW
FT                   VWITMIIAVAMEAIGFISRSISAQHVSERTPYVLQFSLIILAPVLMAACCYILFGRILF
FT                   HVVPPEARTFQLCWVPPRFITPIFVGFDIVALLLQLGGAVLITSADGTSSDAKDKFDRG
FT                   RNIALIGVIVQMVAFGLFSLAAFRFNFTSKRFAKPVDEQFEMLASNDAGPGGREKSANW
FT                   NALLRVVNFSTLMILIRSVYRLVEFTEGKNGYINLHEWCLYVFDALPIFPCAALFVYWH
FT                   PAKYLPYLGFRLPKHAR"
FT   CDS_pept        join(411183..411242,411291..411860,411918..412871)
FT                   /codon_start=1
FT                   /gene_family="HOG000217702" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902829"
FT                   /orf_name="AFUA_3G01640"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86447.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053350"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00005200E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFN0"
FT                   /transl_table=1
FT                   /translation="MPFCCRPSKFCLGCRQRRIKCDMAVPACSQCKRAGKECVGYRDEL
FT                   PLLFRDENARTIRRATAAKARSRAQRKDTGSDSASSLDSQLMRSSHGSITATSLSSTLP
FT                   SLDMDEVGLHFFIYHFSTYAWAGRCSPRNITSPFMRRFGEDATLRSAVASVGLAALSNV
FT                   RKDEAILRGARQRYGQAIRVIRNALKSHTADQLDGTMKMILMVALFEIVDASPTSKLSW
FT                   FVHLQGAAALQNRSPQDFVTKNHRVQIMLTLTWISKYFQTGGRFPPELEGWAAPDIPVE
FT                   ANDDFPAVSLIELLLKFIRLRASLARRSGQSMSNALREALGCEMQLEEWSTSLPARFGY
FT                   TEKVSTDTSQYFYGRVHLYEDVWASRILIHYLVGRLFVNELILHLASQCESSIEKILQA
FT                   ARARRMILQLAVDICVAAGSQPLFPDYMSLERNGRIPPLSGVFLFMYPLAVAATATGVP
FT                   DDLREWVLRTLDHIGQTMGIRHALLMKDELAQSCQRRLQSQIYSHPTEISSSLPTSCLQ
FT                   NRDACLRLTD"
FT   CDS_pept        join(complement(414869..415200),complement(413735..414806))
FT                   /codon_start=1
FT                   /gene_family="HOG000217708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263129"
FT                   /orf_name="AFUA_3G01650"
FT                   /product="WSC domain protein, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="acetylglucosaminyltransferase activity "
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86448.1"
FT                   /db_xref="GO:0008375"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG024207"
FT                   /db_xref="HOGENOM:HBG053351"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniParc:UPI000051FEC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM9"
FT                   /transl_table=1
FT                   /translation="MRAGAQHLPFILSCLELASAFFKVPCSNPLVVERADPIVQPGVAA
FT                   SHAHTIMGGSGFGFTMDYNQTQESKCSSCSPIADKSNYWIPTLYYQAENGSFTPVEQNG
FT                   GALIYYLQRPDPKNKTVLAPPKDLRMVAGNPMDRKFKGTHEAEARSYACLDYNGPAKPE
FT                   TNGFPNYNCPNGLRSQVFFPSCWNGVDYDSPDHKSHMAYPIDSYNSGACPESHPIKIVS
FT                   IFIEVIWKTEAFADMWYGDSQPFVWSNGDKTGYGLHADFVNGWDVPVLQEALDTCDDMG
FT                   GDIRNCQVLKLYDDAITEGCLLEPSIDEKLDGWLDALPGCNPVQPGPDDAVPVKNCAAP
FT                   GIGEPQHYYTDVTKELGWAWIGCARDYINFEHILAESSSSSDDMTVQKCIQTCKKGGYT
FT                   YAGVEYSRECYCGNSIAPEKMPSVSPMGKCLHPCSGDPSQNCGGSGYIGLYQECGSSCD
FT                   NLEYPAVPE"
FT   CDS_pept        join(complement(419104..419464),complement(418431..419059))
FT                   /codon_start=1
FT                   /gene_family="HOG000292018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056098"
FT                   /orf_name="AFUA_3G01660"
FT                   /product="Glycosyl hydrolase, family 43, putative "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86449.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG053352"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="UniParc:UPI000051E6E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM8"
FT                   /transl_table=1
FT                   /translation="MVRIFSKLLTALVGLLALVPATSAFTNPIRNPGGSDPFMVYTGGY
FT                   YYLMTTTWTDVQMARATTIEGLKTAPKKVVYSTSTASRCCNVWAPEVHYLGGKWYIYYT
FT                   AGQTTDLDGQRLHVLTGGATPWDTFTYTGQLTTEWAIDASVLRTNAYGNFLMFSCFHGV
FT                   PYQSICLQQLGTDYVSLTGDIHVISQPTLDFEKHGTPVNEGPVALYFNGVTYIAYSASY
FT                   CWTPYYCLGLLTWDGQTNPTSASAWKKHNGCVLSSANGNYGTGHNSFFQSPDTSQTWIA
FT                   YHATNNSAGACDNSRYTMVQPLGTHSDGSPNFGTSQPFSHVFSEPSGN"
FT   CDS_pept        join(complement(422693..422865),complement(422509..422583),
FT                   complement(421581..422440),complement(421023..421519))
FT                   /codon_start=1
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263130"
FT                   /orf_name="AFUA_3G01670"
FT                   /product="MFS hexose transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86450.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG190581"
FT                   /db_xref="HOGENOM:HBG327399"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E48F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM7"
FT                   /transl_table=1
FT                   /translation="MVQIASIGAKGAQEKVQIAQAEAPQFEKVDWKREPHLRKLYMLSA
FT                   ALMVASATTGYDGVKESNWLGLLVNMFNIGAILSYFITPYVADHLGRKIAIITGCCFMV
FT                   VGGVIGCASNGYNMYIASRFILGFGNGLAQMCSPLLLVEIVHPQHRGPVTTIYNCLWNA
FT                   GALLVSVIGWGTSYVASEWSWRSITLLQIVPSVIQLMFIYCKSSSGTRVVPSVVANRSG
FT                   PKGIPESPRFLINKERHDEALAVLTKYHGGGDVLNTVVQFEYREIKETIRLEKEAGSKS
FT                   SYIDFFRTKGNLWRLAIIVSLGIISQYSGNALFSNYMNQIYEGAGITSQNQKLALSTGK
FT                   TMLDIIVTVAAALQVDKFGRRPLFLTAISGMVGSFVCWTITGAVYENSGETNSGSGYAQ
FT                   VVFIWIFGIFYDIGFSGLLVAYALEVLPFQLRAKGMMIMNLTVQAILALGNQTNMLAWN
FT                   NLPHHWNFMLFYTLWNFCELVFVYFFYVETKGNTLEEVARIFDGDDAIAHIDLQQVEKE
FT                   IEAEATYHETVPNKSAA"
FT   CDS_pept        complement(425906..426295)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263131"
FT                   /orf_name="AFUA_3G01690"
FT                   /product="Sterigmatocystin biosynthesis cytochrome P450
FT                   monooxygenase, putative"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86452.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053354"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="UniParc:UPI000051EB8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM5"
FT                   /transl_table=1
FT                   /translation="MADRISTPATPCSLRGRLDLDLRSWHEKYDGVVRPGPDEVTFITA
FT                   QAWKDIYGHGHLQLPKVQISTINGKNIFATNDVDHARFRKALSHAFSAKGLQAQECLVT
FT                   RYIDKRIERLKGFTESGTAADMGKW"
FT   CDS_pept        join(complement(428826..429041),complement(428469..428768),
FT                   complement(427995..428420),complement(427475..427940),
FT                   complement(427251..427421),complement(427126..427199))
FT                   /codon_start=1
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056099"
FT                   /orf_name="AFUA_3G01700"
FT                   /product="MFS alpha-glucoside transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86453.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG189941"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000052034B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM4"
FT                   /transl_table=1
FT                   /translation="MGNETVVPSENELKNFNPGNPDVVELIRYAQESDAADRLLTVRQA
FT                   LSKYKKAVFWAMFLSTSLIMEGYDLVIITSFYGQSQFIERFGEFSDKAGKKVITAAWQS
FT                   GLSNSSMVGQLTGLLLNAYSQDRFGCRPTMMFFMAWMALMIFIPVFAPSLPILAWGEAM
FT                   CGVSWGVFQTLSTTYASEVVPTVLRPYVTAYVCMCWGAGILLSSGVVRAVAGIDGDLGW
FT                   RLPFVLQWVWPIPLFIGAYLAPESPWNAVRRGKVDLARKSLRRLRQDTPDKEREVEATL
FT                   AYIQHTTKLEQAETENASFLECFKGTNLRRTEINCVVWAAQTLSGNAILGYSVVFLEAA
FT                   GFTELQAFDVNISLSACYIVGGVICWLLFPHFGRATIYMSGLSFMFACMVIIGGLGFAE
FT                   GNKGAQLAIGILLVICTLCNMITVGPVCYPIVAETPSGRLRYKTIVIGRFVYNLTGIFS
FT                   NSLTPRMIAASSWNWGAKTGLFYAGTNLLCNVWCWFRLPETKDRTFGEIDLLFHHHVHA
FT                   RKFKHTKVDQFAHQREYISKEEEGNMGTAEHIA"
FT   CDS_pept        join(complement(431282..431824),complement(430489..431259))
FT                   /codon_start=1
FT                   /gene_family="HOG000217710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263132"
FT                   /orf_name="AFUA_3G01710"
FT                   /product="TPR domain protein"
FT                   /function="binding"
FT                   /protein_id="EAL86454.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG053355"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000520804"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM3"
FT                   /transl_table=1
FT                   /translation="MFAAANQEDSLKDLSRAAESFWEREHLVQAEETARRALDGQKQLL
FT                   GDGHRETLTTATTLAGILKQQDRDDEAAIFYENILQTADEVLGGEDLVTLRVLNDFGLL
FT                   LQKQRKYDAARRMHEQAVRAYVAHYGEEHSSSISSMTNLARVMKAQRDYEEAEDLFRHG
FT                   LALREELLGVTHPETMDSAESLVRETAGRQLALMGGNSPDLLQCMSSFAILMLDHGRTD
FT                   ATVEIAKRAVETRKHWKDKHSLDTVDPNTLTSLNNLAGVLQSCGHHYSAEEIHREVLEG
FT                   SRLVLGPDHPNTLSTCSNLAQVLEKRGAFAEADDLKRQAYQGRVRVLGPEHSRTIASMA
FT                   DLVDVLVWQEKCGEATELNISLVDVKRKVLGADDPSTLWSMCTLGMLYERQGDLRAARD
FT                   TFDTAFAAAKTVCPPDHSVRRSCEAGWYRLKDVEDTRD"
FT   CDS_pept        join(433474..433539,434159..434254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750792"
FT                   /orf_name="AFUA_3G01720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86455.1"
FT                   /db_xref="HOGENOM:HBG053356"
FT                   /db_xref="UniParc:UPI000051E497"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM2"
FT                   /transl_table=1
FT                   /translation="MEHLNCRGPQRPAYGILAIGRRVMQPVVREEFASKTMITVAHRLR
FT                   TILVVIWW"
FT   CDS_pept        join(complement(434525..434648),complement(434347..434399))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263133"
FT                   /orf_name="AFUA_3G01730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86456.1"
FT                   /db_xref="HOGENOM:HBG053357"
FT                   /db_xref="UniParc:UPI000051E93E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFM1"
FT                   /transl_table=1
FT                   /translation="MMETRKDKMIFGPALRCRRSLVMSWEDRYIHKDAAIPIGEEDKWI
FT                   IISMAPYITRDQW"
FT   mobile_element  complement(435603..437144)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(437285..437343,437364..437516,437571..437772,
FT                   437822..438337,438384..438545,438735..438797)
FT                   /codon_start=1
FT                   /gene_family="HOG000159571" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263134"
FT                   /orf_name="AFUA_3G01750"
FT                   /product="G protein coupled receptor family protein "
FT                   /function="transmembrane receptor activity"
FT                   /biological_process="cell surface receptor linked signaling
FT                   pathway"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86458.1"
FT                   /db_xref="GO:0004888"
FT                   /db_xref="GO:0007166"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG053359"
FT                   /db_xref="HOGENOM:HBG324964"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniParc:UPI000051E920"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL9"
FT                   /transl_table=1
FT                   /translation="MCCRPSSVYVRACLWLPRVSSSAFRKPINRLIFYASWGNLLSNSA
FT                   TLIAESSLHGRTQGALCQFQGFMIQWFLPADSLWALAMASNVYLAIFKHYDTRRLGMLE
FT                   WKYLLFCYGVPFIPAFVYLFLSSESRGKVYGESVLWCWVSLRWDFLQIAVFYGPVWFIV
FT                   LLILAIYIRVGVTIRRQRRELRKTAWPVSEYATDITVLGDVDLHRTARSVPLGSLQRLT
FT                   NRERSPASTAASSHRIISREVRSPQNDDGPQNARPSIADSLSSNISPTSTTLSRYNYDL
FT                   GQSETSTTPASAAYYKYAVLFFAALIVTWVPSSANRVYALAASNHYIFGLSCASSFALP
FT                   LQGFWNSLIYITVSWKAIGTWFRQSTGRYRHEVHTRNRISYISS"
FT   CDS_pept        complement(439278..440528)
FT                   /codon_start=1
FT                   /gene_family="HOG000178888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207382"
FT                   /orf_name="AFUA_3G01760"
FT                   /product="Alpha/beta superfamily hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86459.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053360"
FT                   /db_xref="HOGENOM:HBG332128"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051F532"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL8"
FT                   /transl_table=1
FT                   /translation="MRQLMLAKWALRRVQRSLPGFSPIGTVRPSYHPLGSRSLYSTRNT
FT                   SRRRPQLAPAQSRGVFTSAIPPVLIPPVIFVSLLLGLWTWKCFWIVVMQDKLLYISWLP
FT                   PFARSEQISDYAGESRSVHWEERRIRSLDGTKLAVCEGRMPAPARSVAQKPRAQAQAHE
FT                   PARKKLVVICYFQGNGGSTPMRLPLLSQFLRAIHSPTGDVDYIVVALSYRGYWKSSGRA
FT                   SQIGIELDAVAFLQWVAETYGSSPDADVQMVLWGHSLGTAIASSAAATYLTRQPTTRGP
FT                   PAVPIAGMILEAPMSSTKDMLISLYPQKWLPYRYLWPFLWNNWSSAVALERMARWRDQD
FT                   RDPREHEHAVPPILLLSAEKDEVIPVYAAAELEQEGKKLGLNVDRLDVSGAMHTEIPIK
FT                   AAGRQAMIDFIKRCTSS"
FT   CDS_pept        join(complement(441305..441359),complement(440714..441174))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056100"
FT                   /orf_name="AFUA_3G01770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86460.1"
FT                   /db_xref="HOGENOM:HBG053361"
FT                   /db_xref="UniParc:UPI00005200E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL7"
FT                   /transl_table=1
FT                   /translation="MHLSLGSSANRRLVPPQMRTPIASAAVTVNVMHGAGVWGTTSAAG
FT                   GPWTNVRTRLTVVYALVSTSQATAATSTSEKASDWTTESTRQSVPSATLSTTTTSPTTD
FT                   LVTREGDKTVEGDGSKLKVGEIVGIVVGILGLIATALGSWSSCKTLKQRKHLAANAHKA
FT                   PNYLKLCS"
FT   CDS_pept        join(442291..442510,442563..443509)
FT                   /codon_start=1
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056101"
FT                   /orf_name="AFUA_3G01780"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86461.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F795"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL6"
FT                   /transl_table=1
FT                   /translation="MTSNQPPLRKRGIVSYGSYKTGGWKLKDLTLRPLKEKELLIEIVA
FT                   SGICQTDLHFAGAESGFGVHYPRIMGHEGAGYVREVGSGVQVAQIGDPVILSFSACRAC
FT                   ESCETGHPAHCANFNPINFEVEPDNLVFSEEASTATEPSIYGRFFGQSSFASYSIVRED
FT                   SVVNVRGVVDTRSELQLLSPLGCGIQTGSGAILNAAKATPKDRVAVLGLGGVGLSAVMG
FT                   AKIAGCAQIIGIERHASRLELAKQLGATHVVQVDTTADPQSVSDAVLAATNNLGVNIVL
FT                   DTTGVPALIAQGVRMASFKGKVLQVGTAPETGSLTIPIHEFMVAGKQYMGVVEGDVNPK
FT                   DYVPKMVKWVREGSLPLQKIVKFYKAEDFEQAIRDMQSGETIKPVIVW"
FT   CDS_pept        444023..444982
FT                   /codon_start=1
FT                   /gene_family="HOG000178899" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263135"
FT                   /orf_name="AFUA_3G01790"
FT                   /product="Isoflavone reductase family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86462.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053363"
FT                   /db_xref="HOGENOM:HBG331139"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520335"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL5"
FT                   /transl_table=1
FT                   /translation="MPSTPPLTSRPVVAIAGATGHLGKHVAAAFLSPPFNAYFSEIIFL
FT                   SRHDNPPVPSVPESSGGGAVVTVRKYDEDNLPAALEGVDVLVNTIGASGHEFKEKLLRA
FT                   FPSTGVQVYFPSEFGVDHYVHDFPHGEWDQKKRHFELAGQLIPQVKVCRVFCGLFLEDS
FT                   IGPWFGFDTVRGRYGSVGSAKSLVSFTGLEDVGKTVASLAAMPLMSIPEVVHIAGDTRS
FT                   IEEIAKVMEGAGAGPIEITEVDLMKYKEETTGKVSNDPASYLRFLMGENKINHTASGLE
FT                   SDNDLINLQQKTWKWKTMKDLAKSTNGRPWKDFPWPPK"
FT   CDS_pept        join(complement(446181..446424),complement(445811..446135),
FT                   complement(445132..445762))
FT                   /codon_start=1
FT                   /gene_family="HOG000216897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263136"
FT                   /orf_name="AFUA_3G01800"
FT                   /product="GPI anchored dioxygenase, putative "
FT                   /function="ferric iron binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86463.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053364"
FT                   /db_xref="HOGENOM:HBG757944"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI000051F79B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL4"
FT                   /transl_table=1
FT                   /translation="MHFSKFFLVAAATLAAAHPGEVHDAHALKREIRARDAYAVAAKRA
FT                   LDACASTTEAQQLNQRNVARRARTARQLRQNKGITTNAHKWRRDLAALEKWEAINHNKT
FT                   DVLDYSANTPESRIFGGNTSAILAPTITDGPYYVWGEILRQNVKEEKYCDGVDLTLEVQ
FT                   YIDVNTCRPVKGAVVDIWNANATGVYSGISTSGNYAADGWDSTYLRGIQQTDDDGVVTF
FT                   DTIFPGHYEGRATHTHLLTHLNATMNANGTLEVGTGSIAHIGQLFWNEVLRSAVEDTSP
FT                   YNTNTQAITTNADDMWSVLQASDEYDPFPEYLYLGEGLEDGLFAWIQIGINASADYTDN
FT                   SYYSIAAYYQEDGGHQNSASSAFGGSGGDMNGTMPSGVAPSGAMPSGAIPSGASPSSSA
FT                   "
FT   CDS_pept        complement(447466..448887)
FT                   /codon_start=1
FT                   /gene_family="HOG000048383" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263137"
FT                   /orf_name="AFUA_3G01810"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL86464.1"
FT                   /db_xref="HOGENOM:HBG053365"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniParc:UPI000051E930"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL3"
FT                   /transl_table=1
FT                   /translation="MTGLAQCPAQVVEEIDAYLDLTDVGNLRQTNRRLRSQVTQGRFRL
FT                   NFRSKRVKITGAHLQQLGLLTQRGWLGCETRHLTLVGVVNDTMALDAGLKADATNPRKR
FT                   DLAILQQRRQDYEQLLESGKIVQLLSQAFKYLATNSAERKLQSLSLEVTVYRQDAEREV
FT                   TPLAGSSWRLVWQTTAETFRIVLAALQKSLLAVDYLNVFNGSYMQRCSLESRELSQIDY
FT                   HNERLSKVLGALKALSISVSDRILWLTPQDAQRSSDGSADVIDWSDDEHDRRIDKAAAE
FT                   AQDESNFVGLARILDLCHELKSLQIHQYLVNARHLTFHIPFPRERLFQRVAELAALPAL
FT                   EDCSLRGVFIRERNLLALLKRTQLRRLTLESVQMVSGTFRSTFDACTGETSSLSYLYLD
FT                   ELMIQGDLVHFTGVGAPRFNTWVGAHGSNTLKREGEELKHPIRYHLPHGMPIPLGSPAR
FT                   QQWILEQRQEYGPHR"
FT   CDS_pept        join(complement(450605..450915),complement(450381..450531),
FT                   complement(449749..450240))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263138"
FT                   /orf_name="AFUA_3G01820"
FT                   /product="Amino acid permease"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86465.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG053366"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniParc:UPI000051E47C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL2"
FT                   /transl_table=1
FT                   /translation="MGGASCCPIPWPSGPRVSRETTHNDTAEDEDDLQLLKLGYRAELA
FT                   RAWVAFDNVTFSFAALHCIGGIRVFFYIVLSAGGPAAMYVLMIIVFVDCNSQYEGGAHG
FT                   INLLLGMPFMRRRQGCRFVSFLAAALTLVAWTSFLATDSFGVANYAISHVVFLAGFIVV
FT                   VIDILLNRIWLPIGVSKTYGFRPAEYGFTSTYNGGGMAPSLNWILSWYLPARCLVGQHA
FT                   SGHIAEETVTARKSAANGVFWSTVASSLCGLHYHPLPVLHAHDRNIPRRSVPQPFINMY
FT                   VMALGSHAHAVAATFSLVCLAAANTNRTTSRSSRSL"
FT   CDS_pept        join(451843..452459,452507..453443)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750793"
FT                   /orf_name="AFUA_3G01840"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86466.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005200E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL1"
FT                   /transl_table=1
FT                   /translation="MTSKAAAFHDEGDMAKPTGLDAIHMVRIPLTEEDSKRICRKTDRV
FT                   ILAILVWVYFLQILDKSVLGYGATFGLQADTHLTGNQYSLVGSIAPIAQLAWQPFSSFL
FT                   IVKVPHRILMPSLVLGWGIAQTCMAACHSFGGLMATRFFLGLFEAGCLPLFSIITSQWY
FT                   RRAEQPIRVAAWYSTNGLATIVAAALSYGLAHIKSDLLKEWQIIFLFVGLITVISAPIV
FT                   YWKLDNDIASARFLTEQEKLQAMERLRANQTGAGSREFKLSHVVEAGLEPKTYLWIAMA
FT                   MLLNIGASVTNVFGPLILKGLGFNKYTTTLLNMPFGALQWIVILLASYLAQKARLKGAV
FT                   LAAFMVPVVAGLAMLHALPRNDSVQGALMAGYYLLAFLFAGNPLVVSWMVGNTAGMTKK
FT                   SVVMSLYNAASAAGNIVGPLLFSSEDAPTYHPGLQACLGIFVALVAVVLIQWADLFVLN
FT                   KLQEKKRVRNGKPAKMVDRSMDDHYHGTGGDEEAMQEELGNNGLLDVTDRDNDEFVYIY
FT                   "
FT   CDS_pept        453676..454857
FT                   /codon_start=1
FT                   /gene_family="HOG000239346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263139"
FT                   /orf_name="AFUA_3G01850"
FT                   /product="Porphyromonas-type peptidyl-arginine deiminase
FT                   superfamily"
FT                   /protein_id="EAL86467.1"
FT                   /db_xref="HOGENOM:HBG249029"
FT                   /db_xref="HOGENOM:HBG668771"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniParc:UPI000051E6F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFL0"
FT                   /transl_table=1
FT                   /translation="MRFSQAMSKAASIVGQYTGRYIYPAETSRHLATLLGFPSRHSISS
FT                   AYYDNACTDIANLASAISAFEPVRLYSRPEDLPRAQSMVNQAIPKYTGNTSNISFIPFP
FT                   TNHLWVRDTGPVYVLGTGDARSRRFAINFRFREWGKRDEMESQERAADEQDWPIMTTAQ
FT                   LDENATFARRVIETDVSPSPVTLVESRVCLEGGALVVDGEGTLLATESSIINDNRNAGL
FT                   SRSEIEAELQRLLGVEKIIWFPGRKGLDITDVHADAEVGFIRPGVVVLSRPHASVPRAW
FT                   LDVYEEIREILTRSVDAKGRPFEIHTVDEPDPALLGDLSYDEPATNYVNFYFVNGGLIL
FT                   PQFGDEVTDKAAVETFQKLCPGRVIQPVYVHALPLAGGVIHCATQPVIAVPQD"
FT   CDS_pept        join(complement(456194..456389),complement(455085..456121))
FT                   /codon_start=1
FT                   /gene_family="HOG000168387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902830"
FT                   /orf_name="AFUA_3G01860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27273.1"
FT                   /db_xref="UniParc:UPI0000F51CBF"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z2"
FT                   /transl_table=1
FT                   /translation="MAPALRHLFSRREFDPGSTSTAFADEWSNPSNYAFTILLLIGGDL
FT                   IHRALAQLAGGWVTPVAFSFGWVSYAASSICSALGEYRMMPDADTACCLINGKNGYVRG
FT                   NNSWVLGRIMRDYEYWMGEPVREKTESLIQARWDFDRQRQEREVPGSGSRVPRPSQAGL
FT                   VVSLWQPSTTKPSGEPGHDLLHWSGIIVTVIQLGIAAVPLGLSGDWGILMITAAATILC
FT                   YVTGALGQWKVEKWACRRLDTREKKNFVLTRGNGAQHAIAIISNGRGLDLEDLATGFSK
FT                   IDSPSITLFAQLATIVFGIMWIALLITASALQDDSWYLIAVGGLGMLQNIFVAGWKRTP
FT                   DAYGVPLEFIGVVGEVKVMKTLMEVERRYEKLGKSMIGTFFPGDLRENEVREWEAIAQE
FT                   WKEKRSMNHQV"
FT   CDS_pept        join(complement(458200..459314),complement(457939..458099),
FT                   complement(456772..457886))
FT                   /codon_start=1
FT                   /gene_family="HOG000217712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263140"
FT                   /orf_name="AFUA_3G01872"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27274.1"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniParc:UPI0000F51C63"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z3"
FT                   /transl_table=1
FT                   /translation="MEHLPLPEGKEHFILAPYNAPPEEWYDHKGFLDFPKRRGWTDDQP
FT                   PGGNTTQKGYLEGHGIKWKLADSEVEEFFQTWLFFGLVIEVLKVGGVSATTEDFLKGKG
FT                   LSDPREVKLLRLSSQDDSRRHRLVRIVNTSILSCKLKEWRNGVRDKAQAWTAANRMFER
FT                   ARQILDCFCTPDEERDLWGNDKPLRWPVRDEISTTLIAMVYSLRSAAIRVCEPRGISVT
FT                   NPWLDARSEIIARRIQRQWCLADATTIIKDLPIDGQYYVAASPGLSPDELDRHSKCVRE
FT                   RCLEEFPTELYHPRHVAPWHKPNCPTAQTISYGGHLGPERGQTGWDDAIAKIIDKNAIP
FT                   IALWAKGLRTLWSVEYHLSGHRRPDYVAISHVWADGMGNRAANWLPECQLDRITHLVEN
FT                   VQWEGRRPLPEDPNNSDGVGFWMDALCVPAVDKDRKRKAIRNMRHVYSNAKAVLVLDKF
FT                   IQKIPSTAPALDKVARLYLSNWIKRLWTHQEGFLPSLVYIQFSDRPVELRALAEEFMTY
FT                   NREHLEKSGKYLGFPFAANLRLLDLYSALRGLMKLVKEKWMLYEPLAHHLSPRRSTRLA
FT                   DETVCMATIIDIDLDRIQAISGDDDEEVAEERMAAFLEQLGTFDRSVIFNNYERLNKAG
FT                   YRWAPKSLLNFRTPQLTCPDERETVTLERINGQVGLPVRYPGLLVDFAHDNVPFGALQH
FT                   GCEVPCRVSATRGSNVESKSLVLQFPRNNVRWAKRQYAVILSKVPNVGGKPCLAAVGLF
FT                   NRPANGVYRFNHLSLARIRAQEAYGDELVDVRFLDSDSAWFVM"
FT   CDS_pept        join(complement(463722..463836),complement(462715..463645),
FT                   complement(462291..462656),complement(461641..462208))
FT                   /codon_start=1
FT                   /gene_family="HOG000214999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207383"
FT                   /orf_name="AFUA_3G01880"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86470.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053369"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E921"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK7"
FT                   /transl_table=1
FT                   /translation="MADYQNTSVRPLRRERLKVSTACQACRLRKAKCDGGRPACIRCLR
FT                   RGKACTYSINSNAVERQTKREPLVPKAPTIRSHSPVSASSPNSGACSLSTTSTSGPSSR
FT                   SAQTDEDQEPDLDRDPTRAYYSTHGQFAGEVAAAIDVRAGLVPATTSNLVPFVDAPLFG
FT                   ALDLDFPYKGLNPATALPPRAHADRLVCIYWQYIDPVEPVLSRERFLHDYEATFARSGA
FT                   LLHAEHDVWLSILNVVFALAVQRQEFIPAQQRDEEGNRYFQRAWALLRPEAILWQPGTI
FT                   ELVQCLMLMNRYLHCTSNQLKTWMTAGLAIRIAQSICCHLPDGSSAKQSSVDRQLKEQV
FT                   WASCVALDRCVSWSLGRTSAPSLISLPNRADAMSTSASYLQGGKHAGHLSRELHEIGNQ
FT                   IQLAQTQTRNPLAARLGLPRLYQLDDYHAVAVQLDACINKWENDLPSDWKLKNLGKVVD
FT                   RASRAERYVLHLRLLHSRIVLYRPMLARLYSLKSHPAANQAQPIPPSLSDRLLRECAGL
FT                   CVETAQKLTSLIIETLEPNEPMGLLPWWYRVYYLHIAGTNFLAAMFEADLFTASVSQSW
FT                   RDVLSALRAHEHLSIYVQQCIRTFELLSTRILGTQYPTPDATGGMAPEEATSGSLFDHI
FT                   FQDLGFDCDSFLFGMEDFTEGGAR"
FT   CDS_pept        join(464266..464598,464714..465934)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056102"
FT                   /orf_name="AFUA_3G01890"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86471.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E6E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK6"
FT                   /transl_table=1
FT                   /translation="MSQQAEPKITADPEVQQSPIYNGQGTEEDPFIVEFQKDDPGNPMN
FT                   WSQFRKWFITAIVTFSVFAITFTSSAYAASANELIPDFSISTEVFTVGLSLFVLGFAIG
FT                   PAVWGPLSELYGRQALWIVSHIAMVAFIGGSAGSHNVATLLVLRFFSGTFGGSPLVNSG
FT                   GAIADIFPPAQRGLAMTLYCVAPFLGPILGPIVGGFVSENVGWRWVQGVCCIFIGGIGI
FT                   IGVIFVPETYGPVLLIRRASRLSQAHGKVYISILEKNQGKKKPSEVFQRALIRPWVLLF
FT                   REPIVLVASLYMAIIYGTVYMFMSAMPIVYNEQRGWSEGIGGLAFMGIAVGIIIGLAYA
FT                   IYDNNRRYANLLLSNSATAESRLPPAIVGAVALPVGMFAFAWTNSPRIHWSVSIILSAP
FT                   FGFGCVLVILPIVNYLIDAYTIYAASVLAAAAIFRSIVGAVFPLFTTQMYGSLGIHWAS
FT                   SLPAFLTVACMPFPFVMYRYGGALRMKCKYAFEAAEMMRRMQMQQVPAPAKEEEDSPSE
FT                   "
FT   CDS_pept        join(complement(467599..467706),complement(466686..467549),
FT                   complement(466318..466638))
FT                   /codon_start=1
FT                   /gene_family="HOG000178855" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263141"
FT                   /orf_name="AFUA_3G01900"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86472.2"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053371"
FT                   /db_xref="HOGENOM:HBG324129"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI0000F51C6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK5"
FT                   /transl_table=1
FT                   /translation="MEPDSYIDPNLTRSDLLVLQTLLSDAQAQSTGSKPVTLKYVPSHH
FT                   NSQCKSVPEQLEAFNNPQHADFEPTVTMTWDTADLKAKLPSAVNQCLLQPYIQLGRRVV
FT                   RVETDVVMLTHLILYFTTSVPSALYLHYHFTWTHGVLHWIMQSYYVGTYTLMMHQHIHM
FT                   GGILAKRFWLVDSLFPYITNPLMGHTWNSYYYHHVKHHHVEGNGPDDLSSTVRYQRDEL
FT                   SDFLCYLGRFLFLVWFELPSYFFRKGQVLQGLKAASWEIGNYLFIYGMYRFVNAHATLF
FT                   VFILPLFLLRLGLMIGNWGQHAFVDETDPNSDFRSSITLIDVPSNRFCFNDGYHTSHHL
FT                   NPRRHWREHPVAFLKQKDRYASEHALVFRNIDYLMITYRLIRKDYTHLAKCLVPIGDQI
FT                   SMSIEERAAMLQSKTRRFTEAEIARKFGVSR"
FT   CDS_pept        join(471035..471113,471169..471237,471285..471564,
FT                   471613..471866,471916..472053,472105..472362,
FT                   472413..472654,472703..472747)
FT                   /codon_start=1
FT                   /gene_family="HOG000178851" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902831"
FT                   /gene_name="cbhC"
FT                   /orf_name="AFUA_3G01910"
FT                   /product="Probable 1,4-beta-D-glucan cellobiohydrolase C "
FT                   /EC_number="3.2.1.91"
FT                   /function="cellulose 1,4-beta-cellobiosidase activity "
FT                   /function="cellulose binding"
FT                   /biological_process="cellulose catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86473.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0016162"
FT                   /db_xref="GO:0030245"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG053372"
FT                   /db_xref="HOGENOM:HBG756137"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001524"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="UniParc:UPI000051F048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFK4"
FT                   /transl_table=1
FT                   /translation="MKHLASSIALTLLLPAVQAQQTVWGQCGGQGWSGPTSCVAGAACS
FT                   TLNPYYAQCIPGATATSTTLTTTTAATTTSQTTTKPTTTGPTTSAPTVTASGNPFSGYQ
FT                   LYANPYYSSEVHTLAMPSLPSSLQPKASAVAEVPSFVWLDVAAKVPTMGTYLADIQAKN
FT                   KAGANPPIAGIFVVYDLPDRDCAALASNGEYSIANNGVANYKAYIDAIRAQLVKYSDVH
FT                   TILVIEPDSLANLVTNLNVAKCANAQSAYLECVDYALKQLNLPNVAMYLDAGHAGWLGW
FT                   PANLGPAATLFAKVYTDAGSPAAVRGLATNVANYNAWSLSTCPSYTQGDPNCDEKKYIN
FT                   AMAPLLKEAGFDAHFIMDTSRNGVQPTKQNAWGDWCNVIGTGFGVRPSTNTGDPLQDAF
FT                   VWIKPGGESDGTSNSTSPRYDAHCGYSDALQPAPEAGTWFQAYFEQLLTNANPSF"
FT   sig_peptide     471035..471091
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFK4 "
FT   mat_peptide     join(471092..471113,471169..471237,471285..471564,
FT                   471613..471866,471916..472053,472105..472362,
FT                   472413..472654,472703..472744)
FT                   /product="Probable 1,4-beta-D-glucan cellobiohydrolase C "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFK4 "
FT   CDS_pept        join(complement(476333..476665),complement(476029..476279),
FT                   complement(475369..475976),complement(475186..475283))
FT                   /codon_start=1
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263142"
FT                   /orf_name="AFUA_3G01920"
FT                   /product="Acyl-CoA dehydrogenase, putative "
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86474.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG494288"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000051E945"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK3"
FT                   /transl_table=1
FT                   /translation="MAEVSPNPIPFSEPPYLRGLPSPYYTASHRRFQKACRAFLWEHLL
FT                   SHAMDWEKAGTVPEHVFNDFCKHNMLLPNLPAPLPVDWLKKLEIHDILGVKVEEWDYLH
FT                   TGIYCDELARSGLAGPGASLSAGFAFGIPPIIKYGSKDLQERFLPDLLTGRKRGCIAIT
FT                   EPEAGSDVANITTTATKTPDGKYYIINGTKKWITNGIWSDYTTMAVRTGGPGAAGLSVI
FT                   LVPLKGYPGVTMRRLKVSGQITGGTTYIELDDVKVPVGNLIGREGDGMRIIMTNFNHER
FT                   LTIAVGVTRQARVALAAAFEYTMKREAFGKTLMDQPVVRHRLAKAGAELETMWAWVEQI
FT                   LYQLCHLSKEEADQQLGGITALAKAKAAMVLNECAQCAVLLFGGAGYTASGQGELVEGG
FT                   SEDVLLDLAVRQLVKIYQLGEKKLAKKAKM"
FT   CDS_pept        477531..478136
FT                   /codon_start=1
FT                   /gene_family="HOG000167026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263143"
FT                   /orf_name="AFUA_3G01930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86475.1"
FT                   /db_xref="HOGENOM:HBG051983"
FT                   /db_xref="HOGENOM:HBG333960"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI000051EDC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK2"
FT                   /transl_table=1
FT                   /translation="MEWIERPLSWLLANRKGHDAGLIQHTPPFAEHPKPSVTVECPEIG
FT                   PSGSQIPVKYSFFGEDLFPTLKWSAPPAVADNIKEWLLVVEDPDAPLAEPVVHGLYYSI
FT                   PASKCSVSNEDLKPTAAGSHLLRGGFQYGANRRGTIYIPPRGMLGHGPHRYFFQVIGLL
FT                   EPLAVSKLGAVVTKTEIIGLIEGRVVAWGQWMGVWERK"
FT   CDS_pept        join(478700..478954,479004..480272)
FT                   /codon_start=1
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263144"
FT                   /orf_name="AFUA_3G01940"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86476.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058554"
FT                   /db_xref="HOGENOM:HBG738000"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FC87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK1"
FT                   /transl_table=1
FT                   /translation="MSDEKQQQNDAREAIAKETQASQNVSPKDFSVFTTNEKRAIILMG
FT                   SLAGFFSPLSSSIYFPALDTIASSLQVSITKINLTVTTYLLLQGASPMLIAGFSDKVGR
FT                   RPAYIICFTIYIAANIGLSLQNSYAALMVLRCIQSAGSSGTVALSNGLVGDMITSAERG
FT                   SYIAVASIGLMLGPSLSPIIGGLISQYLDWHWIFWFLLILSSVFFAILLLFLPETCRKV
FT                   VGDGSVPPPPLNNNVSDIIRHRRRKRAGLAADQASIAEYRKNYRFQLPNPLPTLLIAFE
FT                   LETGLILLAAGLVFAGFYAVMTGASTSFHEIYGFNDIQSSLMYIPIGAGGIVASFVTGP
FT                   LVDWNFRRHARRAGLPVEKRKQSDLSNFNVERARLEVALPAFYICCVTMIAYGWVMNQK
FT                   VNLAGPVILLFLFSLGLSCTSQVLNALLVDLWPKRSAAATAANNLFRCELGAGASAAIA
FT                   PMTNAMGHGWAYTTLALICVLSTGCLWWTMFFGIQCRQKRAQREQARRS"
FT   CDS_pept        join(complement(481439..481557),complement(480555..481385),
FT                   complement(480465..480509),complement(480364..480421))
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207384"
FT                   /orf_name="AFUA_3G01950"
FT                   /product="Zinc-containing alcohol dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86477.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51CC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFK0"
FT                   /transl_table=1
FT                   /translation="MQAVVFNGPLEVTLETRPIPQIQDPTDAIIKVRYTALCGSELHVF
FT                   RGHQPSSTGFIMGHEFTGEVVETGPAVRNFRKGDRVVSPFTISCGECFYCARGCSSRCA
FT                   KGKLFGSAVLDGGQAEYVRVPLADGTLVAAPAAVDEKKLVLMADIFPTGYFAARNAFRG
FT                   WDEEDVRGSTVVLFGCGPVGLCALISALEYQPAALIAVDSVPDRLERARSLGAEAWNFQ
FT                   TDAQGLRERVLELTEGRGADVAIEVVGHSSALRMAFELLRPWGRISSVGVHNGEIPWTG
FT                   NEAYGKNLQTQMGRCPVRSIFRDALELLLKKQDSLEFMAADIRPLSQAIAAYDDFNQMK
FT                   SQKIIFEAGK"
FT   CDS_pept        join(complement(482158..482362),complement(482056..482084))
FT                   /codon_start=1
FT                   /gene_family="HOG000178830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056103"
FT                   /orf_name="AFUA_3G01960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86478.1"
FT                   /db_xref="HOGENOM:HBG053373"
FT                   /db_xref="UniParc:UPI000051FEC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ9"
FT                   /transl_table=1
FT                   /translation="MPISLSNPFKSSKSQCQTTTEKAQKSVKDDSSSVYSDAATLVSGR
FT                   EQSAKATTDPQHQKGIDFSSTRYTPMGMCPRS"
FT   CDS_pept        join(complement(484784..485174),complement(484461..484716),
FT                   complement(484174..484386),complement(483688..484033))
FT                   /codon_start=1
FT                   /gene_family="HOG000217507" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902832"
FT                   /orf_name="AFUA_3G01970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86479.2"
FT                   /db_xref="HOGENOM:HBG053374"
FT                   /db_xref="UniParc:UPI0000F51C8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ8"
FT                   /transl_table=1
FT                   /translation="MSEWHSFTEDALQVFREAGVSHNVPFHDETELYTVGNELGVSGRF
FT                   VRNLCDPVMKALEPLPCMASIRFADFQAISTPGDVVPDVCLGLVAVVPTPDNVHLVGEV
FT                   KTPWTIPDAYIHLNRPNTSYHLEPLIGQLVAQMRACSLRFGFLSTYNSSVFVKRAADSS
FT                   FLLSPPIKYKAREPSLRQLFAGFVLMALSEPKYFESPSFQPRDVSIDSGNWERNPDYPA
FT                   PALTSELDSVTSNSVIVNTDGSSTTVINCVRRLSDARVKFKATWLATMNGTPVILKCWQ
FT                   PKYEELGDIVCSSIFPSGYVLVLEHRDGMRLDRLWHTLSNTERAQVQSQCLNSVHALRQ
FT                   VTVRLDDAGMHNILYNRESGVIALLDFESAQVVESHSVVPVNHEMGAIFGSDFLLGHPS
FT                   GD"
FT   CDS_pept        join(485494..487163,487226..487490,487539..487901)
FT                   /codon_start=1
FT                   /gene_family="HOG000169253" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750794"
FT                   /orf_name="AFUA_3G01980"
FT                   /product="Chromatin structure remodeling complex protein
FT                   RSC3, putative"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86480.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053375"
FT                   /db_xref="HOGENOM:HBG325685"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F06F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ7"
FT                   /transl_table=1
FT                   /translation="MISTNHPENMERKRRNGQLPSCEPCRKSKLGCDHTRPICNRCVRR
FT                   GRTEECFYHPSPLTKPRQSNATVQSRNQVPGASYSIRDLSVSSTVSGSSAAHRPSALTK
FT                   PRESKAAAIRKPRQKLTHRPSQNQSSPNANVSVNASVSPIGTHSVSVSVSASVSASPLT
FT                   IGESHAWEKRPFANPGFLGLTSYSDNVTGYAAVLDHAMRPHGSGSSPSGSIAAAVDSRQ
FT                   VELGAQVLMLLDHLALFEELLEKRFAIWEGWIFSTQMFRCIVEVLRDLYRDTTEGMQDK
FT                   YASVLELSRTFFRNTATEIELRASMTLSEYVALSAARWDTYALLLSSIGYSIYHVPQDD
FT                   PIFQSGILPGNDRKGLRRIALAASDICLQLCDKLGMISDTLCCAILQHSVLVHHTYGTG
FT                   GKFVPGWRKPGFGLMKRTDYRTWQKLGDLTTILFALGLHQAGDDKNTPFFLSELRKRVM
FT                   VGAYGMDKDLALFLGRPPRICKQYCNIQSPLDLTWEELIAPPTVRQAALQKLDAQGWNT
FT                   EGKLGSGARARTVHLACLIREDILELSIGQGRDNVEEHAERVLKRARQWRSELPAFLHW
FT                   GPESTSPELASLHLEFLHQDFLIYSTLVKRVGKGHDALIKVSLEIITCLLDLLSVQMRA
FT                   LKIYILTTYDLCYVGLPAAGALATELLRRSQPTLEPVLSSAPFPRSEIIQKLSILISHT
FT                   DTFIQQHEGDYEIALQGQLLIRQVLDRVLSPTTEQAFPDSSVNGMTIGDDVDFMALLES
FT                   FDWEQEIRPTFS"
FT   CDS_pept        join(490461..490512,490564..490610,490680..490743,
FT                   490791..491041)
FT                   /codon_start=1
FT                   /gene_family="HOG000256797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207385"
FT                   /orf_name="AFUA_3G01990"
FT                   /product="DUF636 domain protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="EAL86481.2"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="HOGENOM:HBG053376"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI0000F51CAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ6"
FT                   /transl_table=1
FT                   /translation="MTLNGSCMCGAIAYISSSDSLINCLCHCVDCQKWTGSAFTSNVIV
FT                   PRDSFKVTKGTPRSYDTTGDSGKLNKHFFCGDCGSSLYSELEIMSDKTGIKAGTLDGGE
FT                   AHLRNKVDVEFYVKDRVHYLNALDNVRQEPRLG"
FT   CDS_pept        join(491354..491471,491549..491719,491889..492385,
FT                   492436..493644)
FT                   /codon_start=1
FT                   /gene_family="HOG000178819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263145"
FT                   /orf_name="AFUA_3G02000"
FT                   /product="C6 transcription factor Ctf1B-like, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86482.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053378"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51C68"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ5"
FT                   /transl_table=1
FT                   /translation="MTLSESGRLQVIDCGFHGDFLVCRGRPGRVADLGSSLSVGSQLPQ
FT                   CIPFPDVQELPSLELVRTALRPGSDVMLASVEARARPVVGPNWTVTRMGAHQDIFASQL
FT                   RESERECNVKSGMAGNPAVLSTIPLDYHISIINQLFGPGSAAPPAVRLPSYLVGLPDRL
FT                   HSDDIEYLRCSGALDLPSETLRNELLKSYLLWVHPHMPILGLHEFLSAVAGDNESHRIS
FT                   LLLFHAVLFAASAFVDECHIRAEGYPSRSVFRESISCKVKVLLDFECEDDRLATAQALL
FT                   LWVSHPEPHHDQKELTQRLGICISMISSSQTQMVKANARKQQIWRRTWWSIYNHVRITS
FT                   SNPLTLKHDPENGDLCDTPLPSTHDFRFGALSPNVQTLVGNCDFLRDVQYQQFLARLFI
FT                   EKSKLCQIGQFPGPSRDLSDSSSRVVGLASAENKACPTEIAELARRLGRWHTQLPPALR
FT                   HQSTTSTAVTELEKFILVHRAWLLLLYLASAYVVCTCSVGRNSHAEEHILNRISLVFDE
FT                   LHRLGFINVLPNPSVAILMPAVEFHITAVESACPQTNGASQRMLQQFSEILHQLQGSSA
FT                   LAGRMIEKLNNITATETKDDLSRVIASESAIAEQSVSNADFVLDETDDFYSFLESGMSF
FT                   ANVIPLVDNSPNIGLDPPLCNESYFSQLP"
FT   tRNA            complement(493852..493923)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(494418..494620,494664..494886,494943..495129,
FT                   495184..496280)
FT                   /codon_start=1
FT                   /gene_family="HOG000216863" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902833"
FT                   /orf_name="AFUA_3G02010"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86483.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053379"
FT                   /db_xref="HOGENOM:HBG324134"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000F51C66"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ4"
FT                   /transl_table=1
FT                   /translation="MNFADMFLILSVIATLQLLAFWLLNKLDYYRIKQFAAWPQPKPSR
FT                   IWGHMKDLNAFISRGEPNRHIGKEDYVFAEIKAHLGNPPLYLLDARPMQHPLGIVCSHE
FT                   IAEQVSRSSKQFPYGLPKTPTLQDYKYLVGPHSILTSEGEEWKSLRKRFNPGFAPQHIL
FT                   TLLPRILDKTVPFFETLDRYAESGEEFSLAETCTNLTFDIIGAVTMDEDLGAQLPLDKQ
FT                   SEMVRLYHELTASYHQKSSVRAKPSNPLVIWQQYKLARKLNAIIKNHIKRKFAELKEAS
FT                   SDEKKSRSVLALSLQGIEKLDAHVLDQTCDQLKTFLFAGHDTTSIVLQWAFYELSRTPR
FT                   VLESISRELDDVFGPDPSPAVVRDKLLAPNGGELLSKLPYTTAVIKEILRVYPSSGTGR
FT                   LVPEGSDVYIQLPDGRSLCIDGVLMYNCETLIHRDETVYGESKDDFLPERWLGDSGADR
FT                   IPSSAWRPFERGPRSCIGQGLATIEAQVILACAVRQYEFVKIGLGEVARDNAGEPILGP
FT                   QGQYEVKSKLFNVSLRVSFWDLSTALTFKLDNASDCKAGRWNDNESEVVLRW"
FT   CDS_pept        join(500884..501021,501168..501282,501332..501576,
FT                   501628..502077,502128..502712)
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263146"
FT                   /orf_name="AFUA_3G02040"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL86486.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI000052034C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ1"
FT                   /transl_table=1
FT                   /translation="MAYVGSTRGGPIIGDSAHSKASAIKMFTHPAPQPSNSDALLNLLI
FT                   SENIAMRLQSLPRLGWNALWTTLIFSSLAQAIDVDINDDQSIKNAASTAAYGAMSYYHG
FT                   NESGQIPGAFPTKWWEGSALFMAMLQYQYFTGDHTYNSDVSLGLQWQAGDGDYMPSNYS
FT                   SYLGNDDQMFWGLAAMLAAELQFPDRSEGYSWLSLAQGVYNTQVDRWDTSTCGGGLRWQ
FT                   IYTYQAGYTMKNAISNGGLFQLAARLARYTNNHTYYEWAEKVWDWSCSSPLLNNKTWSV
FT                   ADSTNIEDGCESQGNNQWSYNYGTYLMGAAYMWNYTNGTNSKWATAVDGLLNNTLDIFF
FT                   PAKYGGNIMSEVLCEPNEVCNDNEILFKGLVTSWLAFTALLVPSTYDRILPKLQGSAVA
FT                   AGATCTGNGNNSCGVRWYTSKWDGWTGMEEQISVTDVLSVSLITTKHKGPVTSTTGGNS
FT                   TSNPTAGSGDKSGQTTPTRKITMGDKAGASILTIGLVVGWVSLIAFMIIGGK"
FT   CDS_pept        503252..503767
FT                   /codon_start=1
FT                   /gene_family="HOG000178786" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263147"
FT                   /orf_name="AFUA_3G02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86488.2"
FT                   /db_xref="HOGENOM:HBG053383"
FT                   /db_xref="UniParc:UPI0000F51C85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI9"
FT                   /transl_table=1
FT                   /translation="MLRTLIRTAQTTTRPPVYLYTPVLTRSLHPRPNPDELDRQTLHPE
FT                   RAENTQSGTDDAVARHTSSYDPSTTTPETESEALEAECKLLGEVDPLFFSAAHREVSAL
FT                   LDPKLEVAVHTIEHLSPSAKGWTRKHKEVTIRKIPGAGSFDQFERLLKGLRDIQKRGGG
FT                   GPGSAVTT"
FT   CDS_pept        join(complement(505453..505870),complement(505316..505393),
FT                   complement(504841..505266),complement(504637..504786),
FT                   complement(504281..504589),complement(504135..504229),
FT                   complement(504008..504085),complement(503947..503961))
FT                   /codon_start=1
FT                   /gene_family="HOG000178775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750795"
FT                   /orf_name="AFUA_3G02060"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86487.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053382"
FT                   /db_xref="HOGENOM:HBG324136"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFJ0"
FT                   /transl_table=1
FT                   /translation="MDNELQKDPRNQEVEYLYLELDTPLPTPLITSPPGRDQSPAPECP
FT                   DLKKYSSPFLWPKWRKSMMTWISCAVTALAGYSAGEISPSSAELTKEWGISQVVYNLGI
FT                   TLFCIGFALAPMVLAPFSEINGRRPIFIASGILFVACIIACGGTHSFGGMLVARFFQGV
FT                   GGSAATFSTMVGGVISDIYHAEDRNTPMALFSGAALFGTGLAPMLAGAVVQHTTWRWVW
FT                   YSHAIVSAVFVIIIYFFFKETRGSVLLSRKAKALNTYYEKLESAGHYGVIMSDKETVKR
FT                   IRWKVKSDEERASLAQMISISCYRPFHLLVTEPTVFFFSLWVSFSWAVLYLQFGSVPLV
FT                   FATNHGFNVEQSGAVFTSMCVGVVIITVISIYQESFAQRFVTLPKSAERRLYFVCIQSL
FT                   LMPIGLFWFGWTSYPSIPWIVPTIAVGCATMGIFSVYLATFNYLADTYHRYASSAIAAQ
FT                   SCCRNLLGGVFPLVTNALFTNLGYPAASSLLGGIGALLCIVPWVLLLFGPKIRARSKFA
FT                   SELAH"
FT   CDS_pept        join(506718..506805,506859..506913,506972..509168)
FT                   /codon_start=1
FT                   /gene_family="HOG000172442" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263148"
FT                   /orf_name="AFUA_3G02070"
FT                   /product="C2H2 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86489.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055174"
FT                   /db_xref="HOGENOM:HBG329731"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051E498"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI8"
FT                   /transl_table=1
FT                   /translation="MVKAARTFQCQRCSRTFARLEHLQRHDRSHTKEKPYVCKKCPKSF
FT                   TRKDLLTRHERLSHSSPSGNHDTENGDHPTPAPSAPDHVLDGLNILASAVADRTVTAPT
FT                   RGPPRGPFQHPLSASQGTFSSGRPATADQTPLAGHPIQSAHSPGTAEATVFGETLSGYT
FT                   TSNAYDGDDFTSFLDSIPLPSHPYSPTYQPLPVFPAWNFDSTSDYDNSVVRTGTADAAV
FT                   TPSSSVLPRHGTQLPSLQPESPQTSHRARQPKGAIFVTTQCRDKIIAQLADYANVLPDP
FT                   YIPSRHALSRCLTGYLSGYHDHYPFMHIPTLDIEHVSLQLFLSMAALGARYCREPDTSL
FT                   SLYRIARTVTMEHIRRTYQFPGTGQFSEKFKLSTTESPESQDLLETVQALLLLHSVSSW
FT                   FKRNPSHHESLFMRSFMETMLREGGLNELPEQDGSWKSWIRRECVKRTSLIAFCYLNIL
FT                   TIVFDITPLILTEEISMDLPCSEKEWHAPNAVAWMQERSQTSPEPKLQDALSSLFTHPT
FT                   TPKTNMETFSSLGGYVLIHAILQDIWLLQKARRLPLPRNSSFSTAEALSLEQALEQWCQ
FT                   CWERNQESSIDPFNPHGPLSFTSTALLRLAYIRLNADFTSARRLQTWDPSQIAQSLRQN
FT                   LSVQRGDRLTRAALHCAHALSTPIKLGINYVAHTLVTTWSNQYALCSLECAVLLAKWLE
FT                   KVTVPNPDPALTEQETKLLEFVMEMVMETQHGANREWLLENNTRLSAIVTRLWGRLFTT
FT                   DHIWEVVNLIGQSLSRYADILDGVSG"
FT   CDS_pept        509571..511112
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263149"
FT                   /orf_name="AFUA_3G02080"
FT                   /product="MFS allantoate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86490.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520805"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI7"
FT                   /transl_table=1
FT                   /translation="MVATTAVDSPQSPRDDKAPAIRVKQDKLPTKGDAALQLLAGRDTE
FT                   NGVLDPDASRRLVRKIDLYVMPLICIVYFCQYLDKIAISYASVTGIRESAHLHGNQFNW
FT                   ISSIFFFGQLTFQFPTMRLIQAFPLARYVATNVTLWGIILACMAACKSFASLMVCRTLL
FT                   GCAEAAIVPAWVVFTSQWYRKEEQAFRVGLWFSMCGWAQMFGGYVAYGVAVHVGSDPHA
FT                   ALRGWQVIFLILGVFTTLVGVLFFFILPDSPVTAGFLSAEEKALHAERLRGNEQGIGST
FT                   VFKREQFYEALRDPKTWLYSFWVFAANIPNSIATSFGNILVTGMGYSATQSLLLVTPLG
FT                   AYEVVVLVGLTYLAMRTNQRLLWCIIGHIPSIVGAILMATTNKAPALVGYYLSGGIPIG
FT                   WTTILGLTSTNVAGSTKKITVSCIQTIAYTVGNIISPQTFQHKDAPRYLPAKISIVILY
FT                   VLITLDLCLIRWLSIRENKKRDAEREALGDAYVVEKDHEFLDQTDFENREFRYAI"
FT   CDS_pept        513250..515565
FT                   /codon_start=1
FT                   /gene_family="HOG000031216" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263150"
FT                   /gene_name="bxlB"
FT                   /orf_name="AFUA_3G02090"
FT                   /product="Probable exo-1,4-beta-xylosidase bxlB "
FT                   /EC_number="3.2.1.37"
FT                   /function="xylan 1,4-beta-xylosidase activity"
FT                   /biological_process="xylan catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86491.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0009044"
FT                   /db_xref="GO:0045493"
FT                   /db_xref="HOGENOM:HBG390192"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051EDE8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFI6"
FT                   /transl_table=1
FT                   /translation="MAHITSWHYGNAIALLVSLAPGALSLNTFPDCSSGPLSKLAVCDT
FT                   SLDVTTRAQSLVNAMTFEEKVNNTQYNSPGVPRLGLPAYNWWSEALHGVAGSPGVEFAD
FT                   SGPFSYATSFPQPILLGATFDDDLIKQVATVVSTEGRAFGNAGRSGLDFWTPNINPFRD
FT                   ARWGRGQETPGEDPLHVSRYVYHLVDGLQNGIGPANPKVVATCKHFAAYDLEDWNGVVR
FT                   HSFNAEVSTQDLSEFYLPPFKSCARDARVDAVMCSYNALNGVPACADSYLLQTILREHW
FT                   KWDEPGRWITSDCGAIDDIYNGHNFTTTPAEAAATALNAGTDLDCGTVFPKYLGQAADE
FT                   GLYSNQTLDRALVRLYSSLVKLGYFDPAEDQPYRSIGWTDVDTPAAEALAHKAAGEGIV
FT                   LLKNDKTLPLKAKGTLALIGPYANATKQMQGNYEGPAKYIRTLLWAATQAGYDVKYAAG
FT                   TAINTNSTAGFDAALSAAKQADVVVYAGGIDNTIEAEGRDRTTIAWPGNQVNLIDQLSK
FT                   IGKPLVVVQFGGGQVDDSSLLSNPRVNALLWAGYPSQEGGSAIFDILTGKTAPAGRLPV
FT                   TQYPADYVNQVPMTDMALRPGSNTPGRTYRWYDKAVLPFGFGLHYTTFKISWPRRALGP
FT                   YNTAALVSRSPKNVPIDRAAFDTFHIQVTNTGKTTSDYVALLFLKTTDAGPKPYPLKTL
FT                   VGYTRAKQIKPGEKRSVDIEVSLGSLARTAENGDLVLYPGRYTLEVDVGESQYPTASFT
FT                   VTGKETILDSFPQPPKTR"
FT   sig_peptide     513250..513324
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFI6 "
FT   mat_peptide     513325..515562
FT                   /product="Probable exo-1,4-beta-xylosidase bxlB "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WFI6 "
FT   CDS_pept        join(complement(518551..518881),complement(517781..518498),
FT                   complement(516063..517059))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207386"
FT                   /orf_name="AFUA_3G02100"
FT                   /product="Short-chain dehydrogenase/reductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86492.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053385"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniParc:UPI000051F2BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI5"
FT                   /transl_table=1
FT                   /translation="MLLPVTFQSFVRSVPLDLFAVGVVVDRLYIPFTMYFFSLVAAAGL
FT                   AHAYTVVVAEQFMLKNIDPIVLPGQYKSHMHSFFGSDAVTINTNTSAELQAGCSTNENP
FT                   NDLSVYWIPTLYLTEGGKHAPITPMRFSAYYVNIGDAEIPFPQDFKAVAGNAQGASQAD
FT                   VESVYGIQWMCEGVSNTDGGKDVAAFPTKTCPTHLQSILLFPDCVNPDTLDYAYSGTQN
FT                   WSGSFRPANRCPAGMKRIPQLRFSVRYDLRKLLPNGWSGTPPLELACGSSYCWHGDFIN
FT                   GWVPEAAQNMLKATDKREFMQIDGPLGGGKDGSKCGAKNAHDQDPNHGTSDYEESVNMM
FT                   SSKRSIGQRRIMTARYADVHKNPQGPGDARPTAMQIIHDEGLEGKLADSSILITGASSG
FT                   IGVETAKALFTTGATLYLTARNLPKAKHALGDMASSPRVHLLELDLESLASVRACAAQL
FT                   HSKTKTLNIFIANAGVMATPEGRTKDGFETQLGTNYLSHFLLFLLLRPALLAAATPQAN
FT                   SRVVLLSSIAHRYSEVEFDNLNLDGQYDRWKAYGQSKCALVWAANEIDRRYASRGLRAF
FT                   SVQPGGIMTGLVQHLSEEEQSGFTEDPTLGPQFKSPQQGAATSVWAAVSRSLDGMGGKY
FT                   LENVQIAEAYDASGGPWAPGYAPYAYSPEKERRLWDVSLKLVGVDE"
FT   CDS_pept        join(complement(523904..524089),complement(523564..523828),
FT                   complement(523324..523445))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207387"
FT                   /orf_name="AFUA_3G02110"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86493.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053386"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051EB78"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI4"
FT                   /transl_table=1
FT                   /translation="MAEARKSRTAIPRASTEEPDHDTITESGDRTRNTASSDVYPTGIQ
FT                   LALLLLAVFVTMFLVALDRLVISTAIPQITDEFGSVTDIGWYGSAYLLTNCAFQLLVGK
FT                   IYTFSSVKYTCLAAILLFEIGSAKLCRVHLRTGNRWPWVSGDHVRHACYYCLCYPTTQA
FT                   ANHVIYQSKCWTRSYPVADRPVLNEHT"
FT   CDS_pept        524792..525826
FT                   /codon_start=1
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902834"
FT                   /orf_name="AFUA_3G02120"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86494.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053387"
FT                   /db_xref="HOGENOM:HBG330345"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FC7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI3"
FT                   /transl_table=1
FT                   /translation="MSANLKKDLPWESSILGILYKQLFVHPKPLPTRPSLNGRTAVITG
FT                   SNGGIGFEAARQLFQLGLSRLIMGVRSQASGDAAAEKLRAEFRGADIQVWLLDMADYGD
FT                   IDAFARRCRDLDRIDYVILNAAMQSSIFKRHHTTGHELVFQVDYLSTALLCMLLASVLK
FT                   DQSRVGAVTKPPVLTVVGSDTMYLSKFQAAGPISPRMDDPTGYDRMRQYMDSKLLLMVF
FT                   VRQLARQVNPDDVVINVCNPGMVAGTGLGKNGKPNPSFAEKHVVPVFVKALGRKVESGA
FT                   SVYVHALLAEGQKSHGSFISDWTIKPYAGLMYTKEGQDLSEHLWNETMEELGFASKGIR
FT                   QLFS"
FT   CDS_pept        526516..527451
FT                   /codon_start=1
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263151"
FT                   /orf_name="AFUA_3G02130"
FT                   /product="Oxidoreductase, zinc-binding, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86495.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326323"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E6E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI2"
FT                   /transl_table=1
FT                   /translation="MSPILWLLPPTKFLSESKSIAVNPADPIFAELGRLARCLVRPHPI
FT                   PGMDFSGEVVATGSNVTSVNIGDRVFGRVETQKGQAGCMAEYTRAEIEGCVPIPPGIDW
FT                   GHAAGAGTAAITAYESLVLNSKPGDLVFINGGAGGVGTFAIQFAKAHGCRIIVSCSTAK
FT                   IGICKELGADEVIDYPKEDLVSVLKEKGKVIDLVVDYAYREEVNLCKASHDFLVDGATF
FT                   VMVPGGISSAILRVVSKNSLCPHMLGGGKAKFKAYFAKSNRTAFQQISEWMAAGKVRTV
FT                   IDSVFEFDDMPRAIERIKSGKTCGKIIVHV"
FT   CDS_pept        join(530129..530265,530314..530514,530579..530723,
FT                   530774..530832,530958..531063)
FT                   /codon_start=1
FT                   /gene_family="HOG000226782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207388"
FT                   /orf_name="AFUA_3G02140"
FT                   /product="Ion channel, putative"
FT                   /function="ion channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86496.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053388"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="UniParc:UPI000051EB79"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI1"
FT                   /transl_table=1
FT                   /translation="MPRLDDSTEALLRAGQSAQSTVKRAWDGFVNFAVRDNVLEVALGL
FT                   IIAQAFTKVVTSFVSDIILPIVALLPFLHRNMDEKFAVLRRGPHYVEEKGYNTLEQARN
FT                   DGALVLAYGAFLETVISFVGVSLTLYAIGHLYTWISHDQVIKQTVQCKYCRKYISEKAL
FT                   RCVNCTSWQDGREDAPQRRNEIATSANYSNGYEIICLYSTLWQIPPPTGLVV"
FT   tRNA            531049..531120
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        join(complement(532895..532926),complement(532610..532826),
FT                   complement(531635..532558),complement(531411..531587))
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263152"
FT                   /orf_name="AFUA_3G02150"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86497.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053389"
FT                   /db_xref="HOGENOM:HBG329790"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EDD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFI0"
FT                   /transl_table=1
FT                   /translation="MTDEKPSSEYTSRANLTILGSFTGLFCTVGFLNSFGAFEEYYAKN
FT                   QLANKSESTIAWLGALSIFFVFSVSVVSGPLLDAFGPRLLLYVGSFGTIFSIMMTSLCK
FT                   EFYQFILAQGILLGASLALLVCPMLALVGQYIKVKRGAAMGIVIAGSSLGGVIWPIVIN
FT                   ELLKKPTIRFEWTMRIVGFIMIPLLAISCLCCRPPKIPTATKRLQDKPDANEAVTPERE
FT                   PVSTPKTRFSILREPKMQVTCLAFFITYFGMFSPFFFTTSYAVAQGFSTDLSFYTISII
FT                   NGASLFGRIIPGILADRYGRFNICILATLLSGIIALCWTTATSVAGLVIWSAAYGFTSG
FT                   VRLGLALVPFIRNADTLQGHSLPSTSLCSPNCDTKHLGLINRCCHGIYIPFRNGRHPYQ
FT                   WRTGWQVRISVAFYLLRCQPLSRYFVACRSTSDAESGFASIRLRSRNMQQ"
FT   CDS_pept        join(534043..534096,534147..534271,534321..535072,
FT                   535083..535728,535782..536331)
FT                   /codon_start=1
FT                   /gene_family="HOG000201607" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263153"
FT                   /orf_name="AFUA_3G02160"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86498.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053390"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F042"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH9"
FT                   /transl_table=1
FT                   /translation="MESSDKGKELPRGRRTANACLRCQQKKKRCDGNIPQCTSCADHHL
FT                   TCTYQGVRRRGRGKTKAYLEKLEARVTELEASLRRAANVPAGPANNTMAWAEEQLAQAS
FT                   SATCENRTETTLSGAANFITTASHNERRHEPIYCEPEVRVPGPATISGGYERKRAALRE
FT                   KLFRMLPEQNVRKLNLEANRDPFTSSVFIQLPPKFQLQSMFEVAFTEANHVLPLFDVSV
FT                   LRDLVEQHYSDPTVPPGKQPGRWAMLNAAIAVAIQLRTARGSYSEMTELSWHFFKNSFS
FT                   MYSVIALRAADVFGYMYAGIERCANNIRSPARLSLAFGLHRREFYSVLDHAAADRHKRA
FT                   FWIAYILDKSISVKTGLPSVFEDDAINIDYPDLLLSASTIDGNVPGTSMSAFAFRLKAE
FT                   LATIEFSVEKRLYSESAGRQNVHQLLDLASELDHQLENWKAKLPSSLQPDRIVWSTMPT
FT                   VKEPIILLHFAYYRALSEIHGFAAHLNQEDDISVIRQIQSSRMIQASAASQIINILQYL
FT                   PCEQPGHLWHILCYPISACITLLAVVLENPTDAQAHSYARYIGHLVRFLTRVQQNKVLE
FT                   AQSLLDLCSEFERLALHAISKAAANGTVTSTSPSISAASGVQNYGQASCIDNQDEGEKT
FT                   SFLLTVAQKILSYTTSRTSSLQLAQGLMGNVPHLCAIAARTFSGLIPTLQLSPSTGLLS
FT                   PSSLNPETYGFTVM"
FT   CDS_pept        join(complement(540830..540972),complement(540648..540774),
FT                   complement(539990..540565))
FT                   /codon_start=1
FT                   /gene_family="HOG000048441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263154"
FT                   /orf_name="AFUA_3G02175"
FT                   /product="BTB/POZ domain protein"
FT                   /protein_id="EAL86499.2"
FT                   /db_xref="HOGENOM:HBG053391"
FT                   /db_xref="HOGENOM:HBG331578"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI0000F51C84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH8"
FT                   /transl_table=1
FT                   /translation="MAGKGKGKGKKKTKPKISEISAGSAIASTETAVAKDEVTAKMKEL
FT                   VLRHYLNPKYSDLTIICNGEIFPAHRNIVCPQSMYFENACDGRFKESNGEVILEDRDPI
FT                   LVRKMLEFLYTGDYTFEAPNAKGSFKSENTSGEVSHTDLDQDLQVSQGETSSAHPRTDQ
FT                   AFFHAQMYAQGAYFQIEGLKMKAKEYFRESFMKFTDRESYTSAVLEVYGSTEDHNRGLR
FT                   DLVVQMTTDNLLLLRANNNPILDGIFLEAVPNFMLEICLSALDRCAKHQREYRGWSYYN
FT                   "
FT   CDS_pept        541986..542612
FT                   /codon_start=1
FT                   /gene_family="HOG000200001" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902835"
FT                   /orf_name="AFUA_3G02180"
FT                   /product="AM-toxin synthetase"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86500.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG053392"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI000051F53E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH7"
FT                   /transl_table=1
FT                   /translation="MWIRTFLTASTRRGYWGVTRGGSNSPGSLYWWGPGCSNFCDSHVA
FT                   AQGLWRFPGRQGRFFKTGDLVQCKPDGGLVILGRKDTQVQIGGERVELAEVEYHVRRFL
FT                   PGRAGVAAEMITSIARVKPILVAFIAIGDEVNLPLGASLQPLTVGVNEKLAQYVPRTFI
FT                   PEVYIPVETIPLTAAGKTDRKALRKMGGPTTLDEISRLQESRLKN"
FT   CDS_pept        complement(542959..543858)
FT                   /codon_start=1
FT                   /gene_family="HOG000217512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263155"
FT                   /orf_name="AFUA_3G02190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86501.1"
FT                   /db_xref="HOGENOM:HBG053393"
FT                   /db_xref="HOGENOM:HBG485249"
FT                   /db_xref="InterPro:IPR008701"
FT                   /db_xref="UniParc:UPI000051F796"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH6"
FT                   /transl_table=1
FT                   /translation="MVSLNLPKLALFISLLGTCLAELLTPFPDTASELAIKFQPVLDFD
FT                   TDSCYQTAAIGKDYKLNSGIDPTLAPPRPPGPGPIVRAATDDEQVVFAANASDSDSDSD
FT                   SEIGIRSGGPFAPSGCRDKARLDHSQTYVRERCNRGWCAYLYGYYFEVDSGFSNAHKHD
FT                   WEHVIVWTLHDQVFFVSWSAHGDYTTHYYSTVRFEGSHPKIVYHLGSSGTHSLRKAEAK
FT                   DDKIENDTGRWFRAPLVSLEKMPCKFNRLLLNHNWGSAHSDLSRLGEKLDKWMPWDARN
FT                   NEKFNPWEPKVPLWAVRE"
FT   CDS_pept        544869..545447
FT                   /codon_start=1
FT                   /gene_family="HOG000217513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263156"
FT                   /orf_name="AFUA_3G02200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86502.1"
FT                   /db_xref="HOGENOM:HBG053395"
FT                   /db_xref="UniParc:UPI000051E700"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH5"
FT                   /transl_table=1
FT                   /translation="MATLKSRNIILLLTSLLSLLHLATSQRTPNENLVLADCGIGLGVN
FT                   GGSTSREMIYYPGDVWTGNGADTNKPTMMVNVPWSGSYPWGQNGGVSARMPNGDVFTVH
FT                   INPKIKDPIAAGDAWHMYEMNLPLKCYSYHKDKVYQLDDGKWCSSAYVCNHRGTPTPHV
FT                   KPSPAPNPGPVPVTPSPPSGGAICDVLNN"
FT   CDS_pept        546826..547923
FT                   /codon_start=1
FT                   /gene_family="HOG000048440" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263157"
FT                   /orf_name="AFUA_3G02210"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86503.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053396"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000520586"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH4"
FT                   /transl_table=1
FT                   /translation="MKLKSAANFSDTGAKRAPRQDPVSCESCRRKKLKCNRQRPCSSCV
FT                   TRRLSCSYGISLERIEPAIVEVENASHTNTAPSSQGVRGQPREAATMTVPSITDPRSSR
FT                   TTNESAKTADWLENILMSDRVPSVVSRHLQDEVGQSEAAHDPSRDNREPRLGEAVPDFF
FT                   QHRLASSENPMTVDLVSYLPEMSKTISLFRYYCQYIDYLYHVIIPLRVEDQINCIYHCI
FT                   DTASPVNSSHLALLFSILASSVYFQYSNGLSTFAERCSREFVFLTGAALIRSNYTACPT
FT                   LEGLQASLIVMHYLPNPSFHSSVCSLFLHGTIIGQAKSLMLHCIDSPRCREEREANGFD
FT                   AHELELKRRLWWDIATFDWQVFAIR"
FT   CDS_pept        548010..549029
FT                   /codon_start=1
FT                   /gene_family="HOG000178753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263158"
FT                   /orf_name="AFUA_3G02213"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86504.1"
FT                   /db_xref="HOGENOM:HBG053397"
FT                   /db_xref="UniParc:UPI0000520595"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH3"
FT                   /transl_table=1
FT                   /translation="MNVREPLNIDDEGIRGRAVATPSPMSEPTQMSFTLQRLNLAVVCR
FT                   EIVDMTAYEHMHGIDVSYDKILELDRKLHQAYNNLPEFYRLDTVSRRRFAALYRSRPTI
FT                   AWQRCLLQQAYHSRFCRLHRLYFIRGAREPAYSYSHVICLQSARKVLEIKRIMDEDEPK
FT                   FMPPTSTVWSVMHHVFMAAVILLMDVCFNWDDLLADKRKQEVLDACRMLSEAQRTSSLV
FT                   SQGIQAMMDVLQKHWKSGKHSSADGQPSNLPSSPALAPAAVAEPAQIVSNHDSANTNDK
FT                   KDDPSAETSFHFDQNEGQERPLEEIWTEMLDSGGDLNFATPDWTDLLTDLTNATLPCN"
FT   CDS_pept        549219..549821
FT                   /codon_start=1
FT                   /gene_family="HOG000178752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750796"
FT                   /orf_name="AFUA_3G02216"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86506.1"
FT                   /db_xref="HOGENOM:HBG052924"
FT                   /db_xref="HOGENOM:HBG659007"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051E6F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH1"
FT                   /transl_table=1
FT                   /translation="MPRDSNNLPTTKRYITTHSTEGESVFISHSQIPEYIPSKPISDDG
FT                   DIALLYATVSNPVSVDDEIDVQAYDEYLHTSPGLTTSLGTVLRTIDLHPGKTSPMHRTV
FT                   SVDYGVVLEGEVDLILDSGQSRTLRRGDVSIQRGTAHSYRNRSDTEWCRMLFVFLPMQK
FT                   LTIKGRDLDQEVYDEHYDHDTGSENESQGGNGNGKGS"
FT   CDS_pept        join(complement(550342..550422),complement(550145..550247),
FT                   complement(549972..550081))
FT                   /codon_start=1
FT                   /gene_family="HOG000164843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750797"
FT                   /orf_name="AFUA_3G02220"
FT                   /product="DUF427 domain protein"
FT                   /protein_id="EAL86507.1"
FT                   /db_xref="HOGENOM:HBG000470"
FT                   /db_xref="HOGENOM:HBG540835"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="UniParc:UPI00005200E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFH0"
FT                   /transl_table=1
FT                   /translation="MPRARATLDGTVLAESDNWETVEGNIYFPPSAINKALFTPTDLST
FT                   HCSWKGDASYYTVTVGDKTFPNVAWYYAQPYDKAKNIKDYVAFCQFTLRRHC"
FT   CDS_pept        join(complement(551261..551816),complement(550670..551193))
FT                   /codon_start=1
FT                   /gene_family="HOG000217715" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750798"
FT                   /orf_name="AFUA_3G02230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86508.1"
FT                   /db_xref="HOGENOM:HBG053399"
FT                   /db_xref="UniParc:UPI000051E922"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG9"
FT                   /transl_table=1
FT                   /translation="MEIDQVKPERHDIAPDGDLILLYKKHANRPVELRVSTTILKSQSI
FT                   YFEALSGRWLETLPVRPDGLREMAFERFDPDAMLIIMKAAHLKFQGIPDELNVKLLHKI
FT                   AKYVHMFDMFPAVCTLARPWIQYVRMFVDQCNSTELAGYLLGIMWVFNLKEQFKKATRS
FT                   IVVDCNAVDIDLSRTLIDQSMFDDLLAIRHKLMRDMSSLIESTLIAPLKQAEKNGKVIC
FT                   HEECDHHIRIHMQVLMEAPPNKETKPSRIVEGLRLLLDDRKFYHNSSRDPLEGFRKPHC
FT                   IGRLNDVISQLDRMLETVEGFDLADWRPEASQDVVWGDDVEPELRLDWPYDQKFNFDSD
FT                   YELSPRSSASPPPGKGRKE"
FT   CDS_pept        join(552715..552763,552816..553746,553793..554351)
FT                   /codon_start=1
FT                   /gene_family="HOG000121941" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263159"
FT                   /orf_name="AFUA_3G02240"
FT                   /product="Aromatic-L-amino-acid decarboxylase, putative "
FT                   /EC_number="4.1.1.28"
FT                   /function="aromatic-L-amino-acid decarboxylase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="EAL86509.1"
FT                   /db_xref="GO:0004058"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG283697"
FT                   /db_xref="HOGENOM:HBG708517"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniParc:UPI000051F7A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG8"
FT                   /transl_table=1
FT                   /translation="MDRDQFRAAAHAAIDEIIDYFDGLPSQRVVPTIEPGYLRPLIPEN
FT                   PPEEPEQWSQIQADIETKIKPGLTHWQSPNFMAFFPAGVTYPSILGEMYSAAFTAPAFN
FT                   WLCSPACTELETIVMDWMAKALGLPECFLSSSENKGGGVIQVSASDAVATVMIAARERR
FT                   VREQALAEGLKDGTVEYEDRVMELRPRLVALGSNQAHSSTAKGALLAGTRYRSVTARLE
FT                   DNMEMTGPRLREVLEQCDKDGLTPYYITLGMGTTNTCALDRFAEIKAVLKEKPHWQRIW
FT                   VHIDAAYAGAALVADEWQYIAKDFAEGVDSFNMNMHKWLLVNFDASCLYVRNRFDLTDA
FT                   LDITPAYLRNPYSETGRVIDYRNWSISLGRRFRALKIWFVMRSYGLSGMKAYIRKTIGL
FT                   GNIFADLVRSRSDLFEIITKPAFCLTVFRIKSPSLQSNAESSVPRIDDASNAITKEVYE
FT                   LVNSRGEIFITSSVIAGVYAIRVVSANPAAEEKYLRRAFEILVQTAEEVLQKQQ"
FT   CDS_pept        join(554698..554717,554779..555016,555067..555834)
FT                   /codon_start=1
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263160"
FT                   /orf_name="AFUA_3G02250"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase
FT                   family protein"
FT                   /EC_number="1.1.1.-"
FT                   /function="coenzyme binding"
FT                   /function="isomerase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86510.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F2C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG7"
FT                   /transl_table=1
FT                   /translation="MSMKLPSRVLVTGATGFIGAHVVDSLLDRGITVRGATRSLSKGEQ
FT                   MRAARPDHASRLEFVQIEDFSKLGGFDHVMEGVDAVIHVASPFTYNTTNNEQELILPAI
FT                   NGVKSILAASAKPGSTVKRVVLTSSFASVIDISKNPGPDFTYTGAHWNPITYEESVDPA
FT                   TSAVVAYRGSKKFAELEAWNFMDREGPPLDLVTLCPPMVFGPIVHPVASIAQLNESNAV
FT                   LWSVAAGADPLPAARVSAWIDVRDLAEAHVQALLTPEAGGKRYVPASGEPFCYEYAADI
FT                   IKEKFLWARETVTTNYEAGKRPGPTYKLDGATVTRELGVKYRSFEQTVEELVRQVKETL
FT                   A"
FT   CDS_pept        complement(555888..556343)
FT                   /codon_start=1
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263161"
FT                   /orf_name="AFUA_3G02253"
FT                   /product="YjgH family protein"
FT                   /protein_id="EBA27275.1"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000F51C9D"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y3"
FT                   /transl_table=1
FT                   /translation="MSSTVTTSPDGKKQFYATSSPYEDIIGYYRAVRHGNQIFVAGTTA
FT                   VDPQSPASAPRILFPGDAKQQTIVALTESVKAVKALGGAGASSIVRVKMFVARSEDCMA
FT                   VGEGFREVLGKQQGNGVGTVATMIVVQNGFVNRDMMVEVEVDAIADI"
FT   CDS_pept        join(complement(557392..557524),complement(556662..557341))
FT                   /codon_start=1
FT                   /gene_family="HOG000174015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750799"
FT                   /orf_name="AFUA_3G02257"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27276.1"
FT                   /db_xref="HOGENOM:HBG324137"
FT                   /db_xref="UniParc:UPI0000F51CB9"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y4"
FT                   /transl_table=1
FT                   /translation="MSSKLFPGDPSKVMVIRKVTPEITTFSVPFSRFGLFKIGGRGTLV
FT                   KLRTGSLAVISPVALTPEVQQIIASEGGKVQYIIAPDIEHHLHITTWKRAFPDAQILAP
FT                   EGLYEKRKTSRSYPDDPAFDHIFTKDGKHSLSISDEFHADFEVEYMDGHGNREIILCHK
FT                   PSRTLIEADLLFNLPCKEQYAQSEESPTAGLLNRAFISLLQATASPPTAHRRFAWYVLS
FT                   KQDRASFAESVRRIYNWDFDRVIPCHGDVIENRGKEVFRSVFEWFLER"
FT   CDS_pept        join(complement(558904..559051),complement(558439..558845),
FT                   complement(558024..558386))
FT                   /codon_start=1
FT                   /gene_family="HOG000178686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263162"
FT                   /orf_name="AFUA_3G02260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27277.1"
FT                   /db_xref="UniParc:UPI0000F51C50"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y5"
FT                   /transl_table=1
FT                   /translation="MLQSVFSLAFLVASCLTVDPAAVYTGGYSAGSVRLRIGNGGAGQS
FT                   GLIKALADAFIQSSVKNGSSPFKVAWYKSDTTESINYLKDDTIDVGITYTPAAEEIAIK
FT                   QGVAKSPAWYAWRDHFLLVGPPSNPAGLKKADDIKTMFSHIYAVASAGDAANVAIPVRF
FT                   LTRYDKSATNIKESQLWIEIGQVPWATKYSTWYHQYIAYPIQALTAAILLEEYTITDRG
FT                   TYLSIDQALAHKTTIYKAATDDPADPLLNPAHMLVGKKASNMKMADKFTQWVISAEGQA
FT                   VITGFKKNGKQLYTAAPANKTAPF"
FT   CDS_pept        join(563576..563860,563927..564152,564202..564617,
FT                   564703..564867,564924..565098,565158..566077)
FT                   /codon_start=1
FT                   /gene_family="HOG000087851" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16263163"
FT                   /gene_name="catB"
FT                   /gene_synonym="cat1"
FT                   /orf_name="AFUA_3G02270"
FT                   /product="Catalase B"
FT                   /EC_number="1.11.1.6"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="hydrogen peroxide catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86512.1"
FT                   /db_xref="EMBL:AAB48485.1"
FT                   /db_xref="EMBL:AAB71223.1"
FT                   /db_xref="EMBL:CAA69069.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0042744"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052085"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0000127088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92405"
FT                   /transl_table=1
FT                   /translation="MRLTFIPSLIGVANAVCPYMTGELNRRDEISDGDAAAATEEFLSQ
FT                   YYLNDNDAFMTSDVGGPIEDQNSLSAGERGPTLLEDFIFRQKIQRFDHERVPERAVHAR
FT                   GAGAHGVFTSYGDFSNITAASFLAKEGKQTPVFVRFSTVAGSRGSSDLARDVHGFATRF
FT                   YTDEGNFDIVGNNIPVFFIQDAILFPDLIHAVKPRGDNEIPQAATAHDSAWDFFSQQPS
FT                   TMHTLLWAMSGHGIPRSFRHVDGFGVHTFRFVTDDGASKLVKFHWKSLQGKASMVWEEA
FT                   QQTSGKNPDFMRQDLHDAIEAGRYPEWELGVQIMDEEDQLRFGFDLLDPTKIVPEEFVP
FT                   ITKLGKMQLNRNPRNYFAETEQVMFQPGHIVRGVDFTEDPLLQGRLFSYLDTQLNRHGG
FT                   PNFEQLPINQPRVPVHNNNRDGAGQMFIPLNPHAYSPKTSVNGSPKQANQTVGDGFFTA
FT                   PGRTTSGKLVRAVSSSFEDVWSQPRLFYNSLVPAEKQFVIDAIRFENANVKSPVVKNNV
FT                   IIQLNRIDNDLARRVARAIGVAEPEPDPTFYHNNKTADVGTFGTKLKKLDGLKVGVLGS
FT                   VQHPGSVEGASTLRDRLKDDGVDVVLVAERLADGVDQTYSTSDAIQFDAVVVAAGAESL
FT                   FAASSFTGGSANSASGASSLYPTGRPLQILIDGFRFGKTVGALGSGTAALRNAGIATSR
FT                   DGVYVAQSVTDDFANDLKEGLRTFKFLDRFPVDH"
FT   sig_peptide     563576..563620
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92405 "
FT   pro_peptide     563621..563656
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92405 "
FT   mat_peptide     join(563657..563860,563927..564152,564202..564617,
FT                   564703..564867,564924..565098,565158..566074)
FT                   /product="Catalase B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92405 "
FT   CDS_pept        join(567144..567155,567217..568956,569010..569297,
FT                   569354..570532)
FT                   /codon_start=1
FT                   /gene_family="HOG000178675" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263164"
FT                   /orf_name="AFUA_3G02280"
FT                   /product="Alpha,alpha-trehalose glucohydrolase TreA/Ath1 "
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86513.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG053402"
FT                   /db_xref="HOGENOM:HBG329740"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000051EB7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG4"
FT                   /transl_table=1
FT                   /translation="MLSQNLATWVSLLACLPAAIGLPNNNDRVARSLKRHGGHGHKQVD
FT                   TNSSHVYKTRFPGVTWDDDHWLLSTTTLDQGHYQSRGSIANGYLGINVASVGPFFELDV
FT                   PVSGDVINGWPLYSRRQTFATIAGFFDYQPTTNGSNFPWLNQYGGESVISGIPHWSGLI
FT                   LDLGDGNYLDATVDNKTITDFRSTYDFKSGVLSWSYTWTPKCNKGSFNITYRLFAHKLH
FT                   VNQAVVDMEITPSQGSEATVVNVIDGFSAVRTDFVESGQDNGALFSAVRPWGISNVTAY
FT                   VYTNLTASAGVDLTSRALVNDKPYVHSNESSIAQAVDVKFRANETVRITKFVGAASSDA
FT                   FPNPQQTAKQAVSAAMGAGYMGSLQSHVEEWASILLDGSVDSFVDPATGKLPDDDHILN
FT                   SQIIAVANTYYLLQNTVGKNAIKAVSGAPVNVDSISVGGLTSDSYAGLVFWDADVWMQP
FT                   GLVASHPEAAQRVTNYRTKLYPQALENINTAFTSSKNRTTFSPSAAIYPWTSGRFGNCT
FT                   GTGPCWDYQYHLNGDIGLSLMYQWIASGDTKTFREQHFPIYDSVATMYSNIVQRNGSSW
FT                   TLTNMTDPDEYANHIDAGGFTMPLISETLSYANSFRKQFGLEQNETWTEISENVLLIRE
FT                   DGVTLEYTTMNGTAVVKQADIVLVTYPLVYDNNYTAQHALNDLDYYANQQSPDGPAMTW
FT                   AIFAITANDVSPSGCSAYTYHQDSYDPYMRAPFYQLSEQMIDDAGINGGTHPAYPFLTG
FT                   HGGANQVVLMGYLGLRLLPDDAIHIDPNLPPQVSNLKYRTFYWRGWPISSSSNRTHTTI
FT                   SRAANLAPLDTADSRFANASIPVLVGDPSNSTAYRLPVTAPLVVPNRQIGFNNTIPGNM
FT                   VQCRPVYSPNDYAPGQFPIAAVDGATSTKWRPSTANMSSLTVALADVEINSKVSGFHFN
FT                   WWQAPPVNATVIFHDEMLEDPVAAMSSSHGNSRYRVVTTLTNIEQSQPYDAQSTDNNEV
FT                   VLNTGNTTDVSLSQTVHTSRYATLLISGNQAGGEEGATVAEWAILGESKGSSSGHGNNK
FT                   RRLDVRAAAALSALNDRRYRQFNA"
FT   CDS_pept        join(571556..571997,572059..573416)
FT                   /codon_start=1
FT                   /gene_family="HOG000135353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903081"
FT                   /orf_name="AFUA_3G02290"
FT                   /product="Arylsulfatase, putative "
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="EAL86514.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="HOGENOM:HBG005428"
FT                   /db_xref="HOGENOM:HBG651618"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000052080D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG3"
FT                   /transl_table=1
FT                   /translation="MTSRPNFLVIVADDLGFSDCGCFGSEISTPNIDALAYSRGGLRFT
FT                   SFHVAAACAPTRSMLMTGTDHHLTGLGQLPEYIALSRAHQGAPGHEGYLNERVVALPEL
FT                   LRDGGYYTLMSGKWHLGLKREYSPHARGFAKSYAMLSGAANHYGYEPLYDDAVTDVHPF
FT                   FQTTVTALHMEDAEYSTKLPEDFYSSQTYASKVIEFLSERPKSENGKPFFAYLPFTAPH
FT                   WPLQAPKSYVDKYRGMYNEGPAALRLKRLERLKELGLVAPDIVPHDVVTGPGDIDWEMM
FT                   SNEERAKSARAMEVYAAMVEVMDENIGRVLDYLRQSGEYDDTIICFMSDNGAEGASYEA
FT                   SPLGGSGITAHLEKYYDNSLENIGRPNSYVWYGSRWAQAATAPSRLYKMFSTEGGCRVP
FT                   LVVKPAGNPEALHEGGRVIDAFCTVMDIVPTILEYAGLQHPGTTYRGQKIERVRGVSWK
FT                   PFLDAITVASTDTSPAPSSIHGEEHVTGWEIAGSGALRKGRYKITYVPLPRGPQRWELF
FT                   DIVEDPGETRDLSKEKPEIFNELLRLWAIYAEEVGVVGLAGQISANNQVVEGVKDEFED
FT                   TGRWIRFIGKDNVPPEIQARLPK"
FT   CDS_pept        join(complement(574713..575293),complement(573838..574648))
FT                   /codon_start=1
FT                   /gene_family="HOG000178664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264155"
FT                   /orf_name="AFUA_3G02300"
FT                   /product="Proline oxidase Put1, putative "
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="EAL86515.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053403"
FT                   /db_xref="HOGENOM:HBG326213"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI000051FEB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG2"
FT                   /transl_table=1
FT                   /translation="MSLVPKRPGIVSLLAGKQLRCQVSTLNTTPPTHRPQDAIISQPSP
FT                   SSKKAPLSVLPTGALIRSLLFTSIMSSPLLNPCLAIMKYVVDSNSPLLNPSKNPLIDYL
FT                   LRKTIYNHFCAGTNEDEVRKTVQDMKSLGFKGVILGYARESIAKADENDNSSFHAEKSQ
FT                   LAIQDQAVEEWRQGNLRTLKMIGAGDFLGIKFTGAGPKAVAALSQGDLVPPPSIAQAID
FT                   EICEATASQNSRLWIDAEQQVFQPAIDAWTIDLMRRFNRNGQIVVYNTIQAYLKSSSEN
FT                   VHRHLCLAQKQGWTLGIKLVRGAYIAHDIRSRIHDTKADTDNSYDHIVESLLSRKFPLK
FT                   VAADNAAAFPDVRLFVASHNAESVRKASALYRQRINNGQPTIPLEIGQLQGMADEVSCE
FT                   LLAGNSTGQSEMPTPGVFKCLAWGTTEECLHFLLRRAIENKSALERTKDTAVAMRREAW
FT                   RRLWW"
FT   CDS_pept        complement(575688..576530)
FT                   /codon_start=1
FT                   /gene_family="HOG000230247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207643"
FT                   /orf_name="AFUA_3G02310"
FT                   /product="Pyrroline-5-carboxylate reductase "
FT                   /function="binding"
FT                   /function="pyrroline-5-carboxylate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="EAL86516.1"
FT                   /db_xref="GO:0004735"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG342910"
FT                   /db_xref="HOGENOM:HBG726602"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520577"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG1"
FT                   /transl_table=1
FT                   /translation="MGSAILSGLLDATRRTTDSNGSPSAKISRFIVSTKSAASAHRLGE
FT                   EFQADKDRVDIRHSDNLLAMQEADIVLLACKPYLAEEVLGELGVREALAGKLVISIMAG
FT                   KSPEDIEKYIYRDTPADDAESKAIIVRAMPNVAARLRQSMTIIEINNNLSHDIADTLTW
FT                   IFEQIGKVKFLAADLFDIGTMLVGSSIAVLTVPFDGILDGCVAEGLRRADALEMAAQNL
FT                   IGMAGLLREGVHPAILRESISSPRGCTIQGLLAVEKEGMRGACAQAMINGARHLKEIH"
FT   tRNA            complement(577117..577205)
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        join(complement(579333..579386),complement(579199..579272),
FT                   complement(578956..579136),complement(578205..578900))
FT                   /codon_start=1
FT                   /gene_family="HOG000178663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264156"
FT                   /orf_name="AFUA_3G02320"
FT                   /product="C2H2 finger domain protein (Kin17), putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL86517.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG377579"
FT                   /db_xref="HOGENOM:HBG717067"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="UniParc:UPI00005207EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFG0"
FT                   /transl_table=1
FT                   /translation="MPRAEAGSTKAISNRIKAKGLGRLRWYCQACQRQMRDENGFKCHV
FT                   QSESHVRQMLLIGEDPKKHIEEFSREFLNNFVNLLKTTHGEKKVHVNQFYQQVIADKEH
FT                   IHMNATKWKSLTQFAAYLGREGICRVEETEKGLFVSYIDRSPETMRRREAILKKERQDR
FT                   GDEEREQQQIQEQIERARRNAEKKDEIDPEARTLQRKEGEKVKLNIGFGSKTNGESKSG
FT                   ASRTQSPEEKDKEPSSAAPDTSAVESPAAPVEAASQPAAPKLSMSLNNNKPKNVFAAMT
FT                   KKNPLAGKKGPVLEQPKKMTEQERIMKEEMEAMERKRMRAGSGFPNAKRPKIS"
FT   CDS_pept        join(complement(582145..582174),complement(580624..582058),
FT                   complement(579969..580567))
FT                   /codon_start=1
FT                   /gene_family="HOG000178642" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264157"
FT                   /orf_name="AFUA_3G02330"
FT                   /product="Chromatin remodeling complex subunit (Arp9),
FT                   putative"
FT                   /protein_id="EAL86518.2"
FT                   /db_xref="HOGENOM:HBG053404"
FT                   /db_xref="HOGENOM:HBG324140"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0000F51C53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF9"
FT                   /transl_table=1
FT                   /translation="MPPFKDEHILIIAPGSQVTLAQLGLPESFTPARFRFPTRMFPGEK
FT                   KGEYEPYKIHEKRRDVKPSNGSDAPKEDVEMKDAETSAPEGAADTVTDETPQTTETGGQ
FT                   PENGEPHENNGEAVQETTQEVFYEEDVTSDEGAIYPIENGRIVDWPAFFALLTHVYNTL
FT                   SPPFHTPIMLIAEPVWSARDREAITQFVFEKFKTPAFCLMDSALAVCYGYGTSTATVVD
FT                   VGKGKVDVTAVTDFLVNEHGRGIALEGCGGDYMTERLLELLEPKGFTREMCEQLKRSNI
FT                   TEILPPGTPIPGTAETAQQGTNPAASASTGAQDGVGVNGSVPRGPGNNTQVGAEGNNAE
FT                   GEEDEGVLDVAAIVTGNTSEFLAKREKEKAEKASKKGAADQAAKPVRLPNSKKEKASFQ
FT                   FEEFVRLDSDQQTTDGSGRFIRQKRDIEVGIERFLAATPKEHVGERLSNGILEDIATQI
FT                   HHTILAVPDATKRSELWDSLIVVGNGSKVKGFTQALLGVITQKFILSPSGTIFTSEIPS
FT                   NFSTPLPTGGTNTPVPSGQPGLMHHPAGHGVNPLLVAATHSGNPTVGNMPPGTPSLDPN
FT                   AAFHHRSTGHSQTPTSVKTLKPPEYFPEWKEQSNTNAPGASGAGGLGIGNGAAGRPSGP
FT                   STGGHGMEEAVFLGAQVASKVVFVLDQGLSKGFMSRVEYNENGPSAIHEYMM"
FT   CDS_pept        join(complement(583599..583620),complement(583514..583540),
FT                   complement(583136..583395),complement(582962..583081))
FT                   /codon_start=1
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056355"
FT                   /orf_name="AFUA_3G02340"
FT                   /product="CBF/NF-Y family transcription factor, putative "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL86519.2"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EA81C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF8"
FT                   /transl_table=1
FT                   /translation="MSDREFSSNDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLME
FT                   CCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFGDYIPEVLAVAEEHKEQLKS
FT                   REKKQSKMEQSGLTEEELLRQQQELFRSATEKYNAAPE"
FT   CDS_pept        join(complement(585423..585462),complement(585070..585356),
FT                   complement(584606..584976),complement(584521..584557))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264158"
FT                   /orf_name="AFUA_3G02370"
FT                   /product="Short-chain dehydrogenase/reductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86520.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051EDD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF7"
FT                   /transl_table=1
FT                   /translation="MPSKTIIVTGASRGIGLAIAKYLLTAPQSHNVVVIARSVEPLQKL
FT                   KEQYNKQVEVLNGDLADFSLGQKAVDLAIKSFGRLDGLVLNHGILGQVGKIDKADPEQW
FT                   KLGFDIKAGLPALREAKGKIIFTSSGAAVSAYRGWALYGATKAAMNHLALSLGEEEPDV
FT                   TTISIRPGMVDTEMQRELREDHAANLEPQMHSKFTTAHKDGKLLKPEQPGHVMAKLVLD
FT                   APASLSGKFLSWNDEALKDFQA"
FT   CDS_pept        join(586089..586549,586602..587457)
FT                   /codon_start=1
FT                   /gene_family="HOG000178620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264159"
FT                   /orf_name="AFUA_3G02360"
FT                   /product="FAD dependent oxidoreductase superfamily "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86522.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053407"
FT                   /db_xref="HOGENOM:HBG324141"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000F51C9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF5"
FT                   /transl_table=1
FT                   /translation="MSTVILGGGIIGSSIAYYLSENGSSDEIHIVEASSQLFSAASGYA
FT                   AGFLAKDWFTPALASLGELSFNLHQSLADKNGGRQEWGYMKSTALSLDFSKNNNKRGAS
FT                   GDDWLSTGASRAEAATSSSSPVHVEVPAWLTKQKKGIIEKISDDDTVAQVDPLRLARFL
FT                   MESSLSRGVKLHNPAKATSVITDQVSGYITGVKVMNLDAQTECTLPCANIIICAGPWTP
FT                   QVYHELFPLSRLPIPITPLAGYSLVVRSPRHTLQDERVTYANRSHAVFTTHPDSCGFCP
FT                   EIFSRQGGEIYIAGLNDRHIPLPAQAGDSCKLMDQNEMRRLKKVAVHLMGAQEEGNVES
FT                   TDGIANRNDLEILREGLCFRPVSAHGVPFVARIDDHLLGGPKTGSINRCENGITRGGVF
FT                   VASGHGPWGISLSLGTGKVISQMVEGVEPDVDVGGLAIV"
FT   CDS_pept        join(587918..588218,588282..588610)
FT                   /codon_start=1
FT                   /gene_family="HOG000178619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264160"
FT                   /orf_name="AFUA_3G02380"
FT                   /product="U2 auxiliary factor small subunit, putative "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86523.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG243596"
FT                   /db_xref="HOGENOM:HBG525917"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051E93F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF4"
FT                   /transl_table=1
FT                   /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQT
FT                   ILMPNMYQNPAYDPKNKMNPSQLQNHFDAFYEDVWCEMCKYGELEELVVCDNNNDHLIG
FT                   NVYARFKYEEDAQAACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGGFCN
FT                   FIHRKDPSPELDRELRLSTKKWLKERGRDPRSASRSPSPEPTRRRY"
FT   CDS_pept        join(589013..589142,589199..589812,589869..590135)
FT                   /codon_start=1
FT                   /gene_family="HOG000178598" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264161"
FT                   /orf_name="AFUA_3G02390"
FT                   /product="DNA repair protein Nse1, putative "
FT                   /protein_id="EAL86524.1"
FT                   /db_xref="HOGENOM:HBG053408"
FT                   /db_xref="HOGENOM:HBG330250"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="UniParc:UPI000051F7C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF3"
FT                   /transl_table=1
FT                   /translation="MSNNSGANGYNDSNRAFLQAFMARSTMTFEEARSVLAAIFSVHEG
FT                   QPVSPDDVSQEDLDSYINAANAAISPFDLEIRSTLRQLQIDHHINETTQAERVYALVNT
FT                   TSDALMQLATTYSADEIAFIKRVLDAIFDTYNTRRCEAMVVSGIQAMQLAKASSDSSRR
FT                   ESQAATQQVQGGAAQSLTMSQAETVLKQLVEEGWLEKSRKGYYSLSPRGLMELRGWLIA
FT                   TYNENDEGRRVDKIKFCAACKDIITVGQRCGNRDCSGRLHDMCTHNFFRMRQAEQCPVC
FT                   KAPWPGDKFVGERAITNTEASMQGRRRSTNTERESGAGSSTQVASQVTNRDNESD"
FT   CDS_pept        join(complement(591720..591923),complement(590866..591669))
FT                   /codon_start=1
FT                   /gene_family="HOG000229966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903082"
FT                   /orf_name="AFUA_3G02400"
FT                   /product="UbiE/COQ5 methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL86525.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG275846"
FT                   /db_xref="HOGENOM:HBG730664"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051EDE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF2"
FT                   /transl_table=1
FT                   /translation="MQSTETIQAVQDYYGGLAERGSTGRSEDYQTNVAKAFGYDPEDLK
FT                   FLPENANLGVSCGNPLALASLREGETVIDLGSGGGIDVILAARKVGPKGKAIGVDMTKV
FT                   SIHVYRADYTLPASDLLPIYQKMLALAHENVEKAGITNASFVEGFITAIPLEDSTADCI
FT                   ISNCVVNLVPKEQKSLVFHEMFRLLKPGGRVAISDILARRELPPEIANDLALYVGCIAG
FT                   ASQAQQYHAYLKDAGFGGTSTNPLATDRKMLILCADIMIVDTKADLNIYKDMPQEKSAC
FT                   CGMSCSDLQSNDKIRDYDCNEWAGELVLDEASRRGPWLTQFLGSFQIYAVKPAL"
FT   CDS_pept        join(597476..597563,597608..597907,597976..598286)
FT                   /codon_start=1
FT                   /gene_family="HOG000063193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264162"
FT                   /orf_name="AFUA_3G02420"
FT                   /product="ThiJ/PfpI family transcriptional regulator,
FT                   putative"
FT                   /protein_id="EAL86527.1"
FT                   /db_xref="HOGENOM:HBG053410"
FT                   /db_xref="HOGENOM:HBG695952"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0000520106"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFF0"
FT                   /transl_table=1
FT                   /translation="MPAQHRILSLVYNDFEAPNLFDPLGAIIPHSPQGIETSIKNGIAV
FT                   IPTLSLAEALREDHQFDTLFIPGGFGMLPLIWDPILLQRIGKLVDRAANILTVCTGSIL
FT                   LAATGRLDGRKATTNKRLYDELTPKFPGVQWQKRARWVQDGKFLTSSGVTAGIDAGLVF
FT                   MASTYEAQKASAQGEEASIPGFSREKALHHAHFVAFGLEYRWDSLLKMSHKSALIPLNE
FT                   SSTWDNAVRY"
FT   CDS_pept        join(complement(601131..601482),complement(600948..601055),
FT                   complement(600715..600897),complement(600155..600595),
FT                   complement(599965..600088),complement(599550..599897),
FT                   complement(599400..599487))
FT                   /codon_start=1
FT                   /gene_family="HOG000217716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264163"
FT                   /orf_name="AFUA_3G02430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86528.2"
FT                   /db_xref="HOGENOM:HBG053411"
FT                   /db_xref="UniParc:UPI0000F51CC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE9"
FT                   /transl_table=1
FT                   /translation="MASSQDNFVSKTNPDPYDQIIVLSQKVINAGFKNMWKLAQGDDDS
FT                   PLTHFKKSIHGEYIEADVGIPSVKLHVESREPMLYFLLALKNGEMAVYESDDSDTLFKW
FT                   DIKDWVLAFNVVINQKKITKDSEEYRKFKERAGLPESNFSLAQLFIDASSSTKFNPDLT
FT                   SFGEHNLNELTPAAKASVLQFIDHWIKVMSESGSSILGYSAQREQVNGGDELDGSGANK
FT                   DDQDSNALAYLLMSDFKNPPAEGSIQYSGPWVDGDDRVASFCMNRALFWNWMLPIARQV
FT                   VVAMTPVPETPYVSYAGTPPDMPWRTRPRYHIGDTNASANDYKWVPNPSGGWSTSMPMK
FT                   FTWDKVTVPHNSNDWMIGEEWGDNTQATVSFGAGTERLTVKGGSKFRYQIDHHRDGMSG
FT                   TRQVFWVEVFTDWRLSIDMTSIEEGGIVFHPKENNNEDVKVAYKEYGDMKMESTAQDLA
FT                   ESIADDVKQNMTAALESVSETLSQAMANANRLCLPAAGTFFMKDPVFNEGGDLLVKLEY
FT                   DGADPPPPPSKGKYRFRPPMVTASVRRMDS"
FT   mobile_element  complement(603053..603679)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(604178..604642)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  607047..608435
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  608949..609560
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(612326..612733,612824..613142,613238..614389,
FT                   614479..615758,615829..616206)
FT                   /codon_start=1
FT                   /gene_family="HOG000217717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264164"
FT                   /orf_name="AFUA_3G02450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86530.1"
FT                   /db_xref="HOGENOM:HBG053413"
FT                   /db_xref="UniParc:UPI000051F070"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE7"
FT                   /transl_table=1
FT                   /translation="MLIIKKDSEVMTNYVAANPVPAGENFGVFHDKDWQPAVFALGEDG
FT                   ILSLIITVGREPTKINFTKASGLFSEDVKVQAFAVLQAPDSSLDICIATEASDTTSNFY
FT                   LLHHITLDEIPGTMPSAKVIQGVFPTVHHIFMGHKSGDSQQALPLVMVAFKRPDRLTST
FT                   EDLNYVKFVDKQATLVKSWSLPVNPKKIYNIALITCPLGDGVMVLYEGFTGGMFLVFKV
FT                   LDGGEDDDGDDFAVQVPCPKGATCLASFLDPAKKWTVVLVGGEVITALTYKEYRSPHGG
FT                   PGAVIDELRKISDLKDLHLSQTGENLRLWYTTAADAVYYYTTTTTDLSKGVVIPLLAKG
FT                   LGGRISSLLSSRPADGDRKLLVSSLLSVDEHGNLSLLQQDPISQAWQQYPFWHASVETV
FT                   TPVTGIMVRLHATVVNDGDGDSADLLPGCWLRVSCSGVVRCIINGRHTTLSPTADWHQT
FT                   DAKGVLNILLQTDDATIHKFAVDAYRPAQAPSKPMATAGERNLMDPVLDPSQKVIPKIE
FT                   GVQTPADVQNLKKPDGSPLFAKQLEPKDAKGAAAAFQQLVASAKDLNNKDKDRAQAYHA
FT                   TVFASENPSDSPDILVPFGFWSDVGDVFNGMWHWLGEVADTVWHWTCDLVDGVWKFIVH
FT                   VGEEIYEIALTTITSIVKGVMWVLKKIGAVIKDIIEFISYLFDWTDILATTDSVAAGFN
FT                   AALDYGEELLTGADLDVHKWLENIRTTIQQNLTDLQSNDYEQARVGTEKKASHQDAAAT
FT                   NDGGDNADQGDDDEIKAGVTYNWSTYCFLYGGGPTNAVLHDETSLVAADSTEDQLVKLW
FT                   DDVQSEVKIIMRTLTDVAKDLVEFFNPASFSVQDVVNKLESDLINGMIDALEKLADILF
FT                   DALKLGIGMIRDLATKEVDIPVITWLWKNVIARGRPLTLLNFCALLIAIPTTVLYKAKK
FT                   KCAPPKLHGRLTKSTFAQYVQGQADASLASDMLGFSRAAGSSVVLVGGEFDMLSLGVDG
FT                   AFEGLGLEIIPIGPIDSLMNVLDSASLTFETVGGFSTWPVGETPAAVSGVTTTALSTRD
FT                   AIKYAGWVVVGADLLAGAVVKIVGKKKKLERPVIKRWKGTVSAVMSVPTLCLSLTGNIM
FT                   DASQGSKKDVLIVDGFIETAASFGATWGKSVARWNDEFENELMYIGLAVYQFCTLLNYG
FT                   LKIVDFAVEELD"
FT   CDS_pept        join(619106..619124,619305..619548,619618..620195,
FT                   620276..620790)
FT                   /codon_start=1
FT                   /gene_family="HOG000182913" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264165"
FT                   /orf_name="AFUA_3G02460"
FT                   /product="Serine protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL86531.2"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG053414"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000F51CA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE6"
FT                   /transl_table=1
FT                   /translation="MMNKVHRQCMSVASMSASLPPTPPSRALTDNEWRFKTITLPCEWV
FT                   EDYRPGGYHPVVLGDVFNDGQFKVIRKLGEGSYSTVWLARDLKNCRYVALKIPVSEISG
FT                   VTAELRIIRHLTEIAPAEAARHVTRLLGEFEHRGPNGLHRCLVFEPMGPSVNTMVEELP
FT                   QFKPRRRGMKVRYPLRMAKSILKQSLQALAFLHEHGIAHGDFQPGNILFTLNDIDSTAE
FT                   DSLRQEEDVQARSISPPVQRLDNKQDRWAPPYLCVSQPLVPFTSYAEGLKVKLSDMGGA
FT                   FFFTDPPQKPVTPLGLRLPELILTGAVDNSIDVWCFGCLVFELITGQPLFCIPGSEYEN
FT                   DDHLLSLTARLGALPDELFRHWETSSLYFTPEKQLFNCQLGGVAPGEKPLMVEQLSMEA
FT                   LFDMTEPNLDEDEAQKVKTFIRWILQYDPVKRPSPARILSEPWFREIDVNSG"
FT   CDS_pept        complement(621685..623763)
FT                   /codon_start=1
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264166"
FT                   /orf_name="AFUA_3G02470"
FT                   /product="Amidase family protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL86532.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG007514"
FT                   /db_xref="HOGENOM:HBG298706"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI000051FEE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE5"
FT                   /transl_table=1
FT                   /translation="MPAPDTQERPKVLNLVDASIKELLEALRIGAVTSVQLVALYLHRI
FT                   GQYDCRGPSLNSVCVLNPNAFEEAQKSDDYRASGRPPRPLEGIPCTVKNSFMVKGMTVA
FT                   AGSPAFADLIATDDAAVVSLLREAGAVILGLTNMPAMADGGSQRGLYGRAESPYNLQYS
FT                   TTAFASGSSNGCGTATAASLAAFGLAGETVSSGRAPASNNALIGYSPSRGVIPNRGQWP
FT                   LYPTCDVIVPHTRSMEDLFAVLNVIVADDGDSSRGIDFWRNQQIVPIPKASEIRPKDYR
FT                   DLADPYALVGKRVAIPRCFLGDPSAKPFHVCTTAVKALWDSVQKTLESLGATVIATDFP
FT                   LLEKYTKKDFPGQSCNVPGLSHEWTRIERCLMIATAWDDFLQQNGDVRCTSLSKCDPGK
FT                   IHPLIAPMDDPSRFTEAQNQVRYSEMIESIRDRQYSLYDLPGIAEAVRALEDMRKRDLE
FT                   DWMDAHGIDLLAFPTNGDVSYANSDEVYESMLHALQDGVKYSNGGRALKHLGIPCITVP
FT                   MGTLSDTQMPVGMTLASRAWADNDLLRYAYAYEVASRNRTVPRLTPPLSSDSIPMVPLL
FT                   DRLCSTAKPFLNLDSATWKEPANSEHEVRREVSVKGTMQSSEPTVGIASLEVFVDGKLF
FT                   TSISLTGEKWEWNACLSRAKVVDRYPTIGRVPKDCFLVIFIATLQNGRNAARMLLVD"
FT   CDS_pept        join(complement(625144..626019),complement(624626..625084),
FT                   complement(624159..624560))
FT                   /codon_start=1
FT                   /gene_family="HOG000048439" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264167"
FT                   /orf_name="AFUA_3G02480"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86533.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053415"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F79D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE4"
FT                   /transl_table=1
FT                   /translation="MPRGPSGCWTCRVRHRKCGLETPSCKECTDRHVYCHGYGPKPTWM
FT                   DGGSEEQKERSRIKAAINQNFRHVKKRQNRARMSRSLSEQSRPLPGSRTNQANGSEGEI
FT                   VADESPISVATPPRPLHSSYCPNDLGNAALHHEEDSSDRAFELNENNEDHTLKDAAELT
FT                   TTPIPQSLGSNGLDPQEAYLLMYYLDRVFPWQFPYHDRRSRLGNKGWLFLLLMKRGPLY
FT                   HAALSLASLHQSAMIGTEEEFQRRQKALGHHSQALRELCDLMTEKGDKLRDDHAQLTEF
FT                   LTCSFMLISFEVFSGAENDWLMHLDAVASVMSLLSPEVIFSAHPYHHNAGMSALELSDH
FT                   RIGGSDGLEFLVVSVIWFDVFSCLSTGRAPRLPYQRWLQIPGLNTADLLGCYNWVVAVI
FT                   GDLARLGVWKDQQDKDGLLNIRELASRGQEIEMRLEKGIEGLDIAKGYTGSESLKDWVT
FT                   RLFALAALVLLHTTISGPLPALPEIRSAVARSIIALRGRPESYSLTGSVWALCVIGCMA
FT                   EPHIRPFFETLMTDLLRDDSGRCGNIPTVFKIMKSCWKMQETTRADCRSAMSDMGLHPI
FT                   LI"
FT   CDS_pept        join(complement(627755..627923),complement(627323..627718),
FT                   complement(627013..627311),complement(626518..626946))
FT                   /codon_start=1
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903083"
FT                   /orf_name="AFUA_3G02500"
FT                   /product="Protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL86534.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG053416"
FT                   /db_xref="HOGENOM:HBG332733"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F2C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE3"
FT                   /transl_table=1
FT                   /translation="MNISTLDDWWRRKNCSTTEQTGFILFTWARCLGIDTKQLRSLALV
FT                   RHLPLGSLETWTNLDRAHQYVALKVYVRTSLVHRELPSYHHIASRMKDSTHEGRGNVRR
FT                   LLDSFVVNGPDGDHVVLVFEPAQMSLRDMKVVFRPEGFDEDFVRGAIIELLKALDFLHT
FT                   HGEIVHTGICPVDQSPLELDPDCYYYIHPGNMLLGVFDNSIFQAIEEKEYTDPVPRKQV
FT                   SPTRIIYLSRLMRPKEGPMLLSDFGEARIGREPHGGDIMPLEYRAPETLLYVGWSYPVD
FT                   IWSVGLTAWDLLEPKRLFTARDDDGDLYDAAHLAQIIAALGPPPVEFLAKTPERRADFW
FT                   DDEGTLSTLSCGRIQLYSHGLRSLLTLFATGKWLGLAPIPEARTMEALECRLKDKAGFL
FT                   SFIRRALTWMPEERATAKELLQDPWLSGRSR"
FT   CDS_pept        join(complement(631799..632001),complement(631588..631721),
FT                   complement(631407..631530),complement(631136..631342),
FT                   complement(630751..631086),complement(629945..630689))
FT                   /codon_start=1
FT                   /gene_family="HOG000048438" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207644"
FT                   /orf_name="AFUA_3G02520"
FT                   /product="MFS multidrug transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86535.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG053417"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F7A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE2"
FT                   /transl_table=1
FT                   /translation="MENSMHPVQQEPTEKAMDSTQNTEKARDPESQTGKTTNEVSPGSE
FT                   ENQEASSGRPSMSGLRLNIVVFGLWISLFLAALDSTIISTALFDISNSLNETSKSAWVV
FT                   TSYLLTYNAFVLLIAKLSDLVGLKPLLLGSNLVFLVFSIASGVARTIDQLIVFRAFQGI
FT                   GASGLYCLVFVAILQLISLEKAGLYSGVISSVFALSNLLGPILGGVIVDNTTWRWIFYI
FT                   NIPFAAIATVLLGVAIPVSDDIRFNRQAFKRLDYVGSFLSICWLIPLLFALQEGGTYYA
FT                   WDSSEVIGTLVGGIVALIVFLAYEAWLQRRRDSAREPIFPIRFVRDPLQGLLLLNVLFT
FT                   GFAFYTSIINLPQRFQAVNEVSASRAGVLLLTMTLILPFFSLVAGALTAKAPQTAFTLL
FT                   TFGTVLVLTSTACFSVLPDDHAVADRQYGFEVLMGAGLGIISTTQYVILKMTFPARDMA
FT                   AGTGAMNMLRAMGGCIGLAICAAMLSSRLDDELAAVLPGRSPDQIQLAKNSLHGETNGF
FT                   SAEEIAGVRRVYGRGYNDGFQVMIAFAGANVVVAGLLFLATCRRGGIGRVVADAKAAEA
FT                   RRPAAG"
FT   CDS_pept        join(complement(633751..634289),complement(633166..633679),
FT                   complement(632986..633109),complement(632815..632927),
FT                   complement(632049..632744))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264168"
FT                   /orf_name="AFUA_3G02530"
FT                   /product="PKS-like enzyme, putative "
FT                   /EC_number="2.3.1.41"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL86536.1"
FT                   /db_xref="GO:0004315"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG053418"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI000051F071"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE1"
FT                   /transl_table=1
FT                   /translation="MTSSTAEAASVQAGAPSPIAVVGMGMRLPGGVRTVDDFWDALISQ
FT                   KDCSSEVPQTRYNIDAFYHPDKPQSVRTRRGYFLEDDCLQKADTNFLQWIPGFSTSELD
FT                   PQQRLLLEVIWECMENAGQTGWRGKDIGCYVGVFGEDWHELTAKESQMIPRTHAFANGG
FT                   FALSNRVSFEFDLKGPSLTIATACSSSLSALHEACQALQTGSCSSAIVAGTNMLLTPSM
FT                   SVTMSENMVLSPDGLCKTFDADANGYARGEAVNAVYIKTLDKAIADGDPIRAVIRATSA
FT                   NYDGRTAKIFAPDIDGQKRLIRKAYERAQIENIAETAFVECHGTGTRRGDIVEATAIAQ
FT                   TFHPHGVHIGSVKTNFGHGEGASGLTAVIKAVLALEHRTIPPNMHFRQPNPSIPFQEGR
FT                   LKVPVKPTPWPENRKERVSVNGFGVGGANAHVILECAPSIVPVEPKQEPRRGLVPRLLV
FT                   CSAHSKTALDARMDAIRSYLTLRPQALADVAYTLGVRRDHLSHRSFTIANSDGELFGGE
FT                   VHSHHISDTSPPLSLVFAFSGQGTQWARMGVELIRTFPSFQRDIQLMDQILQQLQSPPA
FT                   WSIEGMVVAYAHLLLYFHQNIWSQNDPCRGEVTYDIRSAGSRCLSLSNKGTEYMSVLAV
FT                   HSECQGPDTARADWLLPDNPGCCAKR"
FT   CDS_pept        join(635156..635485,635539..635727)
FT                   /codon_start=1
FT                   /gene_family="HOG000217728" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264169"
FT                   /orf_name="AFUA_3G02540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86537.1"
FT                   /db_xref="HOGENOM:HBG053419"
FT                   /db_xref="HOGENOM:HBG334060"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI000051E931"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFE0"
FT                   /transl_table=1
FT                   /translation="MLLKNLACYLAVGASCALAATNIAAAISDMDNLARAIGDTRVSLQ
FT                   SYQGGAFGAINTASAVNNAKLAARAARENLAASGAFTPDEAAQYYEAYMKMTPVLLDAL
FT                   TVAKDKAPLFNEAGVGQPARESVRDLHSEKKMFEEQASQQIPKETMDKAAPSIEQISKA
FT                   FDEAEAAFL"
FT   CDS_pept        join(639573..639612,639679..639878,640040..640182,
FT                   640299..640343,640397..640623,640795..641423,6
FT                   41567..642088)
FT                   /codon_start=1
FT                   /gene_family="HOG000217312" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264170"
FT                   /orf_name="AFUA_3G02550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86538.1"
FT                   /db_xref="HOGENOM:HBG053420"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniParc:UPI000051F2C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD9"
FT                   /transl_table=1
FT                   /translation="MAVQWSFGNCTNKSDRYFTKEQPDPPVQILKLYSEAFITLREGEL
FT                   PAQQTVRSNLSGFISEWQQKTCRKLPDTVRKDLYNMMTMITYMSAPDFKMHSHSRYSPV
FT                   LVREQVQLLNQVLIEIPMSVSTIDPEFLKGYRYNDEAVLPKNWIPEQEILGKNFIFYVM
FT                   VTGIADKAFRGIRTTDELLDKRPPKGRESWTLEWEAHVQTLPVLRMVTTDGPHPTPNAS
FT                   RAARTQALDHQNPDTFLKYQSKFKRVDVQASFWNLKPDYECLEMEESMAHHRDTNVPQR
FT                   LDAAAIAQIENDDEMKEIYHRIDEITQQIGGKPAEHKELAREREKLYTKAAKKRRAKKA
FT                   EFIDNWWRSSYDEYITGNEFGEQDPTCLFDIYRKYMPERARLRDNLFTKASIGSKIGRQ
FT                   CLQDMVNICVSKERVAYYPGEWPVDGRCPQLYTNGKRAHRRAKRSFLEWCYLCAKWSDT
FT                   EDAWTEHCRFHLDSLQPRCGLLRFRFTLVAPGFCPFCLGDHTKTPAERFQQWREKSTLI
FT                   NHIGNKHLAGRGKEETIQCPHPCCKNRFYNGTLLLQRHFFDAHSIEEPRRNCVSRKRKW
FT                   VCELEACNEPSPKRAALDEECDEAS"
FT   CDS_pept        join(645824..645959,646130..646419)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264171"
FT                   /orf_name="AFUA_3G02560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86539.1"
FT                   /db_xref="HOGENOM:HBG053421"
FT                   /db_xref="UniParc:UPI000051F54B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD8"
FT                   /transl_table=1
FT                   /translation="MEAFQLFERACKRSKKLVNVQAWDEALLLQLCQPDQVLFGPTEVD
FT                   GSLDEDLIKWILQPEPQELTSKRRKPKKLKTKVDIGKTPVPDLRPESATGELTELVAKH
FT                   SASSSSTLNGNDGMALKAAASKVEKGTRQRQMRTVRE"
FT   CDS_pept        join(complement(651614..653701),complement(647415..651512),
FT                   complement(646906..647316))
FT                   /codon_start=1
FT                   /gene_family="HOG000181369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264172"
FT                   /orf_name="AFUA_3G02570"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL86540.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG053422"
FT                   /db_xref="HOGENOM:HBG331271"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000052034D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD7"
FT                   /transl_table=1
FT                   /translation="MVAMPPLPMRVFIFGPHFLSFDMDQYLQLRSVLREHSKYSWILET
FT                   LRELPEWWAKASAALPILQDQGGSQLLTAWADDFNHSNPPSPAPDLGFPLPNIILTPIV
FT                   AISQLVQYQQYCEQQPHARTSASGGRFETVGFCSGTLAAIAVASSPSVSQLDRYGRVAI
FT                   RLAMLIGAMVDAVDNTSALGGAVSYSVSWNHPRLREHIDRTIHDHPSGYLSVFYDERRA
FT                   TLTLARRDAETVVRELEGIAGITLTAIGLKGRFHSNEYNADWMESIHRFCDSHPEFQFP
FT                   DASKMAWRVRFGVDSGNQPTSSSQYLHRAAIEEILLHRCYWYQLVQQLLTELADSPFTL
FT                   VVLGSDRCLPPSLMPYLRSLVEFAPAVGVSGVVDAHLQSSPRPLQDTDVAVIGMACKLP
FT                   GANDLGEFWKLLCKPRSQHREVPQERMDMAVFKWRDSPSSTEWKWYGNFIDDYDAFDHR
FT                   FFKKSPREAASMDPQQRLMLQTAYQAVAQAGHFVQDPSRRTRRVGCYIGVSNVDYENHV
FT                   ACHPANAYSATGTLKSFVAGKVSHFFGWTGPSLTIDTACSGAAVALHQACQGLLTGDCD
FT                   EALAGGVNILASPLWFQNLAGASFLSPTGACKPFDASADGYCRGEGCGAVYLKRAKAAL
FT                   ADGDPIIGIIPGTAVQQNENCTPITVPNSVSLTDLFRRVLDKSQLSPDQISVVEAHGTG
FT                   TAVGDPAEYTSIQQVLGGPKRPRHNPVNLGSVKGLVGHLECASGIVSVLKILLMLKART
FT                   IPPHVGLETINPELAANSESQIEIPLSLRPWQAPFRAALINNYGASGSNASLVVMDAAG
FT                   YYDQPRANDSSSLKRIPFYISALDDRALQAYCAKFLSYIASCRRSVSLDALAFNLSRQS
FT                   NRDLGCVLTLGCTSIEDLEKQLREVQAGRRAWRSRVPQRPVILCFGGQTSTFVGLNRDV
FT                   FISNPLLRMHLDECDRMCRSMALDGIYPEIFQKSPIEDVVKLQLALFALQYACAATWID
FT                   CGAPVAAVVGHSFGELTALCIAGVLSLEDTVRLIAGRAGLVRDSWGKDRGGMIAAEGDL
FT                   PVIKSLLECANHRCGFPEGAGASIACVNGPRSFTLAGPTKAMDAIEAIVSEPAEQPQLG
FT                   ALRMKRLNVSNAFHSTLVQPLTRDLELLGQSLSFYPARIRVERSTECASPPPSTGRYVA
FT                   DHMRNPVYFHQAVQRLAHEYPSAIWLEAGSNSTITNMASRALDNPASSHFQPVNLTNDS
FT                   SSVTFADVFIKLWDQGLSFVSFWPHHPSQGHRYEMLLLPPYQFELFRHLLPMTPREEQD
FT                   VQGKVGSASSTKPGSEQDLWSFVGSHNAQSRFQIHMDNSKIQEYVTGHTVAGSAPLCPS
FT                   TLQLELAIETISSLQPRLMQLQLQPQLRGLDNHNPLCMDPTRKVWLDAEAQDTDGYVWN
FT                   WKMTSESTRTGLSNDRTLHVSGQIVFVSTEDEQLQAQFSRFERLVDYKQCLALLHNDEA
FT                   DDAILGPRNIYKAFSEVVDYGEVYRGVHKVVGQANRSAGRVVKKYTGSTWLDGPLCDSF
FT                   CQVAGIFVNCMTDKAANEIRISNRIEQLIRRPQRAASSTPDEFHVLAVHSRPSDRVFLS
FT                   DVFVFNPENGDLLGVILGIRYQAVNRIALGKALLRLTPGMTHQATDQSALPLPQATATT
FT                   PMVHDAVPISLNQPCSQKKTAESQHQSVSDRLLMLLSNVTGVDATAIRPDTALADLGID
FT                   SLMCMELARDIGAAFQCELKPARLMELVSFSSLLDLLDGQNSSDEDGEPDRLSDDSQDI
FT                   NPLYRTAATTPDESDTEVQSALQSHHAAKMIAHRQSVIEEYVAQYTKDLTAPLPSLPLS
FT                   PASSSCTDQSTVLVTGATGSLGSHLVAHLLRIPTVSKVICLNRRSGMPAENRQQHAFHS
FT                   RNIPVDPASASKLYVYETDTSQHMLGLAADEYERLLSTVTHVVHNAWPMTIARPVQGFE
FT                   AQFRTWRNMIELVRNATIRQSTPRPISIQFISSIATVGMYPLHKGDTVVPETHMTVEST
FT                   LASGYGDAKLICEKMLENTLQRFPTQFRASVVRLGQVAGSSVTGYWNPVEHLAFLFKSA
FT                   KTLNILPNLPGELSWCPVNEAAAILTDLLLCPDPVPPVFHVENPVRQPWADMIAALARE
FT                   LDIRIGNIVPFEDWLNRMRNFVGDEAANPAKRVDDFLEEHFVRMACGGVVLDTQQTARL
FT                   SARFRALKAVDPGMVKLFVEYWRKTGFMN"
FT   CDS_pept        complement(653899..654900)
FT                   /codon_start=1
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056356"
FT                   /orf_name="AFUA_3G02580"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86541.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053129"
FT                   /db_xref="HOGENOM:HBG331316"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000052034E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD6"
FT                   /transl_table=1
FT                   /translation="MGFYYSQFFVRPAYPTQAFTGQTVVITGANTGLGLEAARHIVRLD
FT                   AAKVVLAVRNLDAGEEAKRDIERTTGRPGVCEVWLLDLASRDSVVAFADRASTQLGRLD
FT                   VLVANAAVATPTFALVDGHERTITVNVINTMLLAVLLLPKLGEAASGCSAFPTMAQRPG
FT                   RLVVVVSETHAWTPFPDWQTQNTFETLDDPATADMPNRYATSKLMLILLLRELAARVTR
FT                   ADPDTQRLVVNMVNPGLCHSRLARDLTWGFWLFKLLVARSTEVGSRTLVAGAAAGSGSH
FT                   GRYMTDGRVADDSLSSFVRSREGLKAQKKLWRELHGILEAVRPGAMDSLGEV"
FT   CDS_pept        complement(655118..655876)
FT                   /codon_start=1
FT                   /gene_family="HOG000088999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903084"
FT                   /orf_name="AFUA_3G02585"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86542.1"
FT                   /db_xref="HOGENOM:HBG053424"
FT                   /db_xref="UniParc:UPI000051E6F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD5"
FT                   /transl_table=1
FT                   /translation="MGLNNHTWAFTPKSSMSEVMVNRFAILCGPLAQLCFVIFLPAGLL
FT                   LPPISPSLSPEQTAEHYRKNLTGMKAGISIMLMTAVFWPIFCAGVNRQLSRIPHVNPTL
FT                   LWAQLAGGALGGVSMMLPAVFFAATTYRLDRDPVATQTLSDLSWFSFSMLFPPFIAQDL
FT                   ALSWAILSDKRAQPLFPRWLAYATTGLTLTFYPALGVHCVHHGAVAWNGALGFWLGAAG
FT                   FGLQVGLLVRFMLNAAGKPDLEHDDGVTTV"
FT   CDS_pept        join(complement(658647..658708),complement(658385..658528),
FT                   complement(657581..658322),complement(656191..657513))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264173"
FT                   /orf_name="AFUA_3G02590"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86543.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053425"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F79E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD4"
FT                   /transl_table=1
FT                   /translation="MGRAEESNQHERTQLADKLNHQAELSCVRCRARKIRCGREKEECA
FT                   NCQRDGVKCEYTTPAKRVNHVKLLCNSMAKIEERLGDIEDSLSALAARLTHDDHEKEYP
FT                   AESAIPSGFHQLQSDTSEESGGSVSDLLQHCIFRHHESQIDRYYGPGALPTLCREFQAT
FT                   VSAPPASSASSSASETLEQHMGRLIQDAGDQGACLRRSTGQVPLRLPAKQLFLLVQSQF
FT                   FQRCRWATSIFAAGLFRARVEKLYTQPLTIDDTPWVLSLHLITLLVLGLEQEEPPRQLD
FT                   AEIHISNIFDWGVSWSERTSLMVPRLIDVQTLALLSRYGQQFLPLPVAESIHTQACIRA
FT                   KAIGLHCVGPEGGMDAFSPEEAEERLHLYRHLRSQDIRFAILRGSTPWLLGHHWPSLGS
FT                   SVDLGQIQEQLHHITSTNVATTKRQQVLADLLRQLDQWALEYQIVASGPRDRRNPNVRS
FT                   LRQEILATRIAILVSLNTPDSLQKAIFDARIACAMLLRSFSAGAPVSCEQLAPPASHPI
FT                   LNLGGEDSCQALYSDPQVDEEDYLSPLLRQDALEMFSIRAFFVIAAALTEPTSASLQTD
FT                   LDLLRGVSLLYSSVGRRMPVGNHLLKLGRVFESVLEIIHERRRQDPPDQSEIHGDPHED
FT                   HAMRVTVSPSLDVIEGLPNGLEFQSPDPAYPTTLPSSSFNPDALSSMPVWFLGSMVEDE
FT                   TPFFEAAMLHNQPGHQPRPEQRPAAPGSPSHDLGPELAASSLPKTLHFELPADVGYGMS
FT                   MPE"
FT   CDS_pept        complement(661031..661873)
FT                   /codon_start=1
FT                   /gene_family="HOG000201529" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751039"
FT                   /orf_name="AFUA_3G02600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86544.1"
FT                   /db_xref="HOGENOM:HBG053426"
FT                   /db_xref="UniParc:UPI000051FC88"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD3"
FT                   /transl_table=1
FT                   /translation="MQFADFSSGVVYPNFTLPAADWSAYIAQLDKYPYLTYTWELPDPV
FT                   LEDLLLPFGEFVSKYSLGNEAYLLGTYGAGNGAVLNQTTVYVLKSVDKAYIKGLQGGDV
FT                   MTEHDNHAIYDKAQAALGSNALVSSTVVAASRNASGIRLVVQSASGDLKLIVAKKLLVA
FT                   MPQITANMQPLGMDLSESSVFGQFTYNALYVGLVTNTGVTDFVDTLGISLNTESYNLPG
FT                   LPGLVYLQSTGVAGVFRIWYSSAHEVAEADVKSATLAAIQRLTGKKAQFLVFSSHTPY"
FT   CDS_pept        662970..664268
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903085"
FT                   /orf_name="AFUA_3G02610"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86545.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053427"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E70B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD2"
FT                   /transl_table=1
FT                   /translation="MSISIPATVLQGAEWHISTSTINEPNSLAVVMISISSLVWIPLLN
FT                   CWGRAPVLFWSTVLGLFFTLGCILAPTFPVYYAMRALQALTQGTGSLIGLALIQDMFFF
FT                   HQYARKIGLWYAVFLISPFLGPMLGNFMVAGLGKWRPLFWLVFAWAAGLTAMILAVGDE
FT                   TYYQRDMLLGRQPRRSGSCLWQVVGGWQLRVHKDYFESVRSSYARMFLILLRPVVTVVS
FT                   LVYRLLFMWSISINQTSTILLGVSRETGGYGMSAQQIGYMYFSPVLSVCLGELVGHRLN
FT                   DFIVTWYAHRHQGRFMPETRLWATYLRGFFMVPGLVLVGITLQQHLHWVCILFGWAMFQ
FT                   GGVMVVSVSMVAYVLDSYPSVPGEVSGWINMSRAACGFAIGYFQQVWGLKEGYGLSFGL
FT                   QAVICLAAFGLMVCIHVFGQRLRLLSEPQQNNI"
FT   CDS_pept        join(complement(666260..666282),complement(665968..666184),
FT                   complement(665708..665940),complement(664695..665619))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264174"
FT                   /orf_name="AFUA_3G02620"
FT                   /product="Phenol hydroxylase, putative "
FT                   /EC_number="1.14.13.-"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86546.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053428"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI000051F7C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD1"
FT                   /transl_table=1
FT                   /translation="MMGLEVSRMNCFTLHLGNTEAILIDAIQLQGGPRIERGVVPVVME
FT                   LEEGIADDPDAYPLKIQLRHQKLEHLTAWRTNAHSERGGIDAAIHSGRDGERDTEPVLT
FT                   GEEGSLKTIRAKYVIGSDGAHSWVRCWLGFEMEGDSTNAVWGVVDAILDSDFPDFRRHC
FT                   IILSQHGTILSVPRENGMTRLYVQLPDSMKDICLTDAAQVVKIMAVARRSLFPYTLEYS
FT                   YCDWWTIYRVGRRVANHFTYKQRVFLGGDAVHTHTPKGGQGMNVSMQDAYNLGWKLGGV
FT                   LRGQLRPSVLATYESERRPVAQDLIKLDTSMGRVLAGETMSETPEVLQVYEQLRNYGSG
FT                   ANICYSPNILVASPQQSQQHLAAHLRLGMRFPSHPVVNLASAITMESQSLLPSNGSWRL
FT                   WVFAGNVVACPAQLKRVNSLGEKLCALTARLAALQMLSTPFLEILLLYKGRVEEMEVSD
FT                   FHPIFTR"
FT   CDS_pept        join(complement(667537..668051),complement(667105..667471))
FT                   /codon_start=1
FT                   /gene_family="HOG000175083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751040"
FT                   /orf_name="AFUA_3G02630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86547.1"
FT                   /db_xref="HOGENOM:HBG053429"
FT                   /db_xref="HOGENOM:HBG329045"
FT                   /db_xref="UniParc:UPI000051FA22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFD0"
FT                   /transl_table=1
FT                   /translation="MIVTPRFHLLKLGDQSWCPEWLREYSHLARIQMWKTRIPGTKGSP
FT                   ALQACDILLRYLPDIASYTMVDSCAGGGGPIPIFESTLNAWLAARHEQPVRFILTDPYP
FT                   SLSKWAALARQSANISYIAQPVNATQARRLAEPGKKECCLFNLCFHHFDNPAAAKVLRS
FT                   AIQSSDAFVIFEMTHRTASAFLNTTFIVLSPLLTTLLWFRGSPLHMFFTYIFPLVQLFF
FT                   VVDGYVSCIRGRTPEEVTALIRQQKDLDISDWDFSSGEDMVLPPFGKMYWYIGTRKEGM
FT                   SQRTSLGVDSHL"
FT   CDS_pept        join(668464..668884,668935..669413)
FT                   /codon_start=1
FT                   /gene_family="HOG000035269" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903086"
FT                   /orf_name="AFUA_3G02640"
FT                   /product="Nucleoside-diphosphate-sugar epimerase family
FT                   protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86548.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG451447"
FT                   /db_xref="HOGENOM:HBG647913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019901"
FT                   /db_xref="UniParc:UPI000051FA0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC9"
FT                   /transl_table=1
FT                   /translation="MAVLLTGGTGKTSIRVARFLQNGNVPYVLASRRGQSAAPPDMPAV
FT                   KFDWLDKDTWRIPFDYKFVNEQVISAIYLMEPQAPEPWKPLNEFIDYALEKHGVRRFVL
FT                   VAGSSAECGKPGMGMVWQHFLDRQVDYCVLRPSWFMVLMFAGWSENLTENGPRQLIRDQ
FT                   GKIYTACGQGKIPFISATDIAAVAYHALTDPVSHNCDHRVLGPELLTYDDIADKLSRVL
FT                   GRTIEHVKLSGEERYQGLVNAGVSEYYAGFLTKLEVAASTGFETRENDEVEKVTGRPPR
FT                   CFDLFAQENWSAWVPEDK"
FT   CDS_pept        join(671969..672103,672172..672441,672543..672904,
FT                   673066..673246)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264175"
FT                   /orf_name="AFUA_3G02650"
FT                   /product="MYB DNA binding domain protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL86549.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG053430"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI000051F53F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC8"
FT                   /transl_table=1
FT                   /translation="MEAALLYDWVTRLATPPSFRSLAKVESYLIKALYSSISLKGYFSS
FT                   HDGHQGDPKAIYALEVSGGSTNVYHQAVFSKTSGQHDDEWCKPDWDGWQGRGLEAALVA
FT                   QEAERYKRALFRLLADIQSGSEDQLCDILATQTKVSETGEGKSTPSRQPYQLNARPSPE
FT                   CSVIPATQSVNRLESYPLIAVVVPAPLWMREGVTRSTISAAVARCKKRLRSSRDADDPQ
FT                   DPELLIPGATQQRPRKNQNQWPSLFVIHWAAQTQPYTSDENALLVRLKEREGMLWAEIA
FT                   AYFPERSASSLQVHYSTKLRHKATPRAEKLRIRR"
FT   mobile_element  complement(679908..681449)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(694320..694628,694682..694949,695014..697229,
FT                   697278..697670)
FT                   /codon_start=1
FT                   /gene_family="HOG000205604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903087"
FT                   /orf_name="AFUA_3G02670"
FT                   /product="NRPS-like enzyme, putative "
FT                   /function="acyl carrier activity"
FT                   /function="catalytic activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="EAL86551.2"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG053432"
FT                   /db_xref="HOGENOM:HBG324144"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51C7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC6"
FT                   /transl_table=1
FT                   /translation="MEAVVDTTSETAKPPQRLLATVVDSLALECPTRRFCLIPNGKDVH
FT                   QGFREVTFRDLCCAVNRMSWWMEKHLASSVKGATIAYLGSNDIRYIILMLASHKTGCTI
FT                   FFPSTRLSNEAYDSVFGATQTKMLLFSPEKHPLVSGLTGPSKAISSLEVPSVPEMLNDN
FT                   PDVKNYPFTSTFEEFEDKTAFIIHSSGTTGMPKPVSLTHGYLGTVDYSAFMPRPAGRSP
FT                   SFFQDLLSADPHPRDPVLSVTPYFHIMGLVSFFVSIFHNIPFVTISDQPLSVSLLVDII
FT                   RATHPTATILPPSILEDMSLSQEALECLGTLKFVCYGGAPLAKQVGDKVSQYTQLRNAI
FT                   GSTEIGIIGSLVPEGKENWGYFEWNPAYGIDMQPVADDVYELVIPRLEDSRRMHGIFHT
FT                   FPSFKEYRSKDLYVRHPKIPKLWQYRGRLDDVIVLSNGEKLNPVTLEKVVEGHPFVRRA
FT                   LVFGQGRFQTGLLIEPAMDDRAGKIDERNFVDMIWPLVQTANQNVPRYGQVLKNMIRLA
FT                   SPAKPFKLTPKGTTQRHAVNADYAEEIDAMYATHEKQLGPKLPSTIDSESVHCYVHEVI
FT                   TSLTGRSDIRPSDDLFGLGLDSLQATQLSNILRSAVLSYNPALSTENITVQNIYTRPTT
FT                   DKLAGLLLGVLQEQKEQAAIAPTESRSERIAGLVSKYTADLPARYVNSPTQLPRLSTVI
FT                   LTGSTGSLGTYILSGLLNDPHVAKVYCFNRAADAATRQRQGFAEKGLDASLLEDPSKVE
FT                   FLHVSFGDKHFGLDDSMYSKLLDTVDLIVHNAWKVNFNHPVSSFEDPHIKGVREFVNFS
FT                   LEARYNTHLAFVSSVSTIAGWTPSSDESAVPELPMDTVDAVLKQGYGESKHVGERICLE
FT                   ASRTSGVPTSVLRVGQIAGPDSRLGLWNPHEWLPSVVKTSKSMGKVPDTLGSVLVDWIA
FT                   VDTLAKITIEILLSRRSSLSTQRHAVFHLTNPSQIPWASLIPAIQERYPMSVVSLAEWV
FT                   EELEHIRNPSPQDLAKRPALKLLSFYQALARNAGAPNAEISVENSKKASRTMASLGPVS
FT                   LAQMSNWLNQWDF"
FT   CDS_pept        join(698245..698298,698351..698893,698951..699088,
FT                   699141..699806)
FT                   /codon_start=1
FT                   /gene_family="HOG000178487" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056357"
FT                   /orf_name="AFUA_3G02680"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86552.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053433"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51C89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC5"
FT                   /transl_table=1
FT                   /translation="MTGARSSGCLLCVQRRVKCDERLPGCVRCEKYGKPCPGYVRNFKF
FT                   KAGKPSRARRAPRADATGSERSMSNRDDYKADGESMILSTPVSTLSSPTINVLQGLSLV
FT                   ADDLSQPYSSTSIHIVSKWFRSLPSLYGRNRTLDATVRCFTAHHTSKVLQDVQMARYSR
FT                   FAYIEALSRLRKSLDAPSERLSADIFCAVLLLCLYELFANNQSPDTWMKHAKAVSQLAE
FT                   IRGSNAYKDQFNNTLLKAARGLIVMHSVFSGERCFLASERWHAVMRQRINSFYSEELED
FT                   LLEEFIALFTLAPSLVHALYDIKASDMTSPATWKKASETLTRILEMQNRLLEWYSRFSR
FT                   IAPPACERLSATNDAVYPTVLYYSDLNIASIFNSYHAYMAIIHEALRTLGYPGEHGAMV
FT                   AFFRDQICKSVEYNGAGPLGPYRMGFPLRVDYEVADPKTKAWIENRLAQMSQYYAAVQP
FT                   NNFATQFD"
FT   CDS_pept        join(complement(700601..700805),complement(700407..700539),
FT                   complement(700039..700357))
FT                   /codon_start=1
FT                   /gene_family="HOG000217730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264176"
FT                   /orf_name="AFUA_3G02685"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27278.1"
FT                   /db_xref="UniParc:UPI0000F51C70"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y1"
FT                   /transl_table=1
FT                   /translation="MKANTMQSLSVGHTRIAIAEVTIFSFIQLVQFITRFMQEWQYWHH
FT                   RRKRNVRRCVLYSWFGMLGILAQLRIAGSAMAIAVSNPSKVVLTAEIILQSIGLSPLLL
FT                   EVSLVLLRSGQAGRSGPGNSKYPKHLRFLLTGFRFPVILSLVCAVVGETMNISACKRIG
FT                   SAVFVITFAFVIGLVLWIAIAYRTVLPRIGHHGVMLVLATLPFLVVRIAYFLLSE"
FT   CDS_pept        join(701773..701934,701980..702105)
FT                   /codon_start=1
FT                   /gene_family="HOG000217731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264177"
FT                   /orf_name="AFUA_3G02690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86553.1"
FT                   /db_xref="HOGENOM:HBG053434"
FT                   /db_xref="UniParc:UPI000051F7C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC4"
FT                   /transl_table=1
FT                   /translation="MATEDNPPQAGNEAGRYPLSRRIYCAWMIISCASTTMFRGDDPTA
FT                   VRTVRLRCNEVLDAEEANEAERYLEGEAKRRKANLQAMKEALLKSKSARG"
FT   CDS_pept        join(complement(703530..704476),complement(703185..703474),
FT                   complement(702506..703113))
FT                   /codon_start=1
FT                   /gene_family="HOG000217732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903088"
FT                   /orf_name="AFUA_3G02700"
FT                   /product="C6 transcription factor, putative "
FT                   /protein_id="EAL86554.1"
FT                   /db_xref="HOGENOM:HBG053435"
FT                   /db_xref="UniParc:UPI000051E941"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC3"
FT                   /transl_table=1
FT                   /translation="MERSKPKPASGQSCTYGQACTHCYKAKCRCVRAPNGDTCERCLRL
FT                   KKRCEPSESVRRRNAQNAQTAKVSDRRIARLEDKMESLLSAMNAVIGSTATSGSAVSVF
FT                   QSLHGNGISLSTSSSNAARVTPASTTSSLATDALQYSLSTPAPSPNQADERLNFFRSRM
FT                   LPSFPFIDLTPDITSCSLRQHRPVLLQAIHTVTTFSTQERLAQVEELKHLLFTSALLQV
FT                   QSNIDLLLGLLTYLAWSTDPFLGRADLVSRLMMLAISLIYDLRMFKLSSPDVELMMTIT
FT                   QGRADDNTQSHNNETHHDLLERQRAVLACFVLSSNIASHLGRQDALRWTPQMEEALRVL
FT                   AISEACPADRLFVSQVRLQLIKQRADDVRQQDEARTGTAPAMVSAPRLLYLKSLRRELH
FT                   ELISSFSPDLSQLDLLNAHAQYVELYINQLAYSVSQNSLPLNLTGQLGFERLQCLWQSV
FT                   ENIKSWLGHFYQIPCSDLVGQPFHFWSQMILTVTLLKYLSTLHDPEWDCQAVRGTVHLI
FT                   TTMDSMVQKLDLSSKVPEYQCDDHLLKFLSKLLTRCRRWAEARWHDEETWPGRSASSDT
FT                   TGHNHPIPELDQMVWMQSMDLGDDQWFENVLGMPSAFY"
FT   CDS_pept        704861..706090
FT                   /codon_start=1
FT                   /gene_family="HOG000294668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056358"
FT                   /orf_name="AFUA_3G02710"
FT                   /product="Zinc-binding oxidoreductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86555.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053436"
FT                   /db_xref="HOGENOM:HBG326376"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520587"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC2"
FT                   /transl_table=1
FT                   /translation="MSIKLRSSSAASIVLLVSSIPPMPLSIAMTPKNQAAWIPAKKARP
FT                   FKVGDAPYTPAGPGQVVVRNTAVAINPFDWVLQFIGPAIASYIKYPFIFGTDVAGEVVE
FT                   VGPDVERFRVGDRVFGSATAIAKKVNRPAEGGFQLYTVMRQHMLAPTPAHITDEQACVL
FT                   GLGLLTAAWGLFHPNYLGLDMPQVPAPTGVVGKSGLPRAVIITGGASSVGSNAVQLAVS
FT                   AGYQVLSTSSPKNFEYVKGLGATQVFDYRSRTLSKDLLAALRGHELVGALTIGRGAVEA
FT                   CTAVMKHHDVRLTRKRIAVAGAIIPAEKLTTFVGKGTYLMGMVGGMIKSNARRRRTGVE
FT                   AKFILLDGLVDPESIVARIYREFLPLALERHQFVPAPPTHVVGKGLNKIQDALELQRMG
FT                   VSGKKLVVTL"
FT   CDS_pept        join(complement(707870..708220),complement(706435..707817))
FT                   /codon_start=1
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264178"
FT                   /orf_name="AFUA_3G02720"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86556.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG032742"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520578"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFC1"
FT                   /transl_table=1
FT                   /translation="MSVLYILLEPVVKQYHTSSITRSQVLQAMAEKSVSSEDAEPKYEY
FT                   PSGLAVTLILTSVTLAYFLFFLDLAVLSTATPAITSEFDSLVDVGWYGGAYQLGSAAFQ
FT                   PLTGKIYSQFSIKWTFLAFFILFELGSALCGAAQSSSMFIVGRVIAGVGSAGVANGAVT
FT                   TISAVLPTKKQALFMGLNVGMGQLGLATGPIIGGAFTTKVSWRWCFYINLPLGVVVGGF
FT                   LLFNTIPEPKPKSPPLEILGTAIKSLDLPGFMLICPAVVMFLLGLQFGGNQHPWNSSVV
FT                   IGLLVGAAVTFGLFLVWEHRRGDKAMVPFAMVKHRVIWSTAMTMFFTLSSVLVADFYIA
FT                   IYFQAIRDDSPLMSGVHMLPITLGLVLFTVVSGALISILGYYLPFLLAGGAISAVGYGL
FT                   LSTLSPTTSVAKWIGYQILYGVASGCTTAAPYIAIQNLVSPAQIPQAMAIIIFWQNIGA
FT                   ATSLIAANAIFSNSLRHQLQERVAEIGLAPDAIVAAGVRSIRDLVSGSPLAAVLEAYAK
FT                   SIDRVMYLGLAVSLAVLVFAPGLGWKDIRKVKDLQVIGSESADGGDQELAETSRVVPAM
FT                   A"
FT   rRNA            710375..710490
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(711365..711562),complement(710948..711310))
FT                   /codon_start=1
FT                   /gene_family="HOG000199922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264179"
FT                   /orf_name="AFUA_3G02740"
FT                   /product="Calcium/calmodulin dependent protein kinase,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL86558.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG053438"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015742"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000051EB8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB9"
FT                   /transl_table=1
FT                   /translation="MVECQPSGKNTTVERVQIIDLENAAYLPKGRCIKGMLAGNDNWRS
FT                   PEAHFKGELNKPTDIFSFGVVCIHAMLGRVIFGPDEDFRKHQTQGALPALIRLQRQVSY
FT                   FGHSEGINALLKHIADDEISCQVLRMLWDGRSDEHIPYKPFCKWPEIVDPIFKDLIQQL
FT                   TNLDPTKRITACQALEHPWFRDY"
FT   CDS_pept        join(complement(715062..715223),complement(714971..714994),
FT                   complement(714780..714898),complement(713887..714727),
FT                   complement(713385..713825),complement(713016..713272),
FT                   complement(712440..712935))
FT                   /codon_start=1
FT                   /gene_family="HOG000216801" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751041"
FT                   /orf_name="AFUA_3G02750"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86559.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053439"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51C7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB8"
FT                   /transl_table=1
FT                   /translation="MDADQHTPSTDQLTVRQWEPPAIQSATGGEAADVSFSRAQEIEEQ
FT                   NSSTTEKLACHRCRQRKVKCDRERPCSHCVKAKARCSYATGPKPREKRQRVMVSHTYDS
FT                   KLDAISRKIDELSQRISQMTHGPMRRAASESLDSAQNPIDINQQEPSSSSSFGPTPFCS
FT                   LVGATPDQTSLSDHPTSEDVREAQDHSSKAEYEGESSLFAHAVFAIRFLQNAINNATNA
FT                   EVAHEMEAVLDSLQAAVHSGKQRSDPLHKLYPLAKAIPPSSTTRNLPLPPVEKVFMCLR
FT                   MVRECPQVATLWLGGFIQPAQFNDYFFKVASPGPATEADLIIVHYGLHRLFCECSKVVD
FT                   GETRQDYDAQAVICEANLETVLANLRFHQPTNMDFAYAMAMASIYCLEKNKPSAAWNSI
FT                   NSASHMIQAPGLQHNVPAGTEQPGVKAQNRSLFWTIYITEKMLSLRLGRSSTFRDQDIT
FT                   LARPGRQRGPGGSFLAELAPGWIKIASIQGRIYDDIYSPGALMQPLHIRTSRARALAAE
FT                   LKAAMQHTQDFHNHYEASNGQVLGQEFHEIARRSDRVVGLSLLTLIYRSIAPEKPSTSA
FT                   FCQECIDAARETLQEHDQCVAVINKAQGKTVFLEAYINWTMTQSLFVPYIILFCHTIEI
FT                   SKATDLAHMKSLVEALESTSSVGAQRTCDKQRRLFKALYDVAATYVEVKSRADGGQAGI
FT                   SWSMAAEQPYACEPFTNTTSTGVGLGTFMGDPGTTTSTSGVSPGHTALSHIALEDMDME
FT                   ISRRSAAVGLVQQKPIDHEDAGRYIT"
FT   CDS_pept        join(715591..715722,715762..715985,716039..716695,
FT                   716780..717059,717118..717246,717342..718092,
FT                   718168..718337,718408..718937,719032..719178,
FT                   719254..719395,719504..720196)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903089"
FT                   /orf_name="AFUA_3G02760"
FT                   /product="ABC multidrug transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86560.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000051F04A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB7"
FT                   /transl_table=1
FT                   /translation="MTFPLDHRENEKAAGITNDAYIPIKSNIGEDEYVEKKKGLNVFLW
FT                   LMSRDDLSQRVFTFGDTKLYLLECIAFIAAIASGTALAMVNLVMGQFLTLLSDFSFSDM
FT                   DSTPTNFMSAVRTSALYFIYIGVIRLLATYLYAALFTYVAYHLTRNIRRNYLRAAFSQE
FT                   ISYYDQGTSGSISQQATTNGNLIQSGIAEKLGIVIQAVSTFVATLVIAFVTQWKLTLIL
FT                   IFMVPTLLIVLGTAGGIDAMIETKILQIHAQAGSYAESVLGGVRTVQAFSLRPRVIAKF
FT                   DSYLQEAYSQGMRKNKLYGIVFGGQYFVVHAGMGLAFWQGIAMLDRGEIADLGTVFVVL
FT                   FSIIMAATTVMQIAPHMVAFSRAATAASELFALIDRHSEINPFDDSGAKPENPTGSIEL
FT                   HGVNFRYPSRPDVAVLEDFTLHIPAGKVTALVGPSGSGKSTIIGLLERWYSPCSGSISL
FT                   DGKDISHLNLKWLRTNEPVLFNASVFDNIANGLVGTPWETASHDDQMKLVQEAAKLAFA
FT                   HDFIENLPQGYHTRIGERGGLLSGGQRQRIAIARSVISGPKILLLDEATSALDPHAEAT
FT                   VQKALDHAMQNRTTIVVAHKLATIRKADNIVVMSQGKIMEQGTHEELARKNGIYASLVK
FT                   AQDIAPANLEQDHGSEGMSTSDEGPEMGDNQSVTRVRTAETQKPAALRDREDHSLYKKM
FT                   GIIHNIWNLLRGMPELWIWFAVTMATCIGGAAVNPGQALLLGNILSVFTSPNMVARGNF
FT                   IALMFFVMSLGILVIYFIMGWSTNTIAQTLSRKLRREILDAFLRQDLRFFDRPENTVGA
FT                   LTSRLDSYPQAILELMGLTVAIILMSAINIVASSVLAIAVSWKLGVIGVFVGLPPIMLG
FT                   GYARVRLETKMDDEIGQRLSVSASIASETVMAIRTVASLALENTVLKNYTDELDRAIIQ
FT                   ASGPMFHMMIWFSLTQSVEYFVLALGFWWGSKLINDGEITLYQFVVSFMGVYFSGQATA
FT                   LAFSFASSESEKPVDVPPLGGTICEMDSNRTKGPKDGCRSYDLQDVQFAYPLAPENQVL
FT                   KGVSLSIQRGDFVGFVGASGCGKSTMISLLERFYDPTDGTITIDSSAPLSFLNPLLYRR
FT                   HVALVQQEPTLFPGTIRENISQGMPGLSATEAASDDALEEACRAANAWDFVSSLPEGLD
FT                   TQCGTASGSQLLSGGQRQRIAIARALVRNPRVLLLDEATSALDTESEKLVQAALAEAAS
FT                   SGARITIAVAHRLSTVRDANCIFVFDAGSIVEAGSHDELLAKGGLYARMCEAQALDGSG
FT                   "
FT   CDS_pept        join(complement(726529..727207),complement(725483..726432))
FT                   /codon_start=1
FT                   /gene_family="HOG000161934" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903090"
FT                   /orf_name="AFUA_3G02770"
FT                   /product="FAD binding domain protein "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86561.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG053440"
FT                   /db_xref="HOGENOM:HBG329669"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000052034F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB6"
FT                   /transl_table=1
FT                   /translation="MLRLPAFLGVICAFALGQTSKASSSAFEPDNFDVNAALYNLGVDV
FT                   STIPALTALQPQSTKSACRAAVSTSICKSRTYIRRTDVSQCGALGFLYGPSRAFAQNTT
FT                   AYSNATGSYWSAQQEEVRPDCIFQPSVNTDVSMIVLLARYTGCPFAIKSGGHAAFARAS
FT                   SIQGGITVLLKDLNTITLNDNRSVVSVGPGNVWVQVYSALEPYGLAAIGGRVSTIGVGG
FT                   LTTGEAHREEVVTASGAIVTASIDSYPDLYWALRGGGNNFGIVTKFNLYTIPSSEMRGG
FT                   TRVFAEDQFSNVISAFVSVVNGASDDGNAQHWVAFVHTQGQNVAAAEITYVKNVSEPVI
FT                   FAPYRAIPAVQDTTAARTLVEYCDAVQELNPDGLREMYWTLTLHLDEDFANWVTGYFYS
FT                   VLPQVLSIQGINPALVNQGITIPMLKNMTRNGGNALGLDASQGPFHLLMMSIWWENADD
FT                   DDKVLAWAKDFWETVTAKAKKDGVFHDYVYMNYASQYQDVIAGYGAANKAKLQSIAARY
FT                   DPKGVYQTLQPGYFKLAGAPASDSL"
FT   CDS_pept        join(729286..729299,729333..729434,729480..729533,
FT                   729587..730048,730099..731023)
FT                   /codon_start=1
FT                   /gene_family="HOG000178476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264180"
FT                   /orf_name="AFUA_3G02780"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86562.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG052442"
FT                   /db_xref="HOGENOM:HBG328126"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E942"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB5"
FT                   /transl_table=1
FT                   /translation="MLLMLIKGYFGTGDISGEIQDRTDIEIHTWDGPDDPENPFNWSTK
FT                   YKWLLTLTVCFISILTGLPAGTYGSGNNWMESEWHVQNSPFPNLYWATTSWNMGAAFWP
FT                   LIFVPLTESSGRMPGYFVSYIILVATLFGSAFAHNFATIVVTRFFGGGASSVSINIVGG
FT                   SISDVWQGGKARSLPMSLFGFTSVIGIALGPFIGSAIVQIKKDDPWRWIFYVQIIYNAA
FT                   LIPIFWLILRETRSDVILKRRARKIRKETGRHVYTASELNAPSTMRLLQISFSRPARML
FT                   VSEPVVQFFTLWISFAWGILYLFFSSVVQTYSTNYGWGVLATGLVQLAISVGAVIATAI
FT                   NPFQDWLYLRSAKRNPERPGRPIPEARLYTSIPGSLLFTAGLFWYGWASQPDVHWIVPT
FT                   IGITAAGIGIYAIYMGVVNYLTDAYEKYAASALSAASLGRNSFGAFLPLASPQLFSNLG
FT                   FGWAGSLLGFIGAALSLVPVVLVLKGPQIRRSSPFMRESTWDPEETSEKDDNGIEKATD
FT                   V"
FT   CDS_pept        join(complement(734242..734410),complement(733837..734190),
FT                   complement(733662..733768),complement(733392..733409))
FT                   /codon_start=1
FT                   /gene_family="HOG000217735" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751042"
FT                   /orf_name="AFUA_3G02785"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27279.1"
FT                   /db_xref="UniParc:UPI0000F51C59"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y2"
FT                   /transl_table=1
FT                   /translation="MQPIHSRLEPDSSEDHESEVLDDFLDATVISPSSWWSTKSTWRIG
FT                   RDDRLEMPCSLERLLDDYNLALIAESPNSQLIRPRLDAILIQILSVVKETRQKSVNGKF
FT                   GMSAILDAVSWGSRRRLCIAHDFQGCSYTVSCSVDYTLWYGNQQDLETNFIVVRSDVLM
FT                   EDECWMPLAAMSIIHYARKKAGRNAEIYGVCTDSYKWTFLHLNNKSQEIDND"
FT   CDS_pept        join(complement(736306..737024),complement(736196..736250),
FT                   complement(735384..736148))
FT                   /codon_start=1
FT                   /gene_family="HOG000216778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264181"
FT                   /orf_name="AFUA_3G02790"
FT                   /product="Amidohydrolase family protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="EAL86563.2"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG053442"
FT                   /db_xref="HOGENOM:HBG324149"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI0000F51C88"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB4"
FT                   /transl_table=1
FT                   /translation="MGRPSGLLLSISALLAAVLSPAAAAKNGSTLFKGGTIIAFNEKKQ
FT                   DLDIIRGGSLLISDGIISAITEGAYDKPLPPGTEIVDATGDILTPGFIDTHRHGWQTAY
FT                   RTIGSNTTLAEYFNRYGEFAADGIWSADDVYVSQLTGLYEALNAGVTTTLDHAHHTWSK
FT                   ATTDAGVQASIDSGARVFWCFGFHNVSNFPFEQQLAKFQELADSRRFSGQASSLGIAYD
FT                   AFNPGSAQQTESIIQLAMDYNVSVVTTHSLPKAYGVSLTMCAVINSPEDLHALGFLNSS
FT                   VPIVFSHASFLTPTGARLLRETNQYISITAESEMHYGHDHPYNHMIQDQASLGVDTHFT
FT                   FSTDILTQARIWLQYVRLTLYRWLAQNYEVATKNPMSVDQAFLLATRSGGLALHRPDLG
FT                   VLSVGAAADVVVWDGSSPGMLGWHDPVAAVMLHAGVGDVKHVMVDGKMKKRDGKLLVPK
FT                   YQDLQRKFVDVAKRIQSTWLAMPPTVLEGDFAMSGYPLAVPPLADVVRGDESGY"
FT   tRNA            complement(741375..741446)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        join(complement(742899..742971),complement(742040..742890))
FT                   /codon_start=1
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751043"
FT                   /orf_name="AFUA_3G02800"
FT                   /product="Lipase/esterase, putative "
FT                   /protein_id="EAL86564.2"
FT                   /db_xref="HOGENOM:HBG413490"
FT                   /db_xref="HOGENOM:HBG757640"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0000F51C6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB3"
FT                   /transl_table=1
FT                   /translation="MAPKPKLSFDRELDSLLPDYNDLIQLPEVNDILPPGVTHEEHTFL
FT                   GPDKNPLILSIFRKESPPDSFPQKRPAIYHIHGGGMIMGNRFCTLSGPLEFVREHDAIC
FT                   TTIEYRLAPKHPYPAPIEGCYAGLVWVHEHAEELGIDSTRIVINGLSAGGGLAAGVALL
FT                   CRDRKGPPLIGQSLFSPMIDDCNDSVSAHEFTGTGIWDRNANMAGWNAYLGDRRGSYNV
FT                   NVYAAPIRAKNLTGLPPAYIDVGSTETFRDEDVQYAQNMWRDGTQCELHVWPGAYHGFE
FT                   GLCPRAQLSIMARKARLDWLRRSLFC"
FT   CDS_pept        complement(746040..747926)
FT                   /codon_start=1
FT                   /gene_family="HOG000178421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264182"
FT                   /orf_name="AFUA_3G02830"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL86567.1"
FT                   /db_xref="HOGENOM:HBG053445"
FT                   /db_xref="HOGENOM:HBG331178"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F79F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFB0"
FT                   /transl_table=1
FT                   /translation="MTEEKAVPGKLEVALFLAASKGYDTIVKLLLSTPGVRLDFKDEDG
FT                   RNAVSLAAEGGHESVLQILLETGQVDVNAVDTKTGQSPLCWAVKNGHAGVVSKLLAVEN
FT                   IDPNIPDANGETPLYAAVKSENGGIIDQLLARADLNANTPDAAGQTPLYWAVKNGNEAV
FT                   AGALLGRAEVDPNAAGADGQTPLYLAVRNGHEGIMNRLLARGETNPDIPDANGQTPLYW
FT                   AVEQGNLPFVVQLLKVNADPDVKDNQGRTPLLWAAEKGHEEVVRLLIGSRRVNVNAADA
FT                   VGRTPLWWAARNGHLPVVRLLVRNGADREAQPSPDDEKVAHGTPLYQAGRKYHTDIVKY
FT                   LIKKGADIDCPCGESGLPLLLALVVHDRTKRGMKMLNVLLEKGANVNARDTKGRTTLHI
FT                   LAKDGDMDLTALFLQRGAQVNAAAKDGKTPLHLAVIHEHEEIVEMLLANGGDPEAADHT
FT                   GDTPLHLAVFAGHRRLVGLLLEKDCDINVTNHCGETPLHKAVERGHRKMVEFLLRNGAE
FT                   LEMQDDYKRTPLHRAVKAKNHVMRLLVNKGANIHATDMYGQTALHIAAEAGLRDDVDFL
FT                   LGHGAEAEAKDHKGRIPLDLAVKAGEVEVEELLQEMSLVVVDASSGSEESGG"
FT   CDS_pept        join(749766..750316,750419..750899)
FT                   /codon_start=1
FT                   /gene_family="HOG000127875" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056359"
FT                   /orf_name="AFUA_3G02840"
FT                   /product="Isopropanol dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86568.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG097082"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EB7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA9"
FT                   /transl_table=1
FT                   /translation="MATHQAIILPGINLPLTLASVPTPAPQSGQVLIKVLASPILAYYR
FT                   AILTGKRPYPLSLPLTPGVSPIGRIEATGSDTTALKPGQLVYVDLAVRARDDPLKEHGT
FT                   IVLQGLFVGITPEARILSENDWRHGSWAEKQLVPLENVHVLDESLLCAQMGYSPARLTW
FT                   INTLLVPYGGLLSGALQPGRRSVEKIQSRYPKGKVVGVATEGLNETSLKDAMRKATPRG
FT                   LGADLFLDFTPSSAAEGQKWIHLASAISALKANGRAVLMGGASDAVSLPYSVLMMRNIT
FT                   VKGNFMFDGTAPVKLIRLIETGNLSLSRFHDIEFDFKDYERAIDEAATKTAGDCGVVLV
FT                   HKE"
FT   rRNA            755859..755974
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(757281..758269),complement(756175..757228))
FT                   /codon_start=1
FT                   /gene_family="HOG000217739" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264183"
FT                   /orf_name="AFUA_3G02850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86569.1"
FT                   /db_xref="HOGENOM:HBG053446"
FT                   /db_xref="UniParc:UPI0000520588"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA8"
FT                   /transl_table=1
FT                   /translation="MEVNSNNSEYIYTAVWTDWSHGRIHGATITLSAQNAGFLTAFLAL
FT                   FVSVSAGHLWRIISFVVHQFHSSQKPRDALHHQQQVIFKNTTSPVALIWEFALLSWAWR
FT                   RKAQHPLLRNLLFIVLAIIWLALTGSAAILSARITKPAGSHCLIMSPHCGLYLAAGAGF
FT                   NASDPYQLDVFDTTQLLETNTATSYARTCYVPGAERLPQCNIYAQTRLALHTTTNASCP
FT                   FQSGMCLEGDSTAFAMDTGLLDSREHLGINAPDDERVLFRKSASCAPLTRAGYITVHND
FT                   TNPLPNFPYSDYLVAAYHYGPTFDGNGIHNYTYYYDAVTVRAQIGYKLQSESAILFSGV
FT                   WATAGASETSQFWKPRDELNRTDADVSIFFLNANSVMYEYPTDDPIFSAHVSALSQLRK
FT                   MGMNTSIAEFDDWYSADTLTTIFGCIDQFQICNARTEVCSDLQGIQAWASLDGMLAFID
FT                   AYDLSPLQADTLSVLVNYLVLNNMYYSIYGRSSYALRAQETLSNLNQVAQLPSNQWQIE
FT                   VQSWFETNLAKLQERSVQFATGPRSSREGKQRVALTDQTPLCKAQKVRCPAGMTSFSVL
FT                   GVSCLLAVGGLIILSNLSLDSIMARVGPKWFPGSAYRRLNWALDDKLQLQRKAFEGAGV
FT                   GHWHGQTAAVPVTDTGETFLAWASNEDPAPKSDHLDTSDDHATRE"
FT   CDS_pept        join(761049..761180,761215..761445)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264184"
FT                   /orf_name="AFUA_3G02860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86570.1"
FT                   /db_xref="HOGENOM:HBG053447"
FT                   /db_xref="UniParc:UPI000051EB7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA7"
FT                   /transl_table=1
FT                   /translation="MHAVWLWEHDDIGVEIPLLGHVFLQCLLHALELIIFVYSIRGEQT
FT                   IGRELCRRLDHDWVAIVGRHRIQIKSASCVGFYLEISDFMKGAHANSSPHSLVVMQHLL
FT                   IHFVPSLRKHYTGAGL"
FT   CDS_pept        762651..763187
FT                   /codon_start=1
FT                   /gene_family="HOG000048434" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264185"
FT                   /orf_name="AFUA_3G02870"
FT                   /product="NUDIX domain, putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86571.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053448"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI000051FA23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA6"
FT                   /transl_table=1
FT                   /translation="MATSKYRTTQYTSEEFVESSGAILFDLSNETQRVCLIHYNVKNEW
FT                   LLAKGRRNCGESRLEAALREVEEETGYKCHAHPVTMSTRAPQKTEADNVPDQARSYPGL
FT                   SEPFMLTIRELNKEGAKLIWWYIAAIDGDLSGSTPSADCDFRAEFFTYDEALQRLTFQE
FT                   DRDILARAITLVRGS"
FT   rRNA            767772..767887
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(769215..769505,769567..771717)
FT                   /codon_start=1
FT                   /gene_family="HOG000217744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751044"
FT                   /orf_name="AFUA_3G02880"
FT                   /product="Alpha-L-rhamnosidase C, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86572.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG053450"
FT                   /db_xref="HOGENOM:HBG333734"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI000051E701"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA5"
FT                   /transl_table=1
FT                   /translation="MRLISHLLFGVALQATSGRATLLVPLTYKDHHGTPHAVHNGTTYT
FT                   LSANDTSPSIIILDYGRNVEGYGTFHVSRRSGNTSVFEMSYSETEALLDMYMADGPLPL
FT                   AAAMDTYRINRYNITEQKTYTNRLIQGALRYQKLNLSSAGELELSLVGFKPTVHEVPMS
FT                   GLPGSFNCSDPVLNRIWEIGARTVQLNEFPARSLPDFWILTEEGALVDSLAPQPFAADF
FT                   AATMSAYKVTFSVKPVAHGFGFTVLSDTLGNGIYIFVDVVNSSISAHAGSTEIGQPPLA
FT                   SAVLPPSVTLHRWHTVEATVNVTQISIKLNGKSVLDFSQTTAYYGSFGLGASFGHRAVF
FT                   ANASLMAFGKEMYSSSLTEKSVLNDFLLGTNPLPVSVDGSRRDRIAYAGDLDIAARTAF
FT                   ASTNGLEYINGSIALLGSMQMLPGFFTPTAKVQQEPRVDVIQANITGLIGYSFSLVSSM
FT                   AQYYEQTGDVTFLRHWAPRVGRLFDWAHSQTLPNGLLNISDASFGGDWNYYDPPLSGVV
FT                   SKFNLVYAYALKQWLPYMADGGLNATMYANRLQSLQRAIATRLWSDELQAFYLSDSHKD
FT                   FFSQEANALAILSDTVPLTGNRSASTVLSSMARHLYVPAGALAFSNASAASGWAQKISP
FT                   YASGYHLKAAFHANDQTNAERLLRSVWGPMSDPSLANYTGCTWETLNADGTPGLGAATS
FT                   LCHAWGSGPTADLSRYVLGVQAVTPGFKEWTVHPQTLGLGYARGKHPVPQGNIRVDWSF
FT                   GKDGLLNMTVTAPAGTKGIIFPPSPLKVPLSKYRVSGHARKVGEGFEIQGGQAFTLQQS
FT                   R"
FT   CDS_pept        join(complement(773663..774059),complement(773103..773590),
FT                   complement(772747..773041),complement(772319..772686))
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056360"
FT                   /orf_name="AFUA_3G02890"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86573.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520589"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA4"
FT                   /transl_table=1
FT                   /translation="MTFLIGTPLNWAITATAGSGFLLFGYDQGVMSGLVTGHAFTRVFP
FT                   EIDTTKHGSGSASLQGTVVAIYEIGCFFGAIICMILGERLGRRKCIAIGSIVLSIGAAL
FT                   QASAYSIPQMITGRIIAGLGNGMNTSTIPVWHSELMKARNRGKGLCIELAINIFGVMLS
FT                   YWVDYAMSYVSNDAQFRFPLALQILFAIVTFAGICIVPESPRWLIAHDRHDEARHVLWA
FT                   VEKNARTLDINDPVLARELAEIQQAIKEEREASSKGSWRMILENGEQKFLYRTLLGIGG
FT                   QFMQQISGINLITYYAPVIFENSVGMSHNLSLLLAGFNGVAYFLSSLVPIWIIDRLGRR
FT                   KLMLFAAAGQCACMAILAGTVSDGGLSAGIVAVVMLFLFNFFFAVGLLAIPWLLPAEYA
FT                   PLAIRTRAAALATASNWIFTFLVVEITPVSIKSIGWRTYIYFSVFNFCFIPLIYFFYPE
FT                   TRNLSLEHIDRLFTGEKILLHLPQSMLADAEDAVAPGTDNSDGKDVDLREVENVKLG"
FT   CDS_pept        join(complement(776001..776570),complement(775820..775933),
FT                   complement(775562..775762))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751045"
FT                   /orf_name="AFUA_3G02900"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86574.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051F04D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA3"
FT                   /transl_table=1
FT                   /translation="MTPTAIDDVAAAASLPNTQQQHTSSAPTVPSLLSLTGKTIAITGG
FT                   GRGLGMGLAFAVVESGGHVACLDILPSPSETQWSTLLKLCKSSNLTASYTQCDVTSETE
FT                   LATALEQIAQDADARGAPFSGVVASAGIQQKVPALEYEGQDFERILRVNVTGAFLTAKR
FT                   TARILVEKNRPGSIVLIASMSGQIANRGLTCSAYNTSKAAVQQLCRSLAQEWGKYGIRV
FT                   NTLSPGYIMTDMTNQLLQAEPEVEKTWMAGALLGRLSTPVEFKAPAVFLLSEGSSFMTG
FT                   ADLRVDGGHCASA"
FT   CDS_pept        join(777253..777356,777422..777902,777966..778598,
FT                   778662..778823,778857..779621)
FT                   /codon_start=1
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056361"
FT                   /orf_name="AFUA_3G02910"
FT                   /product="Dihydroxy-acetone synthase, putative "
FT                   /EC_number="2.2.1.3"
FT                   /function="formaldehyde transketolase activity "
FT                   /function="transketolase activity"
FT                   /protein_id="EAL86575.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="GO:0047896"
FT                   /db_xref="HOGENOM:HBG001305"
FT                   /db_xref="HOGENOM:HBG565885"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI000052058A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA2"
FT                   /transl_table=1
FT                   /translation="MTQQLEEKKKIDLALRTIRCLILDLCQQYKGGHPGGAMGMTAIGI
FT                   ALWKYCMRYVPTNPNFFNRDRFVLSNGHTCLFQYTFLHLTGYKAMTMDQLKSYHSERED
FT                   SLCPGHPEIEIDGVEVTTGPLGQGVANAVGLAMATKHLGAVYNRPGFSLVDNTTWCMVG
FT                   DACLQEGVALESIQLAGHWRLNNLVIIYDNNQVTCDGSVDICNSEDINAKMRACGWDVI
FT                   DVEDGCYDVEGITAALMRARSSKEKPTFINVRTVIGVESKFAGDAKAHGAAFGEDEVAN
FT                   IKRKLGLNPDEHFAVPDEVYQFFSDAGGRGRALEESWNQLLLNYSTEHPEMYEEFRLRM
FT                   LGRMTQDWTKLIPSKEEFPASPTASRKSAGLCCNPLAAKLENIMVGTADLTPSVNMACK
FT                   GKVDFQHPELKTTCGLNGNYTGRYIHWGIREHAMASISNGLAAFNKGTILPITSSFFMF
FT                   YISKQWWLTLSKYAAPGIRMAALQGLQQIHIATHDSIGTGEDGPTHQPIALAALYRAMP
FT                   NLLYIRPCDSEETAGAFIAAMQATSTPTIISLSRQNLEQYPKFSSREGVQRGAYVFIED
FT                   EQAQVTLIGVGAEMVFAVRTRQVLRDRFNIRSRIVSFPCQRLFAQQSQEYRREVLKYRS
FT                   GIPRVVIEAYAVTGWERYADAGFTMSTFGHSLPGAAAYKYFGFDEHVIAPEVAKLVDEV
FT                   QRDGIESLRGDFRDLNPVRR"
FT   CDS_pept        complement(779894..782011)
FT                   /codon_start=1
FT                   /gene_family="HOG000217745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264186"
FT                   /orf_name="AFUA_3G02920"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86576.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053451"
FT                   /db_xref="HOGENOM:HBG331962"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E6EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA1"
FT                   /transl_table=1
FT                   /translation="MQVDSPGRAEGEPDPVSDRTGEREARRWGRTRSECLNCRKKRRKC
FT                   DEGKPTCLRCRKRGETCQWGMRVTFREANTQMLVHGCPRQSKNRTQKTFQIMDVTSEVI
FT                   RDYHQSSPTDTAQHPLLDRGSASPLHHAQDPGRREEAGCDVPKIRTRASQPLNSDDSER
FT                   ASEDLSMGGELPTHSPLDQSGGLAATKLSGPGRRTELSQPTTAEDLVDSNPWLQQVMHK
FT                   SPGSFPPGPGLDANTPPVLQRFPECWDSTNYSPDVSLEDGVFLPGSDYLELHSTLRSHL
FT                   MQEARSRYPSRRNSTDSAGPARSSLGREGFTTVPIIQLRDYEDYSLMPNNQTSVDLPKD
FT                   VEYDLWKNWLEEIAPWLDKFDSQRHFQYTLPVMAQSHEHLRYAMLAVSARQQEQKNKTL
FT                   PIERSLTLYHKAIQLLLPQLPTRTTAVIASCVVLCVLEMLSCAPKAWRRHLDGCAHLMQ
FT                   AVGINGFVGGVEQALFWCFARMDVCGGLISSIKTLIPVNHWASMIDLDTDIRLFQSTST
FT                   FETCANQAVYLCAQTLDLLAPSHLLGRAASVRCDPSDIAYMERWLKLWRYVEDWHVKRP
FT                   KEMKPIVNLPSTDPFPTILFSNAAAISGNQLYHTAAILLLQSKPTNVRLEPKPRSILWH
FT                   ARQICGISMSNDHHGAWTNSIQPLWIAGQWMSHPSEHQAILRLLEKIEQESGWPTKWRA
FT                   VDLQEFWGDLS"
FT   CDS_pept        join(complement(784840..784982),complement(784174..784780))
FT                   /codon_start=1
FT                   /gene_family="HOG000217747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264187"
FT                   /orf_name="AFUA_3G02930"
FT                   /product="Extracellular soluble lytic transglycosylase,
FT                   putative"
FT                   /protein_id="EAL86577.1"
FT                   /db_xref="HOGENOM:HBG053452"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="UniParc:UPI000051F2D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WFA0"
FT                   /transl_table=1
FT                   /translation="MAVLKSITLTSLALAIGATAQSANPGVGKNPKAQGATDNVTPSTG
FT                   PNGSEDWLNTGITTTGWKPPFLSIDDVYTISLQDFYNGIGSACAQYDSYFQSSASKYGV
FT                   NPVILAVIAMQESSCNANAGGPTPGLMQVSCDNYPNGQCTDSIQDNVDAGTHYLKSQLD
FT                   ASGGNAIKALGAYNGWFTAGSGLNGNRGLTKDYPCSAEGKAHGMPQNLDYLHQVLNGWM
FT                   MGLDVYGKDNWIGTYHCDQSCSDGSLC"
FT   CDS_pept        788096..788890
FT                   /codon_start=1
FT                   /gene_family="HOG000178363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903091"
FT                   /orf_name="AFUA_3G02940"
FT                   /product="Allergen, putative"
FT                   /protein_id="EAL86578.1"
FT                   /db_xref="HOGENOM:HBG053453"
FT                   /db_xref="HOGENOM:HBG330001"
FT                   /db_xref="UniParc:UPI00005205A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF99"
FT                   /transl_table=1
FT                   /translation="MQFTKSLLLLAALTSSSLARLQGHERRQYATSASSTVAPSSSSGG
FT                   SSAWTATPAGGSYSTAGFGGRTSNSGSGETYAGNVGNPWGSNIIEVSADSASNYKNVAQ
FT                   ISGQNSEPWTVVFWNKIGPDGQMTGWYGNAALTLTLNAGETKYVAFDDDTNGGFAAAAG
FT                   SIPKDSNGGYASTWGEFDFTSAGNGGWSGFDVSAIQAQNAGLTVQGMKICDALGGTCSS
FT                   ITPNAASVDNAYTTAEAAIGGIGGNLSGGGAVRLAVTIDYSG"
FT   CDS_pept        join(789401..789484,789552..789679,789731..789904,
FT                   789957..790269)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264188"
FT                   /orf_name="AFUA_3G02950"
FT                   /product="Short-chain oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86579.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053454"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F798"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF98"
FT                   /transl_table=1
FT                   /translation="MAQVWLITGCSSGFSSKFVTQVLFRRDKLDVTAFQETPNQKASDA
FT                   IAINRKVDVLVNNTAYTQFSTLEDMKLGDHVSQFTTNSFKTINITRAFLPHLRKRREGV
FT                   IVHIGSMAAWESYPAVGAYSASKAATDATEALDHGTNDLGIKTLLVESCQCRTELLSAE
FT                   SRVFAEPKFPEYQELTGANGKQRSDPKKQLHVSLMWSRGERGQKRDSGQRSWRWARMRW
FT                   QPFGRSDKIR"
FT   CDS_pept        complement(790539..790955)
FT                   /codon_start=1
FT                   /gene_family="HOG000217748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751046"
FT                   /orf_name="AFUA_3G02960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86580.1"
FT                   /db_xref="HOGENOM:HBG053455"
FT                   /db_xref="HOGENOM:HBG329329"
FT                   /db_xref="UniParc:UPI000052033F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF97"
FT                   /transl_table=1
FT                   /translation="MLKLYVLVYKGEPLDYHEYRHTALYLKLPDNQSFIMHILGTQGMF
FT                   EYAQIKNKDPSVVGSLAKVVPVADISEVIGSGPIQSTVAKTLVQNGPLDLDWNCQHWVG
FT                   DALSKLAERKYITVAERAEAIDRMMDACLEAMDD"
FT   CDS_pept        794043..794852
FT                   /codon_start=1
FT                   /gene_family="HOG000178374" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264189"
FT                   /orf_name="AFUA_3G02970"
FT                   /product="Aspergillopepsin, putative "
FT                   /EC_number="3.4.23.-"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL86581.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG053456"
FT                   /db_xref="HOGENOM:HBG325156"
FT                   /db_xref="InterPro:IPR000250"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI000051F2C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF96"
FT                   /transl_table=1
FT                   /translation="MKFTSVLASGLLATAAIAAPLTEQRQARHARRLARTANRSSHPPY
FT                   KPGTSEVIKLSNTTQVEYSSNWAGAVLIGTGYTAVTGEFVVPTPSVPSGGSSSKQYCAS
FT                   AWVGIDGDTCSSAILQTGVDFCIQGSSVSFDAWYEWYPDYAYDFSGISISAGDTIRVTV
FT                   DATSKTAGTATVENVTKGKTVTHTFTGGVDGNLCEYNAEWIVEDFESNGSLVPFANFGT
FT                   VTFTGAQATDGGSTVGPSGATLIDIQQSGKVLTSVSTSSSSVTVKYV"
FT   CDS_pept        join(complement(799443..799806),complement(798062..799383))
FT                   /codon_start=1
FT                   /gene_family="HOG000178385" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264190"
FT                   /orf_name="AFUA_3G02980"
FT                   /product="Metalloreductase Fre8, putative "
FT                   /EC_number="1.16.1.-"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86582.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053457"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0000520336"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF95"
FT                   /transl_table=1
FT                   /translation="MGWPYHIVKLSPEEKSQRRESLDRYGLYSQLSVFIPILSFWLYRL
FT                   GHWVYLRSARRHGYSAVTRPGESRASSPGNVVKRCRSILWWLEDEVAPGWGARQHWIFG
FT                   TAWALWLLTLCIHRTGTDYLHVTKRFGIVAVAQLPTHFVLAIKSRYNPLALLFNTSYER
FT                   LLPWHRISGRLIFLLIVVHATLYLNYFIQTATLQEHLASLKIILGIASFMSLFAMMSTS
FT                   IEAVRRCNYRLFYITHSILAPVILIFLVLHAKSLRWYIVETLAVALLSLLNRLDAISAY
FT                   ATISRIPRTNLISVQIPIPASRIQRFRAAPGQHVYLSLHPETAMKVNSSLVQNLFLRNP
FT                   FTVANVSENNEITLVARVQDGPTSRALDALADSAEKPSLLQLYGPFGSISRFSKLAMKY
FT                   DRILIVAGGVGATFALPVYRELKEQVEAEGKGQDKITFVWSMKTLEEAAWAVGLADGQA
FT                   LTQEDNVKLYLTQSYQMRRQKPSPDDSVELEELQAPRAVVWPSAGTGRPDLAKIVDDLL
FT                   GESDERVAVLFCGPPGMGRVLREDIGRYVREGREVWWHAEAFGW"
FT   CDS_pept        join(complement(801121..801129),complement(800443..800751))
FT                   /codon_start=1
FT                   /gene_family="HOG000178396" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264191"
FT                   /orf_name="AFUA_3G02990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86583.1"
FT                   /db_xref="HOGENOM:HBG053458"
FT                   /db_xref="UniParc:UPI000051FC89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF94"
FT                   /transl_table=1
FT                   /translation="MLNTTNGSTTKQIIMPNNNFSSSQDTGVTGAAKFVTSTVGNTVGG
FT                   VSRTVGGVTGAAARGVGGTITSATGSAGKPVGDALGSVGTGVEDAANRVAKGVEDAGQW
FT                   R"
FT   CDS_pept        join(801364..801567,801629..801807,801900..802056)
FT                   /codon_start=1
FT                   /gene_family="HOG000217749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903092"
FT                   /orf_name="AFUA_3G03000"
FT                   /product="Phosphatidylethanolamine-binding protein,
FT                   putative"
FT                   /protein_id="EAL86584.1"
FT                   /db_xref="HOGENOM:HBG053459"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniParc:UPI000051F2CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF93"
FT                   /transl_table=1
FT                   /translation="MSLESHTQQLTQSLAQANLTPGLLPFLPPDFNPTTQLHVSFNDKP
FT                   VSLGNLFRASECKTAPSVSFPKEESNQPSSTSYTLLLVDPDAPTPDDPKYAFWRHWVIS
FT                   GLKAEEGDSGTALTEYLGPGPKDEEPEGFALKKEDVGGEEFTARRSFKVAEWVESHGLE
FT                   LVGVNWMLGAGDGWTE"
FT   CDS_pept        join(complement(804091..804266),complement(803600..804027),
FT                   complement(802887..803550),complement(802751..802834),
FT                   complement(802549..802703),complement(802293..802495))
FT                   /codon_start=1
FT                   /gene_family="HOG000231892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207645"
FT                   /orf_name="AFUA_3G03010"
FT                   /product="Phosphate-repressible Na+/phosphate cotransporter
FT                   Pho89, putative"
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86585.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG325527"
FT                   /db_xref="HOGENOM:HBG410412"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniParc:UPI0000520337"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF92"
FT                   /transl_table=1
FT                   /translation="MALHQFDYLFALGTIFAFLDAYNIGANDVANSWATSVSSRSLQYW
FT                   QAMVLASIMEFSGSIGVGARVADTIRTKIVDVKAFEENPALLMLGMVCAVTASSIYLTV
FT                   ATRLGMPVSTTHSIMGGVIGMGIAALGSDGIQWWGGDINSGVVQVFLAWIIAPLMSGAF
FT                   GAIIFLLTRYGVMERKNSVLKAFISIPIYFGITSALLTMLIVWKGGSSRINLTDSETTG
FT                   VIIGVGAAVALLVAVFFLPWLYRRLIKEDWQLKWYHLFMGPLVLRRGEVPPPPEGYKTV
FT                   QDYYKGHKTLEELERERANIERAGPSDEESEPAVDKEGKEGQAAAASVEIEEPQFTLIG
FT                   PRPDGAAFSPAVLFWQFRRFFFRGIEQDVVSLQKKRNILTGDLEMVHAHARHYDNKAEY
FT                   MYSFLQVMTASTASFTHGANDVSNAVGPYATIYYVWSTNQLKSKSPVPYWILAFGGAAI
FT                   VIGLWTYGYNIMRNLGNRITLHSPSRGFSMELGSAITVIMATKLKLPVSTTQCISGATV
FT                   GVGLCNGTWRTINWRMIAWIYFGWIITLPVSGIISGCLMGIIINAPRWGLTY"
FT   CDS_pept        join(complement(807261..807813),complement(806464..807215),
FT                   complement(806164..806409))
FT                   /codon_start=1
FT                   /gene_family="HOG000066295" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264192"
FT                   /orf_name="AFUA_3G03020"
FT                   /product="Phosphoglucomutase, putative "
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86586.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG009007"
FT                   /db_xref="HOGENOM:HBG644964"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI000052058B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF91"
FT                   /transl_table=1
FT                   /translation="MSSTSPSDALRFHLAYKPQPLKFGTSGRRGKVVDLTQLEIYTNVR
FT                   AEIRYLQSLQFSEGGIRKGDDFYFAYDLRPSSTGYVENNRGGLCQAVVQALKDGGMNPI
FT                   NLGAIPTPALTFFALQKAKGSIMVTGSHIPFDRNGYKLNTSKGELLKKDEQPINNVVEV
FT                   VREELLSQPFADSLFNEQGMLPAYIQRYLDFFRGESLKGMKILVYQHSAVGRDVVVEIL
FT                   EKLGAEATSAGRSETFVPIDTEAIDEAQLSTVQKLYDSTGQSFNAVVSTDGDSDRPLLL
FT                   APEGDKLRFFGGDLLGMIVAEFLQADSVVVPISTNDAIDRGALAGALEPKTKIGSPYVI
FT                   AGMQSAVEKRRQRVCGWEANGGFLTGSDIERNGQVLPALPTRDAVLPLLCALFAAQSRL
FT                   MTLPALFSTLPKRFSRAALIRNFPRATSLKIIDRFSELEGIFSARHGFSSISRIDYTDG
FT                   VRVIFENGDVAHFRPSGNADELRIYAVADTQERADQIATEGVAEPEGLLRRLERLVQA"
FT   CDS_pept        join(complement(809155..809405),complement(808405..809089))
FT                   /codon_start=1
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751047"
FT                   /orf_name="AFUA_3G03030"
FT                   /product="Catechol dioxygenase, putative "
FT                   /EC_number="1.13.11.-"
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86587.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG109213"
FT                   /db_xref="HOGENOM:HBG429220"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI000051FC91"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF90"
FT                   /transl_table=1
FT                   /translation="MSPKRQFDPNFTPYVINSMGPKTPERARVVLGSLIKHIHDFAREV
FT                   ELTPAEWMLGVEFINSIGKISTPVRNECHRICDVIGLESLVDEIANKIVTDEGLTPTPN
FT                   VILGPFWSPNAPFRNLGDSIIQDPNPNGKVTFMHGVLTDMETGKPIAGAVLDIWQASAN
FT                   GQYDFQDPNQSENNLRGKFRSNEKGEFYWYCYHPTPYSLPTDGPAGVLLNLMDRSPMRP
FT                   AHIHLMITHPDYATIINQIYPSDDPHLNIDSVFAVKDDLVVDFKPKTDDPKAELDLEYN
FT                   VKMALKKHHPNPNSAPPVSSFERYNKGQKL"
FT   CDS_pept        812248..812622
FT                   /codon_start=1
FT                   /gene_family="HOG000048433" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751048"
FT                   /orf_name="AFUA_3G03040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86588.1"
FT                   /db_xref="HOGENOM:HBG053460"
FT                   /db_xref="UniParc:UPI000051F04E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF89"
FT                   /transl_table=1
FT                   /translation="MKLSSNIALAVAFLTSSLSATASAEAPLVTVQLANDQSGANANVA
FT                   VRADGVKHTVESLWGKTAVARNGIVYASSTQLTEFQQNTACRISQPGIDVTLDARHTWS
FT                   WLDGGRVVDLNGASLVCKDA"
FT   CDS_pept        join(815965..816181,816234..816469)
FT                   /codon_start=1
FT                   /gene_family="HOG000178297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264193"
FT                   /orf_name="AFUA_3G03050"
FT                   /product="RNAse III, putative"
FT                   /EC_number="3.1.26.3"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="EAL86589.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG053461"
FT                   /db_xref="HOGENOM:HBG331599"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000051F072"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF88"
FT                   /transl_table=1
FT                   /translation="MSLDERADVVEDIIHYDFTNRSILYEALRSAGALALTGRAHRSDG
FT                   NKDLAQVGDAVLQLILVMDGYEAKGSRGYINQIVSSTASNPNLAQVGFKAGLESVILIN
FT                   PSQASVSPGVMAQTVEAILGAVYLDSQMDVQAVRAVMASLSLGWPM"
FT   CDS_pept        join(complement(817545..817842),complement(817221..817480))
FT                   /codon_start=1
FT                   /gene_family="HOG000178274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056362"
FT                   /orf_name="AFUA_3G03060"
FT                   /product="Cell wall protein PhiA"
FT                   /protein_id="EAL86590.1"
FT                   /db_xref="HOGENOM:HBG053462"
FT                   /db_xref="HOGENOM:HBG327411"
FT                   /db_xref="UniParc:UPI000051E923"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF87"
FT                   /transl_table=1
FT                   /translation="MQIKSFVLAASAAATASAAACQAPTNKYFGIVAIHSGSAVQYQPF
FT                   SAAKSSIFAGLNSQNASCDRPDEKSATFYIQDGSLYLYAASATPQEIFVDRSGMGQGKI
FT                   GYTTGAQPPPRNSERQGWAIDSQNHLQFQGKDLIACPNSIDGAWSIWADAGVANPAGNT
FT                   DCVGIAARVEDVTNPNSCVYTQ"
FT   tRNA            821186..821257
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        complement(821639..822340)
FT                   /codon_start=1
FT                   /gene_family="HOG000215466" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264194"
FT                   /orf_name="AFUA_3G03070"
FT                   /product="MYND domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL86591.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053463"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000051F04B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF86"
FT                   /transl_table=1
FT                   /translation="MSDSNPDETHKCQSCKKAESKSVPLRNCFRCKSAIYCSRDCQKAN
FT                   WKTHKKACASNAQANTGSNNQSASDTNATQSTKALEVDDFLKPFYRLHAKTWLHDHTEE
FT                   ETYKLLIDTYRLRLDDVYTFSGDIHEDSIYGGANDDGRAGFRRFLKSVERKPHLLPTWW
FT                   TPAKAEECIRYGTNSANWSYLGYAVEKHDVVEHYANNLMRIQLRIFGDQVLGTRPSGQK
FT                   RASMMRIANGR"
FT   CDS_pept        join(824479..825255,825345..825425)
FT                   /codon_start=1
FT                   /gene_family="HOG000019479" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264195"
FT                   /orf_name="AFUA_3G03080"
FT                   /product="Endo-1,3(4)-beta-glucanase, putative "
FT                   /EC_number="3.2.1.6"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86592.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG053464"
FT                   /db_xref="HOGENOM:HBG696112"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000051EB83"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF85"
FT                   /transl_table=1
FT                   /translation="MRCQYSCFLLALASLVSAWVPPSYSGYTLQWSDTFAGSAGTLPNS
FT                   NNWNIITGNPGVNGELETYTNSNRNVQLSGGNTLQLVPWRDSSVSGGWTSGRLESKYVF
FT                   TPSSGKITFAEANIRFGSNPTSAKQGIWPAFWMLGNSIRSGTPWPGCGELDILETINGQ
FT                   LTGYGTAHCNVYPGGICNEPNGRGGSIAIPDQSWHTWRIVWDRTPSTWQSETITWYMDG
FT                   QFFHQITGSQIGDSNVWATLCHDPLYFILNVAVGGTWPGYPNSATLDGYGSMMEIAYVA
FT                   VYVS"
FT   mobile_element  complement(832108..833649)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  833911..835434
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   rRNA            836707..836822
FT                   /gene_name="8S_rRNA"
FT   mobile_element  complement(837373..838614)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(838626..838913)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(840112..840160,840283..840386,840450..840562,
FT                   840585..840871,840957..841516)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751049"
FT                   /orf_name="AFUA_3G03130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86594.1"
FT                   /db_xref="HOGENOM:HBG053465"
FT                   /db_xref="UniParc:UPI00005200FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF83"
FT                   /transl_table=1
FT                   /translation="MSRIQVIFFILSQQTIKLSSAAPGESLTFNLAARKERLHPYPSTT
FT                   STTTIAQYPAKETSTPYKSGTKKLRSGGEHSASNTDADGPPGAGEAKTEGTVLTILYVS
FT                   RPVLQSPPLASTEPSPYPPSPDSSTSWTPLFTKDMKPSASFTRLINELFSHLDPQRTGY
FT                   LSPEAVAKYVDVCGAPPSHNIWKTSRAKNPQYGYDMADRELADHFTAYGVDFALRQRTP
FT                   PTTPVNYPVDPQSYLPAAQRSAMSPFMPAQSTSANSLSGGQKPMRSFRGWTDLTVCSVL
FT                   QNPSASCAQLNRAMQAFQLPVWTEWGDIPRDMLPLALCQPEVERVRVLLEGARLNVEQE
FT                   IDAVQAWLKLEARGGQNALDLLDDRVWVCW"
FT   rRNA            842272..842387
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        843391..846006
FT                   /codon_start=1
FT                   /gene_family="HOG000168376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264196"
FT                   /orf_name="AFUA_3G03140"
FT                   /product="HET domain protein"
FT                   /protein_id="EAL86595.1"
FT                   /db_xref="HOGENOM:HBG053466"
FT                   /db_xref="UniParc:UPI0000520579"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF82"
FT                   /transl_table=1
FT                   /translation="MFILTRCPRPKALTTSRITSAGKERRKKTMTVPAVQSLSRAQVAA
FT                   VLDLNTYDPADNGDKPGWLLPIEMRFRRFSETGEAPNVSLLNSAETKARLEQWCRDGIA
FT                   FLDPKNQDLGSHVEKLDDLLSPIMVCSLLIQKQKWSRDEIIDRACALLARLPSYPPELP
FT                   FEYAGKDGQSHAESPWPEEYFLTSDSPSSSSTATTTTTTTGTGRLRDGYEWSSLRVLSR
FT                   PSTNVVRIALFLVMQRSVPVGFLGDYLDTITTLLDTATELFQGSTSEAEARARFVLQAF
FT                   LWATWHQTMLIQLWYDAKIQMRTGVSFDRHSYPVAMPGRETVERLRPNYMCKWAFELLR
FT                   SDLSSVTQDFRRLFEIYNVHFGDREPRCNLNPAAAGQVSSSSRSRVCDGKAPGNCQRFE
FT                   SEGVQIQSAHDFECPGSACSLLTWDEQSYKSIKGARAVSLEETDERHIRYCPVSTETMA
FT                   VSHVWSHGQGGRPETGFNICLHRRYTRLARALGCTSYWMDTPCIPTDQELRYEAMGQIN
FT                   SNFLNSKVTLLVDRDLMEINIHPLTLEAKEAIVATLAVCDWNVRAWTLLEGMRGRWNLH
FT                   VLCKDNHVISLVDVLNDVLAYSNLTLVSPCLALQHYNPTGRRPVEGEIPPVKIEQATCL
FT                   LNHRHATKDRDVTMIWSLVCGSQLVKASVDFWKSKMGSPLATGFLVSSSPRLQDQHGFS
FT                   WAPSRPNLLPPTAGTSSAAGQYPAYDGELSVAGMITEQGFKAEWLMCLIGRSRALPTWL
FT                   HLRFYTQDESQIRSYYHVYNKGGNSRMDMKSLYKLRSVIAPVFKKYRWVALLLPAVRDR
FT                   GTNGATSPPRPFQYQGEAKGPLLVIAGSHDEVGWEWQFVHEWDTNFRLPEFVLREVLMV
FT                   "
FT   CDS_pept        join(complement(847824..848244),complement(847572..847771))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264197"
FT                   /orf_name="AFUA_3G03150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86596.1"
FT                   /db_xref="HOGENOM:HBG053467"
FT                   /db_xref="UniParc:UPI000051FA30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF81"
FT                   /transl_table=1
FT                   /translation="MLKCIPGLAEFPNIQDPTHQENIMAAAVILRQYEEMEEETGEGRG
FT                   RMEAEYDDDERVNFLAVTQRIIDSVIASPLDHSLATAAYWIVIRQEIYYALTRETVPHL
FT                   RFDSDRWPNASIANNMIMFVGKVAQWRWGQKSLDEWTRLKLDEQKLIRESLGKMEPILE
FT                   LKADRAKGQIFPTVWYSFDVHATAAQHFQLAQMILTAENPQLE"
FT   CDS_pept        join(849711..849771,849837..849921,850047..850196,
FT                   850270..850293,850437..850663,850734..851011)
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264198"
FT                   /orf_name="AFUA_3G03160"
FT                   /product="Glycerol dehydrogenase (GCY1), putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86597.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000051FEC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF80"
FT                   /transl_table=1
FT                   /translation="MALPTHFKLNTGAQIPAIGLGTWRSEPGQVRQAVSFALKNGYSHI
FT                   DTAFTKLARASRIVVSLAKTFSSPANCGTPTSPTSLKVSRRPLTLWARTTLISISSTGQ
FT                   SDYETWRQMEEIYKAGKVKAIGVANWSIPYLEELKKKWTVVPAVNQVELHPFLPQHALK
FT                   EWCDKHGILLEAYSPLGSEGAPLMSDPAIQEMAKKYGVSPATVLISYHVNRGVVVLPKS
FT                   TQENRILSNRQVIPLSPEDMDVLNGLAAQGKARRINTPLFGWDLGFDDWYQQ"
FT   CDS_pept        join(complement(852542..853296),complement(851265..852486))
FT                   /codon_start=1
FT                   /gene_family="HOG000240003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264199"
FT                   /orf_name="AFUA_3G03170"
FT                   /product="Flavin-containing monooxygenase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86598.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053468"
FT                   /db_xref="HOGENOM:HBG700572"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000051E702"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF79"
FT                   /transl_table=1
FT                   /translation="MATYVQESAGTDSAFPASLQSKGAVLNHDQVPKPVADDFMYAFKY
FT                   NHSLPTTDVLGVEIPADCDAQKEAEGIVARLSTATSQGDAHAFAGLFLDYGETLSKTRP
FT                   EIPTFADFQCTGVWRDKLSFTWDFRTFNFRAAILKAATDLLPQTRATNFTFLEPAPSVA
FT                   RLYPDFSQLQFVVSFETEIVFASAVINAVLTQDGWRIYTMHTVAESLKEFPEQSAPDGH
FT                   MTGITSWECQRAEAVNSVDPEVLIIGGGQNGLAMAARLKVLGMENLIIERSEEVGDVWK
FT                   NRYEYLSLHFPHWPDALPYFKYPQHWPTYTPAQKQGLYMKWYASALELNVWTKSEVVKA
FT                   EQDAEGRWTVVINKEGKETRTLHPQQLIMATSLCGVPSIPAVPGMADFRGVIRHSSAHK
FT                   SARDFVGKKVCVVGTSSSGFDTAYECARLGIDVTLLQRSPTYVMSLTHSVPRLLGGYAP
FT                   DKDGNLPNLEVQDRLMFSTPVGPGEELARRTAKVLEELDKPLLEALNARGLRTWRGQRD
FT                   TGNFTLGQTRNGGFYFDAGACQEIINGNIKVEPGFVERFTEDKVILNGGREREFDLVVF
FT                   ATGFSNMIDSIRATLGEKIASQCGPIWGIDEEGEYNTAYRETGVPNMWIMVGFLPMTRY
FT                   ASKLLALRLKALKEGISPPPYKG"
FT   CDS_pept        join(complement(855427..855826),complement(855271..855372),
FT                   complement(855139..855200),complement(854571..855080))
FT                   /codon_start=1
FT                   /gene_family="HOG000227439" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264200"
FT                   /orf_name="AFUA_3G03180"
FT                   /product="NAD binding Rossmann fold oxidoreductase,
FT                   putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86599.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533598"
FT                   /db_xref="HOGENOM:HBG612336"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F7A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF78"
FT                   /transl_table=1
FT                   /translation="MTNWDRRVKFALFGLGRLGVLRARILAFQQPRIELVAVCDVKPGT
FT                   DKWAAKNLPTSVKYFSDPQECLTNSGAEAILICTATATHAPLILQALDLGLHVMCEKPI
FT                   SVDVATTKAVVEKSVSRPDLKFLVPFTRRYDKAYRQAKALVDNGDLGEIHAIETTGIDQ
FT                   ADPNAFFVSFSEQSGGIFLDFGIHTVDAGRYLLDVKSGLSNPKKQVNRVIAFGQVAVYG
FT                   DLAKYGDADNAWGLVEFANGKILKTYLGRTLTSGFEDTTRLCGTKGHLIISATSNVEIR
FT                   DHLGIRTQSVPDAFTLFDATFLADLAEFADAVLDNKPLTCQPEDAFEAGKICAALQYSF
FT                   RKGVPVYFDDNGLPIMD"
FT   CDS_pept        join(complement(858664..858799),complement(857216..858612))
FT                   /codon_start=1
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264201"
FT                   /orf_name="AFUA_3G03190"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86600.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058554"
FT                   /db_xref="HOGENOM:HBG738000"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000052057A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF77"
FT                   /transl_table=1
FT                   /translation="MSSTGGKTPTSNTKTHPTVMTDPPYSIFDTRQKWLIIIIVSTAAT
FT                   FSGFASNIYFPALPTIAIDLNVSLELVNLTVTSYLIFQGLAPSFWGPVSDVKGRRTAYI
FT                   CTFIVFFCACIGLAETKNYTTLIVVRCLQSAGSASTIAIGSGVIGDITTRADRGGYMGV
FT                   FQAGLLVPVAVGPVIGGAIAGSLGWKAIFWFLAIYSGVFLCLLTLVLPETLRSIVGNGS
FT                   RKPSHPVLRYPLNLYQKSSKMPWQQPQDGLSTAEAKKKIDLLGPLRMLLSNHAAPIILF
FT                   LAVYYAVWQMSITAMSSLFKSRYGLSELQIGLTFIANGVGSMVGTLVTGKILDADYRRV
FT                   KTKYEASFDNEHRDAMSQTAREENFPLESARLRLVPIFSITQCVSIILFGWTIQYPDKV
FT                   HIAVPIVSTFITGWTAVSTQSLIMTYLVDLFPDRSAAASASLNLARCLFAAGGTSFIMP
FT                   MINGVGVGVAFTICVAVQMVALIGPLIQWRFAAGWRRKEREEAAKREGQGEC"
FT   CDS_pept        join(859100..859513,859565..859801)
FT                   /codon_start=1
FT                   /gene_family="HOG000234899" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264202"
FT                   /orf_name="AFUA_3G03200"
FT                   /product="Cysteine hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86601.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053469"
FT                   /db_xref="HOGENOM:HBG326656"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI000051F2DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF76"
FT                   /transl_table=1
FT                   /translation="MGSATNNPVDFGGNYAILNLDWMSLLIKAVENTPEGQAMIASCSR
FT                   WNVAVHQKSPRPLTVFSTLSFSPGQPEVQPNSPFADLLRPYGEFAQGTPPVEIDERFHL
FT                   DEKDLVLHKTRWSATSGNALEQILKAQGIKTVVISGLSLSGVVMSTIYRLFDLDYDIYV
FT                   IRDNVVELPPAQNTAFSNVLLDMLLPKMGLKVISLEDALEALSRSEKSAERTV"
FT   CDS_pept        complement(860517..861467)
FT                   /codon_start=1
FT                   /gene_family="HOG000217758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903093"
FT                   /orf_name="AFUA_3G03210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86602.1"
FT                   /db_xref="HOGENOM:HBG053471"
FT                   /db_xref="HOGENOM:HBG326624"
FT                   /db_xref="UniParc:UPI000051FEC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF75"
FT                   /transl_table=1
FT                   /translation="MHLDHKLPWNTVSAHFAFTKDNQDIRRNDFLVHDRLVDRQSADFK
FT                   HFTQTLISTIEEFSATERAKYPPPAALPKSGPLYDAAILSSIEEKYHLGPHATNSAVSN
FT                   PLSEEFQDVDYWISQAPYSTATAHLADAVKMLIISNEMLALLRLANHEKIPLMDLNHLS
FT                   WGHSFGVTHVADVALEIYMLLNIAASVKANAKPGSANETGCLTETRRFRSFASWGLGDF
FT                   DFPAQNIPHRLFWNTKCITDGLEFSTWDPLRLESDDERREMKEYLKMCFELLYRYDLLL
FT                   KEMGGDPEWKEKILGILHTWGARCIALGESGFCFI"
FT   CDS_pept        complement(862317..862739)
FT                   /codon_start=1
FT                   /gene_family="HOG000178308" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19056363"
FT                   /orf_name="AFUA_3G03220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86603.1"
FT                   /db_xref="HOGENOM:HBG053472"
FT                   /db_xref="HOGENOM:HBG331866"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="PDB:3C6V"
FT                   /db_xref="UniParc:UPI00005207F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF74"
FT                   /transl_table=1
FT                   /translation="MPRWLIQHSPNTLTPEEKSHLAQQITQAYVGFGLPAFYVQVHFIE
FT                   QPAGTSFIGGEQHPNFVALTIYHLARTMTSDEQRQGFLKRIDAFLTPMFEPKGIDWEYF
FT                   VTEAPRDLWKINGLAPPAAGSEEEKVWVRENRPVRF"
FT   CDS_pept        join(complement(865580..865759),complement(864428..865523),
FT                   complement(864234..864370))
FT                   /codon_start=1
FT                   /gene_family="HOG000178319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264203"
FT                   /orf_name="AFUA_3G03230"
FT                   /product="BZIP transcription factor, putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL86604.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG053473"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0000F51C5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF73"
FT                   /transl_table=1
FT                   /translation="MSSTEPNPALSTASDDHQSGKDDGSPKKIMVDSQPAKAKERSSKK
FT                   RGRPQKVQDAQTPAERRRAQVRLAQRAYRSRQEATMVQLKNRIAEMESVIETMTEAFLA
FT                   FSDTLMQSGVLNGSPDIAQSLKEVTAKYVTLSSQMTETDGDHAAPQDKALSQITASEQS
FT                   SFHSADQTSQSSDSVVAVRTGSGDGDPGGAEPFGVLMPIETPGMANGSPFSITTPTDIR
FT                   VLSPHFINIRTPMSHLDRPDSPFFAQRLHLAAYKLALRYLRNPDVPDSALLRNFGFLMT
FT                   RWSRRQLISYLNSFLKSSDGVEVSRKFSIPLLNLGGAGLHYPQKHSPLGDPNLHWLPSA
FT                   EDISMMYANGLSIQDLEEPWFDPEDVEGFLEEQGIILSNRNMFPAGLQSDHQDVVARTW
FT                   QSGLWDDRAMFSRGHMFAVDEDQLINWLSHRGICLGRSPGFRKRDVERFISQHAWPIGM
FT                   PLMPIQAVAVAQ"
FT   CDS_pept        join(complement(867971..868128),complement(867776..867917),
FT                   complement(866768..867730))
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264204"
FT                   /orf_name="AFUA_3G03240"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86605.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053320"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E946"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF72"
FT                   /transl_table=1
FT                   /translation="MSSNIETAPDSSQAEKNEPPKPTFPEGGLKAWMTVLSCWCVMFNT
FT                   FGYMNAFGVYEAYYKNTLLRNESNSNIAWIGSLQAFFMYASGLVSGPLMDRYGPRVILV
FT                   PCSIVFVLSVMLTSLCKEYYQFILAQGVLGGVFNGLTYTPTVTAVNQHFFRRRPLALGI
FT                   ASSGSSLAGIIIPIALNRMLNQSSLGFGWSVRILGFIMLALSVVACLAISSNAPKRRTG
FT                   APFFLEAWKQPEYTVQIIGVFLVTWALFVPMFYIPSYAQSIGIGVSLSNYLIAILNAGS
FT                   LVGRILGGALANRLGRFNTLAAASAACGILILCWLRIKSRGGMVVLSVLFGFCSGIVIG
FT                   LFAATIAVTAPKPNVIGSYLGMAMGVLSLASLTGTPITGAMISTYGTYDAAIIFAGVSA
FT                   VLGAVIIFVARVVYAGWRLVA"
FT   CDS_pept        join(complement(870143..870149),complement(868558..870092))
FT                   /codon_start=1
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751050"
FT                   /orf_name="AFUA_3G03250"
FT                   /product="Aldehyde dehydrogenase family protein, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86606.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051FC6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF71"
FT                   /transl_table=1
FT                   /translation="MRVPKDNHLVLPRKTTTMSDVPHVSNWVNGTHTPPTPERIVVLNP
FT                   ATETPIATIDATPQATVQAIIATSWETFHGGSWSRADASDRFAVLSKAAALLRARIPEF
FT                   VELETRQTGRPIREMRAQLARVPEWLEYSASLARVHEGRVTPFKGPVVNTLTRLPLGVV
FT                   AQITPYNHPLLIATKKIAAALAGGNVVIVKPSELAPLSVLRLGPLFQEAGLPDGVLQIV
FT                   SGYGSETGKSLCESRPLAKIDLTGGLATYKAIAPAAAANMIPITAELGGKAPVCLFPSL
FT                   DVELAVKAAMFASFIASGQTCVTGSRLLVHADLYDRFKDLLEKRVRALRVGDPMEERTQ
FT                   IGSVISRAAVERCSAFVLRAVQEGGRVLCGGNPTNSNGKGFFFEPTIIETHADSDLATN
FT                   EVFGPVIALVRCESEEEIIRIANSTSYALGASVWTNDFSQAHRVAAKIEAGIVWVNGHH
FT                   LNDPSSSWGGFKESGMGKENGIEAYESYTKVKSTVINYGVQPVWFDDEPANARYG"
FT   CDS_pept        join(874449..874538,874588..874900,874949..875171,
FT                   875220..875310)
FT                   /codon_start=1
FT                   /gene_family="HOG000167093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264205"
FT                   /orf_name="AFUA_3G03270"
FT                   /product="Isochorismatase family hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86608.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG042019"
FT                   /db_xref="HOGENOM:HBG289404"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI000051F799"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF69"
FT                   /transl_table=1
FT                   /translation="MRFITVLQTIALLAASMTVKAWNQLDKENAAVLIIDYHVGLAQLD
FT                   RDFNTNDFRNNMLAHAALGNLFDLSVVMTTSSDAGPNGLTIKEVVDLNPNVTIVHRQGE
FT                   VNAWDNAEFRAAIQATGKKQLIVSGIVTEVYRHRLLGPLAHRRRIRGLANTEASGTFDD
FT                   KLAADANRRMEKAGVTLMGTFGVVTDLMRDWRNTPGLDQVLPYLDKYQYACGLVARHHA
FT                   GALENGTLAAVESTLI"
FT   CDS_pept        876157..877704
FT                   /codon_start=1
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056364"
FT                   /orf_name="AFUA_3G03280"
FT                   /product="FAD binding monooxygenase, putative "
FT                   /EC_number="1.14.13.-"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrial respiratory chain
FT                   complex IV"
FT                   /protein_id="EAL86609.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0005751"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053475"
FT                   /db_xref="HOGENOM:HBG672088"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000051FC6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF68"
FT                   /transl_table=1
FT                   /translation="MIPRTEVLIIGAGPTGLVLALWLTRQNVKVRIIDRQEAKPSTSRA
FT                   LVVHARPLELYRQLGLADDVVANGHKIEATNIWAEGTHRAHVPIGDVGKGLTPYPFIHV
FT                   YPQDRHERLLEDRLNAMGVTVQRNWKLVDFEEHDEYILAQLKYTSEQPSSTEKTEFCEA
FT                   RYIVGCDGAHSAVRHLCNIAFEGATYPQLFYVTDIEGSGPTMNGEAHVSLNGSEIMLSL
FT                   AYDTNRRARLAGAVNEEHVTKDISELTLDDILPTTIKKMGLQIDKVNWFTTYRVHHRLA
FT                   ASFRKGRAFLAGDAAHIHSPVGGQGMNTGIGDAINLAWKIAAVVHGKADASLLDSYEPE
FT                   RRAFASTLVKTTDRGFSNLVAKGYVANFIRTWVIPTVLPVLTWFNRVRHRLFQGASQIM
FT                   LNYRDSALSAGTAGYVQGGDRIPWAPVGDVDNFDSLKEITWQVHVYGDSKRAMADWCRD
FT                   KGVPLHVFPWDGKYQAVGFGRDAAYLIRPDTYVAVAEPSGLPETFEQYLERNGIRLV"
FT   CDS_pept        878888..879295
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264206"
FT                   /orf_name="AFUA_3G03290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86610.1"
FT                   /db_xref="HOGENOM:HBG053476"
FT                   /db_xref="UniParc:UPI000051FA24"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF67"
FT                   /transl_table=1
FT                   /translation="MSSQSTDVSVKLTYLQWQSIYNDTRPYRIAQFGRKKKNAQKLAHN
FT                   LIFHKGDSEELIRDIRKTKEQGAQFSLEMNGFIYREYPSSSMAPSDFWSAEQVEKVFLP
FT                   ECEAVIRNEIKGVDQVYIFDWKVTSPISCAG"
FT   CDS_pept        join(complement(881945..882267),complement(881366..881894))
FT                   /codon_start=1
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264207"
FT                   /orf_name="AFUA_3G03295"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27280.1"
FT                   /db_xref="HOGENOM:HBG324152"
FT                   /db_xref="UniParc:UPI0000F51C4C"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Y0"
FT                   /transl_table=1
FT                   /translation="MIATGTTTDTLRKQDIQTELNYWGGTNDPIIIDFAKPDGKEKFAE
FT                   AENQQAKHPVFIHDIRGTKDQYTLETRGFQYVHDEVPDFDDWTDEQKVIDTLIPRSEEL
FT                   VRKITGAKETITFAHRIRCFASDDAKLADNRAPAHSVHTDFTVAGALRHLETAVPDPER
FT                   RQQLLSGRVMIINVWRPLKTVHRDPLAVCDWQSTNPQDIIPFRLVLPQGWNELSKVQYN
FT                   KDHRWYYLSNQQRDEPLVFKQFDSGKLEEGGYTLPHSAFEHPSMTEHEPRQSIEIKMFA
FT                   FL"
FT   CDS_pept        join(complement(883862..884161),complement(883121..883815),
FT                   complement(882864..883072),complement(882542..882816))
FT                   /codon_start=1
FT                   /gene_family="HOG000217760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903094"
FT                   /orf_name="AFUA_3G03300"
FT                   /product="FAD-binding oxidoreductase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EBA27281.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG324153"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000F51C87"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9X8"
FT                   /transl_table=1
FT                   /translation="MFFHRCLTVSLATVVAANRNISVTGTPCACTQLESFYPDKLLLPS
FT                   AARYTVEATSYWDIRSDLHPSCIFLPTTAEEVANAVKILTHCDAHFAVRGGGHMNFPGA
FT                   NNIDNGVLIALSGLNKFTVYNGTIDVGPGMTWYDVYSALDPYGRIAIGGRLKTIGVPGL
FT                   TLIGGVHYFINKYGFAMDNVVRYEVVLGNGTQVVASANSHPDLFWALKGGANNFGIVTK
FT                   FTLKTFAIPKISTTLQSFNESGIYDYITALCDLVKLDEPNPIAAGGVFTIDYNVTTKVS
FT                   SASLIGVQEGISRPPSQFANFTALPGMSKVHNVTTGKQFASGLVTPNQMFRVMFSHHTV
FT                   QPDPETLYSIYQAWKTAVDEIADVKGLYPTFVMNLSPAGAARVGRTNGIGNVWGLDEQP
FT                   MIWWQFSTGWDLASDDIRVQTWSRRLTESLHAINREKGISSEFVYMGDAGEWQDPFVGF
FT                   PAANVRRMKAVRSAYDPLGTFSRLNWGGFKLGFD"
FT   CDS_pept        join(884900..885059,885105..885347,885395..885849)
FT                   /codon_start=1
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264208"
FT                   /orf_name="AFUA_3G03310"
FT                   /product="RTA1 domain protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86612.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123771"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051F073"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF65"
FT                   /transl_table=1
FT                   /translation="MSPNNSFVLYHYEPSLPAAIAFSVLFNITTLAHVYQRVKSGSNYM
FT                   NPFIVGGFFQVTGYGCRAASHFLGTSTTLYAIQTLLVLLAPTLYAASIYMILGRVIRYL
FT                   HAERLSPVPVKWMTKTFVAGDILSFILQGAGGGVMSAGSANSHDIGTYIILAGLAVQLL
FT                   FFGVFVFVAFVFHFRFSSSQGAGTSGNVPWVKSWNGLLWVLYLVSALILIRSAFRMVEF
FT                   AQGFDGYLIRHEIFMYVFDTALMFVLMVVMNTVHPSGVSSAGKGELVECETLRARGSDA
FT                   ERGV"
FT   CDS_pept        join(complement(887159..887323),complement(886053..887102))
FT                   /codon_start=1
FT                   /gene_family="HOG000217761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264209"
FT                   /orf_name="AFUA_3G03315"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86613.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053479"
FT                   /db_xref="HOGENOM:HBG324154"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51CAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF64"
FT                   /transl_table=1
FT                   /translation="MIHRSLSRTLTPVQLRRRYCNRRLLAMSSTLPVRGRRTHRKSRHG
FT                   CQQCKARKIKCDEAKPTCRNCTKHAVDCTYSLPSGGSPAQSHRSERTSPQASKPSHCEC
FT                   SDLAVHDLELLHHFSTSTAYTFSRNPALQTFWRVDAPQLGFGAHYTLRAMLAISALHLA
FT                   YLRPTQKQFYVSQAEHHHSVALTFVTSNMTRLMNENSSALFLFSILTSYFSCAKPRKLD
FT                   DLLLFQQGRISEWLVLFRGTGAIIEYAQEELRSGPLAALLGIRQRRSDYRNSLPTQGQA
FT                   FMDDLEELIREEVKEQQELQVYLGAIQEMRVSYALWSDIGMWETGDVLVWLLRVSEEFL
FT                   TLLREQRYVALVIFGYFCPLLRRLEWMWWLEGWSVHLLSRIHGLLDQEHRTWIQWPMEQ
FT                   LGWRP"
FT   CDS_pept        join(complement(889033..889226),complement(888604..888977),
FT                   complement(887789..888549))
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751051"
FT                   /orf_name="AFUA_3G03320"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86614.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053320"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005205A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF63"
FT                   /transl_table=1
FT                   /translation="MTVSAAATPDNRSEGSSPPSTLPVEELRAEKVEETQTPSPPPPPN
FT                   GGWMAWLQVVGAFFLFFNSWGVVNTFGVYQTYYETDLLHGHSPSSISWIGTVQGFLLFL
FT                   VGVIAGPVFDKGYLKTMIAAGSFLVVFGLMMTSLSDQYYQVFLAHGVVVGIGCAFLFLP
FT                   SIAIVATYFTTRRAVATGITASGGSIGSVIYPIIFRKLIDSVGFGWTTRIIGFIALGGL
FT                   CVSLAVMRMRLPPPKQARSLLDLSAFKEASFLIFSFGLFCAFVGLYFPFFYLPTYMSNI
FT                   VHSTDDLAFYIIAILNATSVFGRITPGLVADRLGSLNTLIPMGLIAAILAYAWMGIKNI
FT                   AGTIVFACLYGFASGAIVSLPPTVVARLSPNMSIVGTRMGMCFTFAGLGLLIGNPIAGA
FT                   LLDLERGVFWKAELFSAVMVTAGAVSFIWLRLLKWRDGEKGKY"
FT   CDS_pept        complement(889931..891157)
FT                   /codon_start=1
FT                   /gene_family="HOG000178330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751052"
FT                   /orf_name="AFUA_3G03330"
FT                   /product="Mitochondrial enoyl reductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86615.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053480"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520350"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF62"
FT                   /transl_table=1
FT                   /translation="MMALGEFVRQTAYKWRPYTTLDNCKHHHRLPFSQPINLSQSSLIY
FT                   FHYIMAESLIFAYGSTEPVKDIRLHSTPAPADCGPHEVVVDFLAAPINPLDFLVLHGKY
FT                   PVKPQNHITVADGEHRPIPGSDGAARIVRTGSAVTQFHVGNSVILRTHCRGSWRTHAVL
FT                   DENDVLRVPSELDPHLACILRMGVAPAYFLLRDYSTLEPGDWIIQNAATGTVSHFVTQL
FT                   ARLQGVNVISVIRDRGTDDELERTKRSLRSHGAAIVLTVDELKTVGAEVLQGKRVNLAI
FT                   DFVSDDALARLMASFLVPGATLVTAGFLGIAPSSPEANLRQFLWQRNITLKAFRLSDCL
FT                   GRRSAFHQTALLEWFARLFLEGTLKTPALEYVRWKRGDPGLEGKLQEVLERHERGEVGE
FT                   RKKILVFEH"
FT   CDS_pept        892438..898767
FT                   /codon_start=1
FT                   /gene_family="HOG000169896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264210"
FT                   /orf_name="AFUA_3G03350"
FT                   /product="Nonribosomal peptide synthase SidE "
FT                   /EC_number="6.3.2.-"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="EAL86616.2"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG053481"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51C9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF61"
FT                   /transl_table=1
FT                   /translation="MAPVALRDLAESPELEGTEVVSMKARSSPPLTPPSPPCLVTDYIR
FT                   HQVESNPDAPAVQCEQEQPYSYAALWQLVEHIAAAGQFRAGRIMPLCMDPSVEFVATVL
FT                   AILRAGSAYVILDPEGSAQRNRVIAEDCGCEPVIVHEKYAAFFDHSVTIESIQSIQNHG
FT                   QLDPPSITPSDLAYLIYTSGSTGTPKGVLLSHRAVSHGIDQFQLNGRKRWLLFYNPIFS
FT                   AAQRTILATLSKGACLCLTRRDRLATALPEVLNNLQIDALGITPSALALLSPGETPACL
FT                   QQITTVGEPLSQSLVNKWADRVHLRVSYGLSECAQLNFSRQLQPGDNPRNPGLPSDTTT
FT                   AIVLEPGTMTRLSVNEPGELCLYGPQVANGYHQRQKETQAAFVKAPKDTHGTMMFRTGD
FT                   LAVQREDGTFEILGRIDHQVKIHGQRVEPEEVAAKLATVKGVASLACVGCYINERMSLV
FT                   AAIVPSPEADWGTLVQYLRDHARQSFPPYMVPSYWMSCTEFPTNQNGKVDFRAIRRLAE
FT                   STEVSKMLGHSTSPKDGATAGLSETASKIAQVWAAVLNLPASSIIPSDSLVALGGTSID
FT                   AIRAIRELKGHGIHVELADMLQAHTIEEIADTVQLDSSPTHVSNEPAAPFDYISDAVLK
FT                   ADLLADRRVVDAYPVTALQEGILASTLQGSQDYLYQRVFDVRHLDLVRLQLAFQVVFWR
FT                   TELLKSTFVAAAKGFLQVVRNDFNLPWSEVSLSLSEYLEQDKNNGVTLGEPFMRVAVLD
FT                   RSILVVSVHHALFDFWSHRFLFDDVARVYYGRRPEKRPEWKSFVGLLHTRDTKASQDFW
FT                   REHLGEAVPTVLNYAPVTKTSTARRTVSQEVRAASSALRAPLGAIIHAAWALVLSSHIA
FT                   SKSVTMATAVSGRELPVPGIEALNGPTLAVVPYAIAIDSEQTLQQLVQSVNTSLWKVIK
FT                   HSQVGVRNALAAAERQGTTLFDTMVNILVNGKVNDDISKEVFQLYGRRPVWRTEYTTLN
FT                   VEEGATGIDVTLTSPMEEHRLEFILEQFCMALNLIASNPRQTVKATNLVSETELQFMLQ
FT                   SHKNLPDATRTLNGQFEATVRTYPNRTAINYQNEQFLTYAELDSEANRMTHYLSELGVV
FT                   PGDIVPLLLEKSPLMIKAILALFKLGAAYVPLSPENPLERNAYIARDVSAKFVLTEKEH
FT                   EAYFASESDIPSVLLDQANLSQYGPEPQLVTVSPDALAYLLYTSGSTGLPKGVMVTHGA
FT                   CAAAMQSIIEFEHRQGQESRMLQFSNYVFDVSLYDFFVALHSGGTLCIAPSERLLNNLA
FT                   EVINEMNVNHVFLTPTVARLLNPKDVPNLESMTVGGEQLTRDVVTTWASRVTLRNGYGP
FT                   TEASVLVTMKDVDTDTTGGNIGRPLASVGAIVLEADGVRPVPYGAVGELCFFGPQLAQG
FT                   YFKKPDITSAAFIESEVLNGRRLYRSGDLARYLPNGDIECLGRKDDQVKINGHRIELGE
FT                   IEQAFLRTGEIKDCVLTVWKHNSTAHLVAVAVFDGASSEKPGEVLPLDGFAENVQRVRS
FT                   KLTGLTPYMIPKAIVPLSSLPRLPSGKANRKQLKAMVQSLSQGELTKFSFDKVGAAQSK
FT                   GAVIPLASETQKVLQQGWIETLQLADDDFGLEADFLSLGGDSIAAINLVSWLRRKQLKI
FT                   SVRDVLKYTSLGAMADQLKGESGDAHQIQKKTFTPPSEIDAAISAAGLQATEYEYIYPC
FT                   PPGQAEFLTQGAHPEALWSLMTVRKVGSDFAPRQWIDLVRQLTTTNEILRTTFTRCHGN
FT                   WYGVVLRDATPVVEIYEDVSNEQRQQIIKSLDDYRFVFGKPFIRYAILHLSTGETEIVT
FT                   KLDHGLYDGTLLRIFGEHFQAYQDNVPVDRFTSFKDFAFHIWQMDKSRTLSFWKQSEKR
FT                   PIAFEFPSSSGTEPRINSVHVHTINLEFDAFAKSTGATVSIIFQSIFQLWLALRSNQRD
FT                   VAFDYLYTGRNIDLPDPQTINGTCANFLPMRSKVDPSMPVSEFLRQTQDEFWQYTENST
FT                   VGMDEIHEACETTREGFSNKTLFLFQPFEPAPATAKQYEKWIVMAKSQVTMPQPYAVVF
FT                   EVVKTADVNEYKLKFAFDKRVYEKEQVQGEAQVIEKLLAKVMENAEASVGDVLGSFRS"
FT   CDS_pept        complement(899325..899885)
FT                   /codon_start=1
FT                   /gene_family="HOG000178341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056365"
FT                   /orf_name="AFUA_3G03370"
FT                   /product="Cell surface protein, putative "
FT                   /protein_id="EAL86619.2"
FT                   /db_xref="HOGENOM:HBG053484"
FT                   /db_xref="UniParc:UPI0000F51CA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF58"
FT                   /transl_table=1
FT                   /translation="MRFFLLLATTLASTVYARTDLRGCISSLTRNQWNEASMIWYVPDT
FT                   GEICDIPDCGGGRAPPKHDNPACPELYTGTATYEPSYLPGYGPGAAASTPTLAATASAS
FT                   TTGDAMTTMSSEASSLRITAAPSTTASATETMKTSVKAGSSSSVASTTTGSAGATETGN
FT                   GAGILELNVVGAVAAAALAVAAL"
FT   tRNA            complement(900573..900660)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        join(901268..901371,901420..901656,901705..902011)
FT                   /codon_start=1
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264211"
FT                   /orf_name="AFUA_3G03380"
FT                   /product="Sugar O-acetyltransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /protein_id="EAL86620.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG282173"
FT                   /db_xref="HOGENOM:HBG699746"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI000051FEE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF57"
FT                   /transl_table=1
FT                   /translation="MMPRTEKDSQIIEKAKSLQGVCWGEEYEKMISGILYSPLASELIE
FT                   GRTRARFLMSEFNGPPKPDVPFSETVAQREVTLRKLFGRVGRGVYIEPPLFVDYGCNIS
FT                   VGDGFYANFNLTVLDCGLVTIGNNVEIGPNVNIITGEHETKIEARRKHRGTEFTREVII
FT                   GDDCWIGANVTILAGVTIGSGCSIGAGSVVKRDIPPYSIAVGSPARVIRSAV"
FT   CDS_pept        join(complement(903273..903326),complement(902202..903212))
FT                   /codon_start=1
FT                   /gene_family="HOG000178252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903095"
FT                   /orf_name="AFUA_3G03390"
FT                   /product="Siderophore biosynthesis lipase/esterase,
FT                   putative"
FT                   /protein_id="EAL86621.1"
FT                   /db_xref="HOGENOM:HBG124307"
FT                   /db_xref="HOGENOM:HBG620655"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="UniParc:UPI000051F7A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF56"
FT                   /transl_table=1
FT                   /translation="MYSKFWPKGGLPGILHHYTETLVTFEYTTTTTRKPHSLLFVGGLG
FT                   DGLATTSYLADLAHALQPTEWSLFTLTLTSSYQSWGLGHLDRDTNEIAQCLKYIKEYKT
FT                   EKFGGSASSGKIVLMGHSTGSQCVLHYLSRPNPHTHTPAFDPYLEHVERMPLDGAIMQA
FT                   PVSDREAIQWVLAEGLGDRTPAEIRPVFEKLTSMAREAARDADAGTDVLLPLAMTSLVY
FT                   PAHTPLSARRFLSLTSPESPESPSEDDLFSSDLSDEQLGKTFGMIREQGLLRGKLMVLF
FT                   SGADQSVPAWVDKDTLLSRWRNATDHNGEAAIWDENSGIIPNASHALSNDDQAEPRNFL
FT                   VNKVLGYLSALVKA"
FT   CDS_pept        complement(904874..906262)
FT                   /codon_start=1
FT                   /gene_family="HOG000178241" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056366"
FT                   /orf_name="AFUA_3G03400"
FT                   /product="Siderophore biosynthesis acetylase AceI, putative"
FT                   /protein_id="EAL86622.1"
FT                   /db_xref="HOGENOM:HBG053485"
FT                   /db_xref="HOGENOM:HBG331378"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniParc:UPI0000520340"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF55"
FT                   /transl_table=1
FT                   /translation="MATQSSTELPQINMTTAEPTSANKRTYPWVKLPHPYLTSYAIHVV
FT                   SESTPRVLQLRLHDDQKGQALPEPLHSASLTYTDIAFDEAAQEIPDNDNSPWARSRRAP
FT                   GTSFHWTGQEPPTLGQIWNVIHALFLTYPQHEIVRLDLNGSGKDIIREECLRTGLAVPF
FT                   PSPRVPFGTENRPSETDTLILLRSAFWQGAGSPVGPRPIWAVDHGIHGLLRRSGSSYPP
FT                   LAQNYEFSMKFPSERIYTRHPIRPQKPAPGSLVYSRYIPHLDQHFSLMVVDWQNEEHLQ
FT                   LFHKWQNDPRVAKGWNETGDLEHHRNYLRQLHEDKHVLCLFGRFDDFPFSYFEVYWAKE
FT                   DHYGAHYDAGDYDRGRHSLVGESSVRGAYRVNAWWSSLIHYIFLDEPRTMCVVGEPKAT
FT                   NTTVLSYENAHGLTVQKYVDLGHKRSVHVYCSREKWFQLCPLFWDGRERPLESSDRMAW
FT                   DAKL"
FT   CDS_pept        join(906574..906799,906873..907459)
FT                   /codon_start=1
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264212"
FT                   /orf_name="AFUA_3G03410"
FT                   /product="Enoyl-CoA hydratase/isomerase family protein "
FT                   /EC_number="4.2.1.-"
FT                   /function="isomerase activity"
FT                   /function="lyase activity"
FT                   /protein_id="EAL86623.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG461048"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="UniParc:UPI000051E947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF54"
FT                   /transl_table=1
FT                   /translation="MSTEAHPTVQGCLVSFPTPHILLLTLNRPEKRNCISLATSAEIQR
FT                   LWTWFDTQPALYVAIITGTGESFCAGADLKEWNDLNARGITNEMTAPGLAGLPRRRGSK
FT                   PIIAAVNGYCLGGGFEMVANCDIVVASENATFGLPEVQRGIAAVAGSLPRLVRVLGKQR
FT                   AAEIALSGLSFSASQLERWGLVNRVVEHDQLLATAVEIATAISRNSPDSVRVTMEGLHY
FT                   GWEMASVEEASSALVDQWYAKLMAGENFHEGVRAFVEKRKPQWRPSKL"
FT   CDS_pept        join(908168..908602,908658..914474)
FT                   /codon_start=1
FT                   /gene_family="HOG000178230" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264213"
FT                   /orf_name="AFUA_3G03420"
FT                   /product="Nonribosomal peptide synthase SidD "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /protein_id="EAL86624.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG053486"
FT                   /db_xref="HOGENOM:HBG331377"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000051F7B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF53"
FT                   /transl_table=1
FT                   /translation="MGSIQQDDVHNQIDHCNQSDDLPAARLNCNDVELFEVAGLACDET
FT                   SSPTGMRDEMVLLSWLIALLRTREGGQIRYEWAYRYPEEEPVPRCLAMNEVVAGLQSSV
FT                   KETAAAVSRHISADVSSPPAPASLLLSTSSLSQTSDEAKDEGLLHLEIAFENGLCKIRP
FT                   TWHSENMLPFTVTRYARTLIDTVRLCISNCDAAIQDCLRPTAYDLDEIWRWNHNLPPTY
FT                   NFCMHEIISDQAQKFPDKEAIASWDGSLTYRQIDQYSSFVARSLIGMGVGLHDVLPVCF
FT                   EKSRWTIVAVLAVMKAGATFVLMDPTLPLARLQNMAQQVGAKMMVSSRGQYNLATEIIP
FT                   NANVLVVEENTFSSLSAEQNGEPLPTVPSSALMYMIFTSGSTGTPKGVKISHETYTSSA
FT                   IPRANAVGYTEDSRVLDFASYAFDVSIDSMLLTLGNGGCLCIPSDEDRLNDINGVIRRM
FT                   KVNYAGLTPSVARILDADVISSLSGLGLGGEAVSARDVNLWGQDTRIIIGYGPCECTIG
FT                   CTVNSSAATGRDYISIGPGNGAVIWIVDPNDHESLVPLGAVGELLVEGPIVGQGYLNDP
FT                   EKTAAAFIEDPSWLVAGHEGYPGRRGRLYKTGDLGRYDPDGSGGIVFVGRKDTQVKLRG
FT                   QRVELGEIESQLRARLPSETTVIAEVIVPQGSGGQPTLVAFVAAQTTKGHDHTGLEAAE
FT                   LPDELRRALSEADAELAKVLPRYMVPTAYIPVNHIPTLISGKTDRKRLRQFGATVDLRQ
FT                   LDQDATNTAARELSDLERRLRQAWSQTLKLQACSIRLQDNFFALGGDSLTAMKLVSVCR
FT                   SQGLDLSVTSMFSNPTLSAMASVVRICDVDVQRTVPAFSMITSDMNSACVEAAEPCGVG
FT                   PADIEDIYPCTPTQESLFTFSLKSVKPYVAQRVLCIPSHIDLNAWRKAWEDVVAALPIL
FT                   RTRVAQLQEPGLQQVVLKNSISWTQASDLAEYLENDRTQKMNLGESLARYAIVEDSADG
FT                   KRYMVWTIHHVLYDGWSEPIILKQVSDALQGQPVEVKAQMRDFVRFVRDSDDAAVQEFW
FT                   RRELKGAVGPQFPRLPSRDFMPTPDALVERQVSLDTSSGSPFTMATLIRGAWALVASQY
FT                   TGSDDIVFGETLTGRDIPLPGVESIVGPLIATVPIRVRILRGSTVESYLQAVQQSVLAR
FT                   TPYQHLGMQNIRKVSQDAQHACETGTGLVIQPEPEYVGSELGVERGDVVLEALHFNPYP
FT                   LMLACGIRKGGFRVCASFDSSLIETRQMERMLAQLETACWQLSQGLSRKVDEISCLPEA
FT                   ELNQIWQWNRSPPLSLDETTSRLRANASTKPGSSYPPAVVPWVCSPRNSSLLSPIGCVG
FT                   ELWLEGALLSGDTVDSPAWLVAGSSTCAGRTGKVQATGDMVQLREDGSLVFVGRKENVV
FT                   PVQGHAVDITEIERHLAEHLPPTIRAAATVVRSSSDQELVMFIEQPAAEEACIELLSEK
FT                   REIVCDAPDKAFQTTICATIPGSLAAVLKKLDKYMRDSLPSYMAPSAYIVVEKLPNTMD
FT                   DIDHNLLNQIASQVTPQILNELRDGLSNAWTKATAPNHLSASESILRSAWAKVLRVDPE
FT                   QIDVDDNFFRRGGDSVLAMKLVSSLRAQGYSLSVADIFRHMRLSDAARVMKVDERSTEK
FT                   INSYQPFSMLRLPDVQQFLANIVRPQLGDQHWPIRDVLPVTDSQDMDIRATIQPPRTSI
FT                   QYTMLYFDNSVDRERLFRSCSDLVKTHEILRTVFISHESSFLQVVLNELEIPVRAHKTD
FT                   KQLDQYVASLFREDIESNFQLGCPFLRLFYVEGNNGESCLVIGLSHAQYDGVSLPRLLQ
FT                   DLDALYTGTQLATFSPFSLYMAQTSEEAIQNKAAAYWRNLLSSSSLSTLDGPSSDPTDK
FT                   AIFHTRPVNIHPLKEITTANLLTAAWAMVLARRLQTPDVTFGSVTSGRTLDIPNAENFM
FT                   GPCYQLTPVRVPFHPDWTASDLLNFVQTQSAESAAHDFLGFEKIAKLAGWASGRQGFDS
FT                   IVHHQDWEDFDMMPFGGGSCRVDIANPHGDAAYPVKAVSFVKEGEIHVGVVCSERDVMF
FT                   VDEVLGELAAAVVELAGQSTEVLLDSKLFSGQ"
FT   CDS_pept        join(complement(917663..918596),complement(914602..917615))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207646"
FT                   /orf_name="AFUA_3G03430"
FT                   /product="ABC multidrug transporter SitT "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86625.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000051EDBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF52"
FT                   /transl_table=1
FT                   /translation="MKLVQKLSGYPRLLLAGNPSKIDLGRLLLGIISAVASGVPFPLIG
FT                   ILFGQLLDDFNAVTCGESESSDSDSDYQHDINGKILIIVYLAIAQFVLIYVHLSCWSLN
FT                   GARLAQRLRETYLQNVLRQEPSYFDKLPPGEIASRLNGDIQAIRSGTSEKVGICLSSLS
FT                   FFITAYIVAFIKDAKLAGMLVSLIPAYFLMSFVGSHYIEKYTGRMSDYAASAASIASEA
FT                   LSNTVVVQAFGANARLEEKFSKALKAAETEGLKKATAVGIQSGVLYFIAYSANGLAFWQ
FT                   GSRSIADSVSGNTHGATVGATFTVIFILVEATLLLSQVAPFLHLFVAAVASFQKLREDI
FT                   DREPLIDSTSGSGLRLTQAEGGFEFKDVSFTYPSRPEITVLDNISLSIPANKHTAIVGL
FT                   SGSGKSTIAGLVTRLYDPTQGQVLFDGHDLRDVNPRDLRSFMSLVQQEPSLLDRSLLEN
FT                   IAHGLINSNHPSHAHLKATLLSTDLADLASEVRGGKDLTAAAEARGPNVAEIVGLVTKA
FT                   ASLADADGFISVLQHGYGTVVGSSGRLISGGQKQRVALARALVKDPAVLILDEATASLD
FT                   SRSEQRIQRAISNIASGRTIITIAHRLSTITSADNIIVMHKGHIVEQGNHATLMAKNGT
FT                   YAELVKLQTLASKDETTINIDAASKSDQTSSSEADIEKSAILLDDFGDAEKIPVSTTAA
FT                   PVADAAEEAEEPETPKKSLWALAKGYAPALRPHLLFIFLALLGSSVVGGAFSGEAVIFG
FT                   NTVGSLNPCHSADSIRSRGNFFGLMFFILAIIEFFANVVSWSGFGWVSEKIVYAVRVLS
FT                   FRSLFEQDLQWHQSEGRTPALLLSYITRDGNALAGLSGSVIGTLFSISVNLIAAIILTH
FT                   IIAWRIALVCLALVPLLLGAGLMELHVLGKFEERHENAYTKSVDIGVEAITSIKTIASL
FT                   SLEEETLRTYRRSLKGPRKETFKVTMHASLWQAMTYFLGNLVNALAYWWGAKQIIAGNY
FT                   TQTQFLIVVFSLLVSALLWSQMFALAPELSSARAAMARILSLIEIGSDKMQGHVRSPPT
FT                   NDSNDPEATAEPKPIASNHEASSVQLRDVHFAYPARPDIKVLNGLSIDIRPGQFCALVG
FT                   PSGAGKSTIISLVERLYTPESGAILVDGVDITKHRDVSFRDTMALVPQESVLFEGSIAF
FT                   NVGLGARPDHEATMDEIVEACKLANIHDVIESLPDGYQTLCGPNGSQFSGGQKQRLSIA
FT                   RALVRKPKLLILDESTSALDAESEKLLQDGLERAAKGITVIAIAHRLHTIRKADVIFLI
FT                   EGGKCVDRGTHEELLQRSESYRANVMHQTVA"
FT   CDS_pept        join(919374..919627,919686..919956,920007..920349,
FT                   920398..921326)
FT                   /codon_start=1
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264214"
FT                   /orf_name="AFUA_3G03440"
FT                   /product="MFS siderophore iron transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86626.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053487"
FT                   /db_xref="HOGENOM:HBG324157"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF51"
FT                   /transl_table=1
FT                   /translation="MLSSWQKKFFQTPEHPPAEGIAPPRDDGVPNPEPVTYPDTKYPSD
FT                   VVNHDAGEMLPNEEAQDGVTQAEAITLTWSKISLGAAYFLMWLLYLVNGFQASITGNLS
FT                   AYVTSGFESHSLIPVISIVSSVMSAATYMPLAKVLNLWDRSIGFIIMVAFATLGLILSA
FT                   TCHDIGTYCAAQVFYSIGFAGIIFSVDVITADTSTLRDRGLAYAFTSSPYIITAFGGPA
FT                   AAEHFYDSNWRWAYGCFSIVLPVVALPMFCLLRWNRHKAKKSGLLKDKADSGRTWMESI
FT                   RHYIIEFDILGVFFLAAGLVLFLLPFSIAGSTEDDWKSASIITMLVIGFVCLLVFALVE
FT                   RFVAPVPFLPWALLASRTVLGACMLDVCYQIAYYCWFNYYTSYLQVVYGTSITTAGYIT
FT                   SIFDVVSGVWLFIVGFLIKKTNRFRWLLFIAVPLYILGVGLMIYFRKPSWSVGYMIMCQ
FT                   IFIAFAGGTMIICQQVAVLAASDHDHAASSLAFLNVFGTMGSAVGSSISGAIWTHTLPG
FT                   ALQRLLPDSVKADWQTIYDSLEEQLSYERGTLIRQAIALAYASTQSKMLIAGTAIMALS
FT                   LVWMFVIRDIKLTKTQTKGVLF"
FT   CDS_pept        join(complement(922586..922930),complement(922147..922533))
FT                   /codon_start=1
FT                   /gene_family="HOG000217762" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903096"
FT                   /orf_name="AFUA_3G03445"
FT                   /product="Short-chain alcohol dehydrogenase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EBA27282.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51C94"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9X9"
FT                   /transl_table=1
FT                   /translation="MSNKTLLLVGSGPGIGVAVASLFAQRYFDNVALFARNPVQLEKDR
FT                   ETILASAASVNCIVTVQTWPVDISDLHRLEKALGEVARFGDLECVYFNAARVGPSPFFE
FT                   FPISGIEEDFKVSNIALYAAAKWAMPLLRAKAASGTDCRPSFLVTSSLLPVDPIPELFS
FT                   LSLVKAAQANLVKSLEKVFTPEGVHVGLVVVGGAVSPSAPALNPRNIAEHAWNLFAQKR
FT                   EDWTGQVTIREEKMVDWEPSI"
FT   CDS_pept        join(complement(924821..925123),complement(923525..924772))
FT                   /codon_start=1
FT                   /gene_family="HOG000158948" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207647"
FT                   /orf_name="AFUA_3G03450"
FT                   /product="Cytochrome P450 oxidoreductase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86627.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053488"
FT                   /db_xref="HOGENOM:HBG324159"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000F51CAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF50"
FT                   /transl_table=1
FT                   /translation="MEVSILSLFKAYAAYVTVAVVLLRLITNRFRRGLAGIPGPTIAKW
FT                   TRLWKLHSVWKGNHHTTAIDLHRKYGPLVRIGPKHVSVGDPSAIPIIYGLNKGFTKTGF
FT                   YPIQCISWNKRPQMNLFSTRDEMFHREQKRPVANAYSMTSLLELEPAVDSCTEIFINQL
FT                   ARFANSKKPVDLGMWLQYYAFDVVGEFTFAKKLGFLQEGKDVDGMIEAIQGMLVYASVC
FT                   GQIPEAHPLLLGNPLFPIFMPSMETWNQVLNFTLKAINSRASLQRDGELDAEKPEAGKD
FT                   MLSRWMAIHLSDPEKLTTRDVIVHLSTNVFAGSDTTAIALRAVFYFLLRNPSVLAKLNA
FT                   EIDNADREGKLSTPISYRETMNHLPYLQAVLKESMRLHPSVGLILEREVPKGGVTICDR
FT                   HFPGGTIVGINAWVLHRDARVFPDPDKFIPERWIDSDPQHLKKMDQSFFAFGAGSRTCI
FT                   GKNISLIEMHKIIPQLLREFEIRLHSPEKEWKTKNVWFVQQEGLVCDLVCRRDAKCYH"
FT   CDS_pept        927326..928000
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056367"
FT                   /orf_name="AFUA_3G03460"
FT                   /product="HAD superfamily hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86628.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051F2CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF49"
FT                   /transl_table=1
FT                   /translation="MGVPDSTNSDLFHNWAKLPISREQFARELREEVHRQFQTCTPLPG
FT                   AEKLLSNLNSARSTCSGERIELALASSTKTHTFDLKMSRPETKKLLNIIPSERRVLGDD
FT                   PRVGQGRGKPAPDIYLVLWQALNSTADSGKPILPSECLVFEDSVAGVEAGRRAGMRVIW
FT                   VPHPDLAVEYEKRQREVLAGRTGMIEIGDEWQLGEIDDGWAESIPSLNFFDYEKYGIVA
FT                   PS"
FT   CDS_pept        join(complement(930399..930503),complement(929861..930310))
FT                   /codon_start=1
FT                   /gene_family="HOG000048432" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264215"
FT                   /orf_name="AFUA_3G03470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86629.2"
FT                   /db_xref="HOGENOM:HBG053489"
FT                   /db_xref="UniParc:UPI0000F51C9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF48"
FT                   /transl_table=1
FT                   /translation="MPDTVDPLADTAFYLLLSGVIIFNSLNHFVIRKESWFQISLNGTS
FT                   LNTRDVAEIAERTPITVCERTVIAVGGCVGIASYVVTFARSIATTIKDLSNGGNCNAMH
FT                   GTFEGLKWTYYSTGRNCDTTAQHDTIAGAIKKYLNNVEHNDICGTQCLRMDHGGTWDGW
FT                   LKLAPVGSFNEICLLWSLFVR"
FT   CDS_pept        join(complement(933309..933890),complement(933172..933230),
FT                   complement(932359..933061))
FT                   /codon_start=1
FT                   /gene_family="HOG000217406" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207648"
FT                   /orf_name="AFUA_3G03480"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86630.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052839"
FT                   /db_xref="HOGENOM:HBG324161"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000F51C83"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF47"
FT                   /transl_table=1
FT                   /translation="MLGMMLLLGLLARLFFRFVIWAIFVYLRDPKGLRKYPLMHPLSGI
FT                   SDIPFMLESMRGFRSATLLQLHYGQGHPVIRLGPNALSFAGGQAIPAIYGHNTPATKDR
FT                   QYLNAAGSHFHLADVVDKKEHARKRKVLASAFAAKHLEDWEYKVADKVQRLMQRFDQHL
FT                   AQMPDDPLDYRSWTNLFTIDSLCDTLIVAPTWGILSGHMNGIMWSLGYCSVDIFAALME
FT                   DPAGNPQDLEWGEVLAEISLAISGSSSTSNSIASTMQLLIEHPEKMRKLQEEVDSVMAT
FT                   QLEDSPDGDTPTVASYDQIKSLPYLRAVIDESLRLYPPISHGLPRETPKEGMMIMDQWV
FT                   PGNTTVSVSAYVAHRDPAVFDQPESFVPERWLGEQGRALQTRFIAFSAGARGCIGRPIS
FT                   YLQASILLANLVHQYDFEMWDPKWKPSRRETMNLIMGPMPVRIQKRST"
FT   CDS_pept        join(934429..934524,934577..935209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264216"
FT                   /orf_name="AFUA_3G03490"
FT                   /product="O-methyltransferase, putative "
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="EAL86631.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG053490"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="UniParc:UPI00005207F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF46"
FT                   /transl_table=1
FT                   /translation="MALITNGGPHDVSHVVSGFAWGDLGEDAVVIDVGGADGFVGIALA
FT                   QAYANLTVFVQDSINLKKEADAKIPPALKSRVFFQPHSFFEPQSRLAGMADVLLLRHIL
FT                   HDWDDNDCLVILRHLAAVLQPGASIIVAEQVLGQSGTYDWQTERVMRALDMQVMTPFGS
FT                   KERTFDDWETLFPGGRSDIASGRNGSACGKCGHTDGVEESCLIRFILRICLVTSMLFIP
FT                   FRRKTVSLENSDLLSIPTSN"
FT   CDS_pept        join(936148..937064,937167..937400,937462..937897)
FT                   /codon_start=1
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207649"
FT                   /orf_name="AFUA_3G03500"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86632.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176437"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F04F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF45"
FT                   /transl_table=1
FT                   /translation="MLAMAASAEETNRQSNAGRRSVISPSEAPPEAEQSDVYQAPPPGL
FT                   KEWLFILILCSTQLFVQGAFGYILIPLHIVGQTFGQGPSEATRMTWHVGGYSLTVGTFI
FT                   LIAGKLGDLYGSKRILVLGWAWFGVWSVIGGCSAFTHSPVFFDTARALQGIGPALLLPN
FT                   ALAIAGRTYPPGKKKNMIFSAFAVAAPLGCFTAGVVGSVFAQYVWWPWVMWTYSIGCFI
FT                   IAAVGLWVIPSDYPRCQKAATLQFDYIGSVLGVAGLLLLNISWNQAPIDGWSTPYVYVL
FT                   LIGGFLVLGLFELQERRAPGIRSWINFAMCLLWIQQCSSRQGPSQGILPALATPYLMAV
FT                   ITSGWLMAIACAAFLGGCILQSTAPVEQSYWMNTFWSFVIMAWGMDISFPASTTILSDA
FT                   VPVKHQGASASLVNTVINYSIAIGLGIAGTVEAEVSHQGVNQLRGYRAALWSSVGLAAL
FT                   AFGIALVFAVCTFQEQRSSRKSSQEREQRACIEGCILGLTLTPDREWERVELGRLLSHV
FT                   SQTGGLRSQSV"
FT   CDS_pept        join(938213..938249,938260..939266)
FT                   /codon_start=1
FT                   /gene_family="HOG000225393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207650"
FT                   /orf_name="AFUA_3G03510"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase, putative "
FT                   /EC_number="4.2.1.-"
FT                   /function="lyase activity"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL86633.2"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG053492"
FT                   /db_xref="HOGENOM:HBG333932"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniParc:UPI0000F51CA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF44"
FT                   /transl_table=1
FT                   /translation="MPCRPAISSMSLVRTICQKKLQQAAHQGFKGIEFFYEDLETFAAQ
FT                   SSGGASRLNILKGALRIRHLCTSLQLEIIALQPFWFYEGVLDEAEHNRLIDDKLRFWFE
FT                   ICHILHTDMILIPSNFLPPDPETGEPRTTGNRRVIVSDLRQAADLGLAQSPPIRFSYEA
FT                   LAWGNHVDTWEQSWDIVRRVDRPNFGLCLDTFNIAARVYADPASASGMTYNGAKELQRS
FT                   LARLRQTVDPKRVFLFQVVDGERLKAPLVMGHEWYVAEQPSRMSWSRNARLFAFEEGGY
FT                   LPVKDIARTVFALGYGGWVSMELFSRTTFDPDPNTPYGHAQRGIASWKTLVTEMQGEMV
FT                   CAKADSV"
FT   CDS_pept        942883..944223
FT                   /codon_start=1
FT                   /gene_family="HOG000171333" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056368"
FT                   /orf_name="AFUA_3G03520"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86634.1"
FT                   /db_xref="HOGENOM:HBG053493"
FT                   /db_xref="UniParc:UPI000051F7A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF43"
FT                   /transl_table=1
FT                   /translation="MASTSASDPELKASTSISLPTSTTTTAPTITLTLKKERLRLSSSI
FT                   SQYKNNLLAGVGYLELANAGDFAANVWNEVPVPTHAKICMGIFGPIALLMTVFAAWDFA
FT                   RSYANVLRLLSERRALSSSQHVPTARSEKREKEREGILGVNTRELLTELMDRIFMDILL
FT                   GAGALLVGTGTIMAIFGDDRKVFEASNLLSGFVGNAPAAVYGVANAVSSVYLVWRLEQR
FT                   VRAVAGAAGHALLGARERRRMTARYRMLQCHGALNGLNGLVAGMASMVTAKMWWGYVVL
FT                   VPCVGVVIASNWFWRVRLGYDRLLCTQDGAEKEDGEGREVASELAKTIDLQGKLPELMD
FT                   GGTLESLMDFIVQNDMFDVFCEWLLGRWKDHRLFNVDVSTPGIQISPKDLMASLAREQT
FT                   RLLDECRHFLQGDGMRILEYRERYLLELLGEIIWTDHSHRRNWLASP"
FT   CDS_pept        join(complement(945979..946095),complement(945786..945938),
FT                   complement(945409..945729))
FT                   /codon_start=1
FT                   /gene_family="HOG000048431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264217"
FT                   /orf_name="AFUA_3G03530"
FT                   /product="Nitroreductase family protein "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86635.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053494"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniParc:UPI000051EDCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF42"
FT                   /transl_table=1
FT                   /translation="MSSVTAEQWLEAAAYRRTVYGLAGTSKVSDKRVEEIVSKPVRVSL
FT                   AFGAKHKELWSIIIKVAEPVLTSMNPDLWARFGPILEAHKAAYGSVLFWECGETIKESS
FT                   EKHKHVAHKLGEWSDVSQGMHQILVWTALGLEGVGANLQHTNSIPPIEAAIKKFAGVPE
FT                   HYTLKAHLNYGDKQADHPEKPAKLPMGEILMIL"
FT   CDS_pept        join(947249..947388,947479..947773,947844..948302,
FT                   948334..949330,949377..949912)
FT                   /codon_start=1
FT                   /gene_family="HOG000048430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751053"
FT                   /orf_name="AFUA_3G03540"
FT                   /product="PKS-like enzyme, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="phosphopantetheine binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86636.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053495"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI000052080E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF41"
FT                   /transl_table=1
FT                   /translation="MGLRALAQLGLLAALSKVSTPVDKFKRLDHQGRDIGDTMFFTYFQ
FT                   PRDLLQVLWESLPAEAQSKTHAQKKVSDIKTTETGVVVSCTDGTSYEGSMVIGADGAYS
FT                   VVRKHIQLMALREQPAAKEERPFLTTYRAFWMLMPLIPGLKEGVVKNWSWGGHHAGQTL
FT                   GRDGDLYATAGSQEKRDLLTREYGIPAERIFSSRDASFAPAVLAATEGRGVDVMLNSLP
FT                   GPLLQASLSVIAPLGHLIEFGKKEIETNSLVALECFSRGISLASLDVPTLLRRRGPDIH
FT                   RILGEVTRLVDQRALKPHVQDAFRFLQTGAHMGKVVLPAGPEEVVPVVPRPKGITPRPR
FT                   LRSDASYLVVGGVGGIGRSIAHWLVDHGAQNLILLSRSAGDLDLAQNQNAEGALFVREL
FT                   RAAGCRVKPVSCDIALASSLAKALRACEDEGLPPVRGVIQGAMLLRDAIFEQMTLADWK
FT                   SGLAPKLNGSWNLHTEFSTRGGLDFFVMLSSVSGVIGIASQTNYAAGGSYEDALARWRQ
FT                   ARGLPGVSIDLGPISDIGYVSQEAKVAERLRKDGDFAMLDEEIVLRALNAAVLYPLGTS
FT                   SRPQLVVGLNSEPGPQWDPAGGSQLGRDARFLHLRPRRKASPHGKAADGGADSSKAASL
FT                   IGAAIASKLADIMAPVTEIDLSKPPAHFGVDSLIAVELRNMLVLQAAADISIFNLLQTP
FT                   SLAALAASVAEKSRHVNAAAYTHVLGPGCILTRFLSSYEPMLGRDEEAEYPGMAQARRK
FT                   EQFNCGAGHSTYFCALCFILFLIGFILGVEGSSTLDRSEFNRPHCSSMDNSIKYR"
FT   CDS_pept        join(complement(950978..951016),complement(950347..950919))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751054"
FT                   /orf_name="AFUA_3G03550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86637.1"
FT                   /db_xref="HOGENOM:HBG053496"
FT                   /db_xref="UniParc:UPI000051E943"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF40"
FT                   /transl_table=1
FT                   /translation="MVDGLHLFFDERMIRTRLPAPKANFASGRPTETSFLPDMIRVIDL
FT                   DWPETELSPLKETVIVATICGQVLEHKQRPPSRTRDSTATTYDFCRRHRSLNALLAQRI
FT                   KMLRLHASFEHLNPVFTLTALATYIAVLTLYNGIQSQPLGTEAQAMQLTKALHSEHQQQ
FT                   SLDAVADVALLVTALGQHFQVKHPRPYDPCCAPCEPTRTK"
FT   CDS_pept        complement(954740..956482)
FT                   /codon_start=1
FT                   /gene_family="HOG000276710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264218"
FT                   /orf_name="AFUA_3G03560"
FT                   /product="Pyridine nucleotide-disulfide oxidoreductase,
FT                   putative"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL86638.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG489192"
FT                   /db_xref="HOGENOM:HBG535576"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000051F050"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF39"
FT                   /transl_table=1
FT                   /translation="MSADSSSPLVVKEPKDGGMPTEGEKLRLVIIGGARGGMSAAVRAR
FT                   RLNENASIIVIERGSYISYTNCFAPFSLGGAIERDTWIAVQTPAGLKARFNVDVRVCTE
FT                   LVSISRERHSITVRCRKTDTTYDLPYDKMILAQGADPAGRPMADIEKDKVFPLQTPADL
FT                   QAIRSFVVKNDCREVVILGGAFTGLKAVESLHSFGLHVRVVEAGDRLCPEFDPDFATII
FT                   QKELVKRGVGIHLGRGECQTIAETEDSDRCRIEFHDGSSLSADLVVVATEPEPRVQHAK
FT                   NAGLTVRKGIVVNAFMQTSDPDIYAVGSVAEVVNSISHMPQVSSSMSGASNRQGRLAAD
FT                   HIFTRATAYPGTAGTHVYHVFHLTAAITGLSVSELRQIGYDPQSVTIHQPDHAGYFPSA
FT                   QQLTLRVAFERASGVLLGAQIIGHSGVDGRIDVLATAMQAGMTVFDLEHLELSYMPQYG
FT                   SVRDPVNLAGSVGSNLLRGDLHIVHPQDLQDHLHEWPIIDVRSAEHFAQGHLPLARNIP
FT                   IDTLRSRLAEIGKDRPVLVYSRVGYHGYLAYRNLVQSGYRAANLDGGLKLFTDGGYQPE
FT                   LTVD"
FT   CDS_pept        join(957422..957972,958021..959086)
FT                   /codon_start=1
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264219"
FT                   /orf_name="AFUA_3G03570"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /protein_id="EAL86639.1"
FT                   /db_xref="HOGENOM:HBG095770"
FT                   /db_xref="HOGENOM:HBG325023"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI000051FA25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF38"
FT                   /transl_table=1
FT                   /translation="MAEASNGQRRDPSKVQAWLVGSGMACLAAAVHLIREGNLPGKNVH
FT                   ILDLHLGFGGEMGTSGDAQNGYFVPFECHPYFHGDCIKDLLSIVPSPGEPGKSMMDDIY
FT                   SLEKNERRPPQDSGMTRAIKLGKLGPEVVHFRGIQVGLKHRLELMKFILESETSLGAKS
FT                   INQIFEPSFFETGFWTRWSTAFAFQPWHSAVEFRRHLRKYLEDIQALNDVKGAYRTKYN
FT                   LFDSITLPLADFLKGEGVDFRFNVDVTDLLLYPESDPTTVSEIKLIKEGDECLITLDPE
FT                   DICIVDPGYSRSGADFGTDTAPPPFLTSNWEDLMMKEWKLWQKLSDKSPKFGNPSNFLS
FT                   RALESGVETFTTTLWGPQFMNLYEKLTHDQPRTDALLSLTESKWSITLSIPHQPILPGQ
FT                   PPDAHIVCGYALSPWNEGDFVKKPMFACSGKEIFTEVLSHLGFPVQSILDAATTIPCGL
FT                   SLGTAPFLTRGNRDRPHVIPPYTTNIACVGQFAELPEDTTLSMEYSVRSAQMAVYQLMD
FT                   LQKKPAKLKKNILLELFDLLI"
FT   CDS_pept        join(complement(959758..960918),complement(959392..959709))
FT                   /codon_start=1
FT                   /gene_family="HOG000217765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751055"
FT                   /orf_name="AFUA_3G03580"
FT                   /product="Transferase family protein "
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="EAL86640.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG053497"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000051F54C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF37"
FT                   /transl_table=1
FT                   /translation="MEVYKTRLSPHVLPSSPISTPLSILDATVARFAPAGAIWLWDRFS
FT                   GNLPETDFIDCLQSLFVQTLSDYPQWAGQLQWAPVREGGNHTERFNRPMIVYGAPDDPA
FT                   DEWRVVKRDGISVGTLVPSAMERISAGAWDGANFPQRDFLSEPPLALHDLREYQGSPSM
FT                   QVQITLLKSGAFAIGIRMAHVLADAQTLMVFVHQWAATSRATFGSHNSKSLMDAPVFNP
FT                   ALLGAHAAGDVDGPAPDRGLVATARELPLHRFDWWKTDDPGYPKVLVPNTLNSMPSCEQ
FT                   LDSVELSPSTSAPWTSWDLSRRIRYTQIHSSGNQLADLKRTALAQSQEDISRLDALLAH
FT                   LWISINRARNLTNCPDSVFLDLSIGTRTRLSPPLPDTFLGSPLFLTHPLFTSEKIGAML
FT                   HDDAYEISPQRLWQAFLGSRHVLVTSWLRLKVYKIDFVGDGNRPRYVHAVLPKLDGEVQ
FT                   VMESGVDVNGVDVAVYLEEEVMERILAEQRQITV"
FT   CDS_pept        complement(961701..963569)
FT                   /codon_start=1
FT                   /gene_family="HOG000217766" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264220"
FT                   /orf_name="AFUA_3G03590"
FT                   /product="F-box and ankyrin domain protein "
FT                   /protein_id="EAL86641.1"
FT                   /db_xref="HOGENOM:HBG053498"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F2DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF36"
FT                   /transl_table=1
FT                   /translation="MSLLNLPLDVLYEIASHVDSDRDLNALVQTCSPLYTVFNFELYRR
FT                   DAKRGRNRALFWAVQGNRTGTLWKSLDTGASAPWPTLFSMAAEHDSVLAMKVLLLQDGA
FT                   DTNAVEHTEGIPLLVTAVVNRSPKVVRFLLTRDGVDPNVKNHDGQTPLAYAACECFNDI
FT                   VKILLKCPQVDVNCTDNAGCTPLRLAAGRSHVFVVRTLLSNPWVDVSVRDNILHMTALS
FT                   AAVAALANRIAWSPEKVKLKHRRTIQALLEHPATSVNYDMDPDLLPLYRFSAQYGYEEI
FT                   FKLLWSKGAGQLPAELDRSGILFFVAEHGQAGIMKMLFANGFEPEAQTDTGRTTLSIAA
FT                   EHKQLEVICLLLSTGKVDVNSKDQAGRTPLWWAMTHGWRKTGTDETLKLLIAHDATIPT
FT                   IERRKWLQKSLCNALEYGNCFLSEILLDQSQPISSNQRQTLLSAVAKSADVSLAKTVLE
FT                   RAQIDPNDRDSDGLTVLDRAVLNGDIALMDLLLVLDGIDLNSRNSNGDTALAIAMNEVI
FT                   DSLTISLGLKDRRPFETCMERFLRHKDVTTGTLDEYWLIGFIVGYIDVIDQQLMKLLIL
FT                   KDDRLTTDTIVREDYAETLLDWAQQNHHRIIVRALRDKEKRMRMTI"
FT   CDS_pept        complement(964392..965315)
FT                   /codon_start=1
FT                   /gene_family="HOG000168653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751056"
FT                   /orf_name="AFUA_3G03600"
FT                   /product="Carboxylesterase, putative "
FT                   /protein_id="EAL86642.1"
FT                   /db_xref="HOGENOM:HBG053211"
FT                   /db_xref="HOGENOM:HBG735455"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI00005207F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF35"
FT                   /transl_table=1
FT                   /translation="MGSLSTFLRYLRLKLLISFYQLIVKILASPPRPRPDSILRIPSRD
FT                   KGRTINAHLYKPSSEYARSSGPRPVLLNFYGSGFAIPLHGADDGFCRFIATTTGYIVLD
FT                   VEYRLAPEHPFPAAVHDVEDAVKYVLDRPEEYKTSQVSVSGFSSGGTLALVGPTLFPPG
FT                   TFQSVVAFYPATDLARDPSLRTAPAPNAKPRSAFWTRIFREAYIGTMDPRDPRISPAYA
FT                   DASMYPTNMLVITAELDSSALEAEDLAKKAEMEGTASGRNVVIRRMKNCGHAFDKKKTD
FT                   MTCVQARDETYELVGDMLRKVAGESG"
FT   CDS_pept        join(complement(969608..969866),complement(969500..969555),
FT                   complement(969019..969437),complement(968691..968961))
FT                   /codon_start=1
FT                   /gene_family="HOG000178208" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056369"
FT                   /orf_name="AFUA_3G03610"
FT                   /product="Putative uncharacterized protein "
FT                   /function="cellulase activity"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="EAL86643.2"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="HOGENOM:HBG053500"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="UniParc:UPI0000F51CA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF34"
FT                   /transl_table=1
FT                   /translation="MVLRWVVNAGLLAIPIGGTVGALMGIDAHRQATGQAPLFSGGGSG
FT                   SGSGSAPPGGDGSTTHNGVTNTMYCQKSYGIAPETKGQSFTLNPNQWGVTADTVGALCM
FT                   NVTTFDNGTYATKNTAPEFSVTWQFNPGPATQPVHAFSNVMIDDGLPISLEKIQHLNVD
FT                   FHWTYGVGNTPAEATNEAELTAASVNTNVAIDMFMSQEEKVKDSADYTHEVMVWFAKFG
FT                   PAAYVIGQDDGIVATKEVNGTIFNLYSGQNGKNQRVLTWLASDSRTDPQAKGKTTESFT
FT                   GDLLPLITDLYSMTGEAYPSKSDYMGIFQFGTEAFSSSTNVTFWAPKFSVDLR"
FT   CDS_pept        join(971143..971332,971433..972172,972235..973488)
FT                   /codon_start=1
FT                   /gene_family="HOG000178197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265195"
FT                   /orf_name="AFUA_3G03620"
FT                   /product="Glycosyl transferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL86644.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG053501"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000051E934"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF33"
FT                   /transl_table=1
FT                   /translation="MNGHYGQEDQEEKFGLSVHRRGHNNHSSFDSLDQLPPGAQTPIRA
FT                   GEIPLEDYASPGYHFATALKYLGHQYQHNQLLQSHQSLAPLVNASPSPLFAKDWVQSGS
FT                   IARIHKRDDADIWRGWKRWVFSLVPFLTLANTGLYLFYLGLRIACIILAQNAAGYTYAG
FT                   AWVFVAIEIAVAIPSLMHNCWTMMALKKRGRPKLRLTGNDVPTVDVFVTCCGEDDEVVL
FT                   DTVRGACDQDYPRDRFRVIVLDDAKSATLEASVRQLAITHPNLIYMAREKIPGKPHHFK
FT                   AGNLNYGLEQVHHLPGGAGQFMAALDADMIPEQDWLRAVLPHLLVDPKMALACPPQLFY
FT                   NTPPSDPLAQSLDFFVHVIEPIKDAMGVAWCTGSGYVVRREALDEIGNFPLGSLAEDVA
FT                   TSTLMLGKGWKTAYIHEPLQFGTVPEDFGGHLKQRTRWAIGTVDTAVKLKFCLWGDAVR
FT                   QMTVAQRFSGFLYATLSLYTLLLTASIFAIPIILLWGKQLVAYATQEQLRWLIWACFAS
FT                   TISNRICEFALFIPAGYHTGQRGSRYQLWMAPYIALCIVRSFILPRWLGGQAQAFKPTG
FT                   SLSSALEERDPKRRKNMLVRLRVILLNYMAFFHLAFVYVTLVAVVISSYRCFAQEKTFQ
FT                   DVILCLITHAFWPPLTFLFICTSLWTPVAYAVDPPAMPDREDLLVRDPKTGVAHPTARS
FT                   KKIAFGGQAAWFELEYTVATAATILVFVYSFFF"
FT   CDS_pept        join(977808..978445,978529..979033)
FT                   /codon_start=1
FT                   /gene_family="HOG000178151" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265196"
FT                   /orf_name="AFUA_3G03630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86645.1"
FT                   /db_xref="HOGENOM:HBG053502"
FT                   /db_xref="UniParc:UPI000051FECE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF32"
FT                   /transl_table=1
FT                   /translation="MTFQFLQRFRSKDKERDNGKGKARPKDQPDEDPSQSDPRTVLAQV
FT                   GIYHETCKQNGNCRDFRSMPLPPPRRPLTPPDYELAAIRGRSNTLTAINTSTTNFLDLT
FT                   KSTTLPQDQSLLFSRLPKEIRQRIYIELFGNRSVHLEYDFGYAPGYRQRDKRPPDQWRW
FT                   WHRVCDDEEHPNPGDLCRMNDLEDPKRIGRRQLSRHKLKGVAWLRVCRRATNTFLISSS
FT                   VKLCRLPKLIAPSHLSRIASLDILHVAKTTTPSTMADNEWETYHTLFRTLRLAYVGVRR
FT                   LRVVIHILNKSCTPRAGTVPEELDEAWIRPWSELASSRQWEKLEIGLQDSWFDDFSAAG
FT                   RRWEARNGRQLEDSGYSLARVDDFTTWDGRLSEIWNAVYL"
FT   tRNA            complement(979210..979297)
FT                   /gene_name="tRNA-Asp"
FT   rRNA            complement(979980..980095)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(983593..983882),complement(983223..983493),
FT                   complement(982816..983161),complement(981804..982735))
FT                   /codon_start=1
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056617"
FT                   /orf_name="AFUA_3G03640"
FT                   /product="MFS siderochrome iron transporter MirB "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86646.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053487"
FT                   /db_xref="HOGENOM:HBG324157"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E6F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF31"
FT                   /transl_table=1
FT                   /translation="MLHVLSVGPSHAAFTVEAAMATMKKFHSIVGEKPAQDAEAPSVDD
FT                   PNVGQIRADDKEAAHAPANAETNNEEANPSDGAQAGVKKIEAVTLSWTRGTAIWFLTLV
FT                   NDFRLSMYTSLNAYATSSFLGHSLLTVINIVSYVMGGSVYIPMAKALDLWGRAEGFLLM
FT                   TFFCILGLILLASSQNLPTYCAGQVFYKVGFGGLSYTWNVLAADVTNLRNRGLAFAFTS
FT                   SPALISAFAGSKAASDLLAHSTWRWGFGMWAIILPVVALPIYGLLAYHLRQAEKKGVLV
FT                   KETRDWSITPKTVWWAIMEFDLPGVLLFAGGFVIFLLPFTLAATAPHGYQTDYIIAMIT
FT                   LGLALIIAFGFYEMLVAPVPFLNYKFLIDRTVLGACLLDMTYQVSYYCYASYLPSFLQV
FT                   VYELDVATAGYVTNTFSVVSFVFLFFAGWLIRWTGRFKWILWVCVPLYIFGLGLMIHFR
FT                   QPGGYIGYIVMCEIFFSVAGSVFILCVQLAVLASVDHQHVAAVLALLFVMGSIGGSIGS
FT                   AICGAIWTSTFLSRLERNLPASAMPDLSLIYSSLPTQLSYPVGSATRTAIVEAYGYAQA
FT                   RMLIAGTAFMVLGFIWVGMMRNLNVKNMTQTKGNVV"
FT   CDS_pept        complement(984524..985231)
FT                   /codon_start=1
FT                   /gene_family="HOG000078535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903352"
FT                   /orf_name="AFUA_3G03650"
FT                   /product="GNAT family acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL86647.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG053503"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051F05B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF30"
FT                   /transl_table=1
FT                   /translation="MTIKAQPTLHTARLELVPLGHEHREFTMKLDMDPEVMKMVAFGRP
FT                   FTEDEAIQVHTWLMNCATSVPGFGTWVGFAEGEFVGWWVLAPVPTTENPKSFRTDRTEY
FT                   GFRVSPKFWGQGYAKEGAREMVRYAFEELGLAEVIGETMTINMASRAVMAGCGLTHVET
FT                   FFNKYDTPPPGIEEGEVRYSITREEWLRMQKPSMTRSRWFPAFASWLPRLLLSRLWSYI
FT                   FQGRRLAAGAASP"
FT   CDS_pept        join(complement(987491..987636),complement(986694..987426))
FT                   /codon_start=1
FT                   /gene_family="HOG000095657" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751289"
FT                   /orf_name="AFUA_3G03660"
FT                   /product="Siderophore esterase IroE-like, putative "
FT                   /protein_id="EAL86648.1"
FT                   /db_xref="HOGENOM:HBG053504"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="UniParc:UPI000051FA26"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF29"
FT                   /transl_table=1
FT                   /translation="MGDRPTPVPLPNSEQFYLENDRGEPYLIQVSWPLHWEDKQTGRGP
FT                   LPIIYIVDGNALFLTATEAAWRRAAASHFAGGGIIVAIGYPLKGKLYDARRRSFDLTPP
FT                   TACAPVGYGGADVFLDFIENSVRPAVQARFPQVSLAREALYGHSYGGLLALHALFTRPQ
FT                   SFDCYIASSPSIWWNSLCILHEAKAFVETKKVSHDQSPSLMVSWGSWEQHPPRWADELL
FT                   DHYEARKRTAAELRMADNALDLCAMLHGCSRLHALIKTEYEGEDHTSVMSCSVSRGLTM
FT                   FFEDWPFHQSG"
FT   CDS_pept        join(988358..988411,988487..989408,989470..992438)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265197"
FT                   /orf_name="AFUA_3G03670"
FT                   /product="ABC multidrug transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86649.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000052057B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF28"
FT                   /transl_table=1
FT                   /translation="MAATSEASTEVKASAKPSIWRRATSFGRLLFYAVPSSTDLIILLV
FT                   GFLAAVASGVPFPIMSIVFGQLVNGLNSATCDVDPSTAASYQAGINSKILLIVYVGIAY
FT                   FALIYIHTLCWNIFSERLAQRIRERYFSAILRQDTTFFDNRPAGEVSARITDEIAVVQQ
FT                   GTNEKVGIVISSVSFFVAAYVVAFIKDPKLAGMLVSLTPAYLTMALGGGYLVQKYVGRS
FT                   IEAMAMASSAALEAISNPLVVHAFSANARLEQRFVEVLAPALSAGVWKSVAVALQAGLL
FT                   YFIAFSANGLAFWQGSRQIASAVESNITGITIGDTFTVILILIDASLVLSQAAPFLRSF
FT                   DAASVAFAKLEADMNRPAVIDGTVEGTGGLLSDVAGEVELRNVDFAFPSRPDKPVLQGL
FT                   SFVCPAGRQTAIVGLSGSGKSTVAGLIARFYDPVEGTVLLDGRDLRELNVRSVRSHISL
FT                   VQQEPYLLNRSILENIALGLINSPKHEHLRPALMSDVLAKVAAAVRDGQSLTAASQEHG
FT                   DLVREIVELTLNAAALADATGFIERLPEGFGASVGAQGHLISGGQKQRISLARALVKDP
FT                   RILILDEATASLDSASELRIQQALGKLAAGRTMIIIAHRLSTVKTADNIIVLRQGKLVE
FT                   QGTHRDLMDARGAYAELVRLQNLNINGSEEGNSTAAASSNCSTEEISEKAGALETSTVA
FT                   DVPHADTREPADEVVEGERTFSATAQSMGALLRPYSFVLVIATVGAIVIGGTYCGSALI
FT                   FGNVVSKLSYCEEPGSIRHAGELFGLLFFILAIIEFTANFSSWSLFGWVAEQVVYKVRV
FT                   LSLRSILEQDLAWHESQGRNPSLLLGLITKDSTALGGLTGSVICTLLSILVSLVATITM
FT                   THIIAWKIAIVCLSVVPLLLGAGYMRVTTLARFEEEHLEAFANSNAITVEAVNSIKTVM
FT                   SLSLEHEILGTYRRSLQEPMRQITKHSAWANLWLAVGYGLSNFLYALAYWWGSTRIMAG
FT                   EYTPTQFFIVQLALLVSSQLWGQAFALAPDVSRAFSATRRLLNMLDMGSTKKLSAPLTP
FT                   VWDVEEATATGEKAPPAAGGVSVAFKQVFFSYPARRESPVLHGLDLSIQRGQFAALVGP
FT                   SGAGKSTIVSLVERLYAPTAGTVAIDGHDIAYGDTSFRSAIAYVPQQSVLFNGTIRFNL
FT                   TLGARPGQTVSQEELEEACKAANIHDTIMQLPDGYDTLCGPNGDRLSGGQKQRLAIARA
FT                   LIRKPRLLLLDESTSALDAESERLLQDGLEKAAKHMTIIAIAHRLYTIRKADVIFLIEN
FT                   GRCVDQGTHAQLMERSESYRVNVLNQAVDS"
FT   CDS_pept        996176..996856
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903353"
FT                   /orf_name="AFUA_3G03690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86651.1"
FT                   /db_xref="HOGENOM:HBG053506"
FT                   /db_xref="UniParc:UPI000051F54D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF26"
FT                   /transl_table=1
FT                   /translation="MMGGYIPGTETLCRRLGAKDEFRYRYGLFWWKWDRRKGGVNGLVP
FT                   LLTRSFDGGIWMGGIVEWDLGRGGGRSRFFGEGKDFHLVVMVKFERGVSVDRSTLLDDS
FT                   MGAPERIFVCRRRISGRSRKKVVRLWEEFIGKNCMKGTLFCGGLDELSVGKGEMDDLRI
FT                   RSDGGDGSGNRKRGDLGEKEDEEVYGETSEVGVDRGGSVVGRLGVSEESWELDYDSDSS
FT                   CTVF"
FT   CDS_pept        join(1004211..1004214,1004428..1004850,1004904..1005042,
FT                   1005118..1005845,1005907..1006637)
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265198"
FT                   /orf_name="AFUA_3G03700"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86652.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG060117"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF25"
FT                   /transl_table=1
FT                   /translation="MANDYSSRVDEYKQDAQPTERVIDEYFPPPLAFPFCPSLWEAFNL
FT                   TYSRLENPLARIPKDRLLRDVEEYAQSYDLNDILPELKKGALVAQRPGEFESIEELTPE
FT                   ERQFLREEVTHRWKHPWGLYYTVVLNSVAAAIQGWDQTGSNGANLTFAQQFGIPQDGCV
FT                   TRAECTRNQWIVGVINAMPYITIALFAGWISDPLNHWLGRKAVIAIAAVFSLVAPIACG
FT                   VTQNWHQLLGCRILLGIGMGLKEVTVPVFSAETVPTSIRGGLVMSWQVCRCSLFPWLIL
FT                   EFGSSSGLTTDNGYPGTAFGIFLGTCANLAVVNTGKIAWRLQLGSAFIPAVPLLLGIWF
FT                   CPESPRWLLSKENPRKAYESLLRLRNSPLQAARDLYYIHAQIKMEKRLLRESEFTRGGN
FT                   TLARFLELFTVPRVRRATQASGIVMIAQQMCGINIIAFYSSTIFEQAGATNIQALLASF
FT                   GFGLVNFLFAWPAVWTIDTFGRRWLLLATFPNMCWTLLAAGFCFWIPASSSAHLGLIAL
FT                   FIYLFNIFYSPGEGPVPFTYSAEVFPLTHREVGMAWAVATNNFWAAVLSLTFPYMLRDF
FT                   KPQGAFGFYAGLNIIALLLIFFFLPETKQRSLEELDRVFSISTRAHAKYQVTEVLPWWI
FT                   RRYLLGRKDAVVRDIYRHLSPDPVLIAEKPKKEEHLESV"
FT   CDS_pept        complement(1007427..1008602)
FT                   /codon_start=1
FT                   /gene_family="HOG000174725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903354"
FT                   /orf_name="AFUA_3G03710"
FT                   /product="D-aminopeptidase, putative "
FT                   /function="aminopeptidase activity"
FT                   /protein_id="EAL86653.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="HOGENOM:HBG002974"
FT                   /db_xref="HOGENOM:HBG300725"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniParc:UPI0000520597"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF24"
FT                   /transl_table=1
FT                   /translation="MAAINPIPPSARPRIRELLPNLYLGRHRPGTKNSLTDVPGVLVHT
FT                   ESIKRPSTATSHAVNTGVTTILPRRDWFDSDCYAGYFRFNGSGEMTGSHWLDETGLLNS
FT                   PIILTNSFSVGACYTGVYEYAVREYKDPATGLVDWFLLPVVAETCDLFLSDIGAMAVTS
FT                   EMVVRGIDQASADPVKEGNTGGGTGMMCHGFKGGTGSASRVIDGVAFGAETNYTVAALV
FT                   QANYGAKRDLRFGGAPVGLLMEQEDGAAATAAANEDDARKAKDGSIIVVIATDAPLHPT
FT                   QLQRLAKRATVGLSRVGGWGSNSSGDIFIAFSTAERIPRAPDFSWKPTVEQQVSVVQDV
FT                   TINALFEGAADATEEAIYNALVGAEDMEGPRGKIVKALDHARLKSIMERYL"
FT   CDS_pept        complement(1009382..1010881)
FT                   /codon_start=1
FT                   /gene_family="HOG000048428" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207919"
FT                   /orf_name="AFUA_3G03720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86654.1"
FT                   /db_xref="HOGENOM:HBG053508"
FT                   /db_xref="UniParc:UPI000051F533"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF23"
FT                   /transl_table=1
FT                   /translation="MAHLAAGDWDAIKAFMIERVNLPNCKGPAGHTGLDGSRWYRMIGA
FT                   WEIQGFVICETCYQELVAWNQLKSYFATTPTIKSDEHLWTCDAAVVPLIKEGLRRAIAS
FT                   PHRWDELHRLFRRRMEYPSCLETKNLLAGSTYWYACKAVPDLVVCTACYLDHFVLDYAS
FT                   SWELHPLTPEQQQQRFECGMQTLQIYAALGVCKQIGIAANTDEYDGFETLARMILESPP
FT                   CNAEDMRNATWYAPKDCTVDVYAICRRCLLGFMAPPGFAREFKEVESRRGGNWLCDLHP
FT                   TTPRFRKYLAKYAAAVKLEDFSFFSKYVVEWTPYPECPRNEACTNRKWYGEGRFTACEL
FT                   CYKEAMEGASLASRLDCALVPNEARCQMYSRRMRNLWRQACENNDLDSFLALANERMDA
FT                   FLLMNMEKERQLAEMSIRMSQRNTLLLASSMNTGIDGIVSAARGDNGTRWGNSSIGYIW
FT                   QTSAGAEGRLQFDQAMGMNVVPASSDLARMAPVMQRWAELE"
FT   CDS_pept        join(complement(1027014..1027313),
FT                   complement(1026723..1026963),complement(1026478..1026668))
FT                   /codon_start=1
FT                   /gene_family="HOG000172824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903355"
FT                   /orf_name="AFUA_3G03740"
FT                   /product="Protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL86656.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG053510"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051FC92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF21"
FT                   /transl_table=1
FT                   /translation="MVSFEDPTVLADFTDSQLAIPTPFKIDSAGRPVYQSHNDFGPLKS
FT                   LRSIPQLVDFGLATRLEEDDDWGVWPIQSDHYRAPEVILGNGWQMPADIWNLGVLLWDM
FT                   IDGKELFRHIHDKEGRYDARLHIAEMIALLGPPPPEVIQRYQYMREYSWPKPVKREDGR
FT                   VCETAEEYFCGPFFDEKGCFLYENLIPNRKLSDTASFLGGEEKETFLDLAKRMLVWHPD
FT                   ARETAGELAGHPFLQPKHTIA"
FT   CDS_pept        join(1027939..1028075,1029108..1029369)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751290"
FT                   /orf_name="AFUA_3G03750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86657.1"
FT                   /db_xref="HOGENOM:HBG053511"
FT                   /db_xref="UniParc:UPI000051EB95"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF20"
FT                   /transl_table=1
FT                   /translation="MPGGKGGLEKGMGNGFLRSKAEKRETNGFIVFITELLPVSRRENV
FT                   IGNPHPTPNREDPYHGSVVLLDKDGKRVTSAHAYPNGYVKFSKEATFKPVKLPPMPGAP
FT                   VIPPEGVATRKSDSTTLLSQSTSEKGKK"
FT   CDS_pept        join(1035763..1035893,1036023..1036143)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265199"
FT                   /orf_name="AFUA_3G03760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86658.1"
FT                   /db_xref="HOGENOM:HBG053512"
FT                   /db_xref="UniParc:UPI000051F2CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF19"
FT                   /transl_table=1
FT                   /translation="MLAVVEALLFRVDGYEGVPEQTTSAQEAIRIAALGATGAGNASAK
FT                   ASRDWAGSLVRLVLSTTFSVNTVTLLNRFREMVFEPDA"
FT   mobile_element  complement(1043411..1044865)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  1062881..1064116
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(1081133..1082677)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        1091988..1093367
FT                   /codon_start=1
FT                   /gene_family="HOG000178697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265200"
FT                   /orf_name="AFUA_3G03780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86660.1"
FT                   /db_xref="HOGENOM:HBG053513"
FT                   /db_xref="HOGENOM:HBG332082"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051EDCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF17"
FT                   /transl_table=1
FT                   /translation="MSRGKRVTRLWMLGFQSYSRLRLRQIGDFVVKHRKGVPTELCEPK
FT                   AGAFKVSFRMEFEDGGSAVIRFPKPGASMFPEEKIRNEVSVIRYLKDNTSIPVPFILHW
FT                   GTKEESPLGLGPFIIMEYIDHAMDLGAALSTPGLNIENRPIPDPHIDSNKLEMLYGQLA
FT                   DILLQLPKLSFPRIGSLTQVDDFTWEVTRRPLSINMNELIRLGTLPRSKLPATSFENAS
FT                   SYYKALADLHLEHLVHQRNDAVDSVNDCRGKYVPRQLFRNLARDGRLVSSLKKLWCDDL
FT                   RPSNVLVNANLQIVGVVDWEFTYAAPADFSFAPPWWLLLEQPEYWPDGIEAWTEVYESR
FT                   LQTFLNVLIKREVEAIRQGRLKEDQKLSGPMQQSWESGHFWVTYAARKNFAFDAIFWQK
FT                   LDCRFFGPSGVPEGNRWKQRVDLLDEEEKYYMEELVNQKFEHMKERVLAWEPNEVYLEK
FT                   V"
FT   CDS_pept        join(complement(1096663..1096759),
FT                   complement(1096090..1096613),complement(1095999..1096043),
FT                   complement(1095874..1095946),complement(1095600..1095826),
FT                   complement(1095578..1095597),complement(1095421..1095523),
FT                   complement(1095239..1095372),complement(1094979..1095192),
FT                   complement(1094562..1094930))
FT                   /codon_start=1
FT                   /gene_family="HOG000217767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265201"
FT                   /orf_name="AFUA_3G03790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27283.1"
FT                   /db_xref="HOGENOM:HBG324163"
FT                   /db_xref="UniParc:UPI0000F51C6D"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9X7"
FT                   /transl_table=1
FT                   /translation="MDGKEVVAVHKPWDDDWGPDIVVGVDFGMTCTGVAYSIGPEWLPP
FT                   RTIQRWPGKLISELANKVPTAIEYESPSHSVKSWGFLCNTEDPASDIKEYFKLHLAPGA
FT                   HQGGKITRAEAQRWLQDYIRCVCQHVTAHFRDTLPSFAACKVEWVFSVPTTWKDVRMVE
FT                   ETRHLLQRAINMSSPGMSPENNRAVVGLTEAEAAAVYACRQHYQMNDIVLVCDAGGGTT
FT                   DVNILQLKSARGEPTKLDQFGSVEGRPIGSVFIDRGMHSLICGRLSKLHDRLEMSPSHT
FT                   AWRMVLGRFQRLKCAFGTPAAANTPSLKLDVPGLKPGADVPGQMSISWDDLQQCFDAKI
FT                   AEMFDLLDGQIRHMHDRFATERISCLILSGGFGSSPYVRKRLMERYGSEIGNGHGNTTA
FT                   MRILMAEEPQLAAVHGLVLDRIQLLKQGVLTFGSRCSPVSYGIICDQLYIPEKHAGELI
FT                   RQDPHDQLSYAIDQIDWLVVQGSPVPPTGFSKEFQLKLEPGREVETFQVHIVMSHYPPA
FT                   LLPKSMSHKGVERVCTLHISTEGVDKKLKNRHWYNRKPVFWKGTFSVKVVVGPADLAFQ
FT                   LWSKDQRIRSSSHPPIALKWMSAGV"
FT   CDS_pept        join(1097173..1097526,1097595..1098009,1098063..1098460)
FT                   /codon_start=1
FT                   /gene_family="HOG000217768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265202"
FT                   /orf_name="AFUA_3G03810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86663.2"
FT                   /db_xref="HOGENOM:HBG053516"
FT                   /db_xref="UniParc:UPI0000F51C56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF14"
FT                   /transl_table=1
FT                   /translation="MSTSTASSTSTYTTAAEPASLSTTSSSPLPGLESTTSTITRAAAI
FT                   SPSSSEAVPTSTSIPGSPSASSPINSVTSASISPSATSTITSSTASSTATNQTSLLPQS
FT                   SPNNVSRGALAGAIKSTRLGGSELSEAKPPQHPALHLGASASSLYAPHPADDETVRARI
FT                   LTLFDHARLHVDNYYSSAAASSPHNPTTSLASYESPYLPSPIATLLTKPGRHRAVLTHI
FT                   LVRELLQKITPGSGKGALLPACYASCPQVVNQTPETDQVLFQWRMLTAYLYQRQQGDRD
FT                   VDEHASSGLAEPFVDAFTGYANPAHTRAERLQHLKSVASAAAELGRLLFAQPCAFEFVW
FT                   DYPGRQGAVLVITPRVIKICDEQGRRLAVSQVMAEGTSLSPFASKQLA"
FT   CDS_pept        join(complement(1099387..1099413),
FT                   complement(1099002..1099190),complement(1098720..1098952),
FT                   complement(1098556..1098619))
FT                   /codon_start=1
FT                   /gene_family="HOG000217769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265203"
FT                   /orf_name="AFUA_3G03815"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EBA27284.1"
FT                   /db_xref="UniParc:UPI0000F51CB0"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z4"
FT                   /transl_table=1
FT                   /translation="MDTPTYVNLPSTALPQHGRHRLPPRKRLDSFGLRIIICASTIALL
FT                   AVTAHLATGWGGDHEEAPVVLPIVLATASLAIVSDILALFLHFQYIGFITATAVLDILV
FT                   IILCAIGVGTISTGDFVSYLGLYYYDYPSVLAQAEIVVFALNLLVAGRLVAEDAKEVPV
FT                   QVQANYE"
FT   CDS_pept        join(complement(1101418..1101709),
FT                   complement(1101253..1101368),complement(1101142..1101208),
FT                   complement(1100941..1101092),complement(1100625..1100907),
FT                   complement(1100281..1100571),complement(1100123..1100236),
FT                   complement(1099847..1100070))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265204"
FT                   /orf_name="AFUA_3G03820"
FT                   /product="MFS nicotinic acid transporter Tna1, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86664.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF13"
FT                   /transl_table=1
FT                   /translation="MYATDTDIEKPTTMGVEHVAETPVSSVSEKHTQDAEQIPHFTPEQ
FT                   EKRVLRKMDLRLIPMLSVLYLLAFLDRGNIGNAKIEGLVEDLGLTSQEYSWCLTVFFFT
FT                   YCAFEMPSNLLLKKLRPSRWLPFLMISWGIVMTLMGVVHNYAGLLSTRIFLGVAEAGLY
FT                   PGTAYYITMWYPREKAQYRQALFFSSASIAGAFSGLLAYAIGVCLWKMDGVGGYAGWRW
FT                   IFILEGLLTVAVALVAPFAIHDFPETATFLTEEERRWVIHKLRSQSGRDTTQDGTDHEE
FT                   SRFRVRYVLDALTDWQIYVALFMYWGITTPLYGISYFLPSIIKDLGYKSSTAQLLTVPI
FT                   YITAAIVAIASAWLSDRRKQRSPFIFFFMSLIAIGFIIVLASTGRGVPGVVYFGVFIAV
FT                   VGIYPAFPGNVTWLSVNLAGDYKRAAGMAIHIGLGNMAGAMASNFYRAQDAPRYILGHS
FT                   LELGFAVVGIIAVVILRFSYQRINKKRDQMDVSGYDNAQLARMGDRSPLFRYML"
FT   CDS_pept        join(complement(1105560..1105692),
FT                   complement(1104834..1105494),complement(1104378..1104517),
FT                   complement(1103726..1104315),complement(1103531..1103681),
FT                   complement(1103384..1103484),complement(1103082..1103329),
FT                   complement(1102420..1103033),complement(1102198..1102374),
FT                   complement(1102095..1102153))
FT                   /codon_start=1
FT                   /gene_family="HOG000178162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056618"
FT                   /orf_name="AFUA_3G03852"
FT                   /product="C2H2 type zinc finger domain protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EBA27285.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51CAC"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z5"
FT                   /transl_table=1
FT                   /translation="MMATPSGAYLPTRPSPILEPIPHYPSNAIPEERVTLRMGIILSNG
FT                   VRVDHQFTFPAMNIANCIIHGEGEMYSVEITHRCTCRRLLHEELVRMLPGFLRENDVYW
FT                   FRTRNPETNIQHTCLFDGAELEMQLVTSHVPECGFCFARRAFIAERDAFDRQQGQMPRG
FT                   SASSTSPRDHSLSAGWTFREPSDTERLRVNRHGWEIMFVLHPDAREGAVTISRLRMELC
FT                   RLLCISDPRRVILTSGPFTWGGDFQEDGKDYYSTYFVHDLIVEVHPMSTSRLNPTGMST
FT                   VSENPTRPHRCVYCGLCFKRSEHLKRHVRRHTKERPFRCRICGESFSRKELHDRHQRTR
FT                   HGATSSIPLPEIVESEPSAATQPKSYSSGQVDAAQGDSPSRAPFPSFVEEPGPALHAPL
FT                   APETHRHENLYLAGAPGSPAFQENAYSVISDRRRESRLQTPSGSETPPWLKLPSGLEFA
FT                   SLLSALNRSPLSTSLPTPLRLSTPQSEAIFENDRNETARLGIEKALEGLRSINVAGGEE
FT                   YSHRFKIPEMDSLYRYWHMFFEIPHKNLPFAHPKSEIYQIPAIAIGVLADGAMYCDEPE
FT                   VGQMLFEASRRIIAHHLNTLYTRENNTIPIWIFTTLLLNCVFGLPGGKSSESDITLGSL
FT                   DSLINLARVIESGPAMDLVDQASTVEEKWKSYIEGESHRRSILCFIVVSGLWSVAYEPI
FT                   VNVLDFPFSLIEFPWSETLWNARSAVQWHVLYQNPRSRSPGSWSENVEALLFGRPQPLN
FT                   GLASLCLVVGLLLYIDGLRREAVLDVVEINSYLQHALDQWFLIHDRTSMENLALNHLCY
FT                   PAAYYLRISLVVDIRQTMDLMRSKQFAAMRKVLREGDLVQAAAFARAAMIPWVISRRNQ
FT                   TSMVAIPCGVVIAEWAIDVMDNQPEDSPQREVLRGFENSIREYWPVAPFVTAVDVWRAV
FT                   RRIIANGPVTTALTRSMDAYEMSLALA"
FT   CDS_pept        1106137..1107018
FT                   /codon_start=1
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903356"
FT                   /orf_name="AFUA_3G03860"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, putative "
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /protein_id="EAL86668.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG419704"
FT                   /db_xref="HOGENOM:HBG691737"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniParc:UPI000051EB96"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF09"
FT                   /transl_table=1
FT                   /translation="MISTAWVEPDTIARPVAVIGGGVLGRRLCMMWAAAGHSVQLYEKS
FT                   PEVASSAIKYINDAMPEQCTKLGTEPGSVFLATSLQDAVQNAWMVIEAIPEILPLKIEL
FT                   FGHLDQLAPPDCILATNSSSYKSSEMIQQVTRRYRVCNGHYYMPPDQNHLEIMTCGYTD
FT                   PSIIAFLMEQSAAAGFVPIHAKVESTGLIFNRIWAAIKRESLLVMAEGVGTAGDIDRLF
FT                   KGWFHGEVGPCEMMDRVGLDTVYNIEKHYVEERGLDAKPIEWLKENYVDRGLLGRKSGK
FT                   GLLSEESNGHAQ"
FT   CDS_pept        join(complement(1108090..1108419),
FT                   complement(1107284..1107982))
FT                   /codon_start=1
FT                   /gene_family="HOG000158937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903357"
FT                   /orf_name="AFUA_3G03870"
FT                   /product="Endo-1,4-beta-glucanase, putative "
FT                   /EC_number="3.2.1.4"
FT                   /function="cellulase activity"
FT                   /function="cellulose binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86669.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG052191"
FT                   /db_xref="HOGENOM:HBG324252"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="UniParc:UPI000051FC7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF08"
FT                   /transl_table=1
FT                   /translation="MRHVQSTQLLAALLLTTRVTAHGHVTNIVINGVSYRGWNIDSDPY
FT                   NPDPPVVVAWQTPNTANGFISPDAYGTNDIICHLNATNARGHAVVAAGDKISIQWTAWP
FT                   DSHHGPVIDYLARCGSSCETVDKTTLEFFKIDGVGLVDGSNPPGVWGDDQLIADNNSWL
FT                   VEIPPTIAPGYYVLRHELIALHGAGSQNGAQNYPQCFNLQITGSGTAQPSGVKGTELYS
FT                   PTDPGILVNIYNALSTYIVPGPTLIPGAVSVVQSSSTITASGTPVTGSGSAPTTSATTT
FT                   LSTTTRATTTTTTTTAGSSTSVQSVYGQCGGSGWSGPTACVTGATCTSYNSYYSQCIPT
FT                   AS"
FT   CDS_pept        join(complement(1110962..1111101),
FT                   complement(1110765..1110907),complement(1110280..1110707))
FT                   /codon_start=1
FT                   /gene_family="HOG000168920" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265205"
FT                   /orf_name="AFUA_3G03880"
FT                   /product="Spherulin, putative"
FT                   /function="nutrient reservoir activity"
FT                   /protein_id="EAL86670.1"
FT                   /db_xref="GO:0045735"
FT                   /db_xref="HOGENOM:HBG053520"
FT                   /db_xref="HOGENOM:HBG326617"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051E924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF07"
FT                   /transl_table=1
FT                   /translation="MLPDFPLHSVVAVMLSLVPLARTAPQPITQGSTSELSLTAQLRLA
FT                   DTAIERYKLLPKDEDFVFNFAGASLPVATSQNFPALVGTGASFSISQLPACSMSFLHLH
FT                   PRATELFAITSGRVLSEMIPETGVLDSEGHQRVIRAELGPGMLTVFPAGSFHTQVNPDC
FT                   EPANFTAAFTSDEFAVGIVAAQTFSFSDDVIAATFGETIAGEDIDKVRHAIPATMAIKV
FT                   EECLTKCGKQKRQA"
FT   CDS_pept        1111929..1113320
FT                   /codon_start=1
FT                   /gene_family="HOG000217771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265206"
FT                   /orf_name="AFUA_3G03890"
FT                   /product="Secretory lipase, putative "
FT                   /EC_number="3.1.-.-"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /protein_id="EAL86671.2"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="HOGENOM:HBG053521"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="UniParc:UPI0000F51CBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF06"
FT                   /transl_table=1
FT                   /translation="MRVSSSAKSSSSWPTLTSGQGAIINTITNFDRSQLANGGAHEDDF
FT                   YNVQGLPRDQWPTEPGKTVKLQEFTDPSPFSIPAKTAMSRIIYSTTNANGTLVPASAYI
FT                   LWPFQPKALRRKAQNNSGLSSAPVVLWKHGTSGFYANGAPSTHRGLFYADIVPFALAEA
FT                   GYAVVAPDYAGLGVDVSWDGSHIPHQYFVREAGAHDALNARSAARGSFPHHLSSDYVVM
FT                   GHSQGGGVAWGLSEILARNHTDNQFEDVGKGYRGAVLAAPPTDALSFTSAGFLAWIAKD
FT                   LNQIYQSFNLSDWFTPLAVSRIELLDQIEGSQMVTFAMFSPEEAVLQPGWHETWYAKAF
FT                   EQLTNPGKRPFKGPILLVQGTEDQIVSYSSTKATMQETCKRYPGDLELLAVPQASHFAA
FT                   INAAKQTLLRWIEDRFEHRPVDRHGCVESQLGSLLSLEYYQVRSNSFPLWAGESHWSYE
FT                   LPTAL"
FT   CDS_pept        join(complement(1115273..1115383),
FT                   complement(1113583..1115214))
FT                   /codon_start=1
FT                   /gene_family="HOG000168931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207920"
FT                   /orf_name="AFUA_3G03900"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86672.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053523"
FT                   /db_xref="HOGENOM:HBG324168"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51C73"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF05"
FT                   /transl_table=1
FT                   /translation="MADNTTLLDLQATGFRLRKTHKKSRGGCLRCKHLRKKCDELRPSC
FT                   SRCTKGMYTCRYQNPSSDGNVPMEQGLTQLPASSVSVSPPIPSTVDPDCAAPLAPSSDQ
FT                   FSVPSPLSGGQTASFSSLSTDEERPPFNRHTRHTPGTLDTIELGLLSHYLSHTCRSIPV
FT                   DDLDLYALSVGVPNLAFSSDVVMSSLLALAAACNSHDIAKRAEALLAPQALMEIQQLLA
FT                   LAERHHQASLRHIQATMQNSDSYDHVLANAALMVLYASASHSIRVHLAAAAKKCRQRLP
FT                   NEVLPQHSQWISFTRAAHTASTAILNGLVAAANETCTATSSPILDAWSETPSLGSCSTD
FT                   GLSPEDGPSENTKRIFLPLVASTFTQALESLRGRAELATALFNRSELCAADSLQLQACL
FT                   ETVSVLERCACAALSRREGSTAVEPPGYQPKSGGGLCRVSPWVARYMISVTSMESPQIL
FT                   RRIIMSFLNKAPAEYLNLVQSVLDSPSAETRAENRMTRDSPGTEVPLLDATHLLAMDIF
FT                   AHWLVLVMLLDGVWWIRDIGEWELGQVVSLMKTQDLPSQSADIGQTWWPETMYLVKREL
FT                   TPSA"
FT   CDS_pept        join(1116029..1116190,1116282..1116356,1116413..1117306,
FT                   1117368..1117513,1117579..1118029)
FT                   /codon_start=1
FT                   /gene_family="HOG000178173" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056619"
FT                   /orf_name="AFUA_3G03910"
FT                   /product="IQ calmodulin-binding motif protein "
FT                   /protein_id="EAL86673.2"
FT                   /db_xref="HOGENOM:HBG053524"
FT                   /db_xref="HOGENOM:HBG324169"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI0000F51C55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF04"
FT                   /transl_table=1
FT                   /translation="MAEKIADTSAVPSAETAAASGGDFSSPTATDGTEIARNNDVTVAD
FT                   QENAARLIQRTYRGYRTRRELQGLGLNATARWSEALKEARWRELYRPSVSPESAGTDAS
FT                   KQVHQKWERVVSVAMQAGSDDGKFRNLNEPDSSKLPTASPVGTGRPSENAPANASSTAR
FT                   SRFPHSFPRLHHGVPSEKRAKMMDQRYFLEMVDLKHRHGSNLRKYHNYWMNCPSTQNFF
FT                   YWLDHGEGKDLDLPECPRAKLEHQQVRYLSRDERLNYLVTVDQAGLFLWAKNNELVCTD
FT                   STRFKDSLKGVVPVAEDAPQFRGHSESGYPVAYASSSSSVSTQSLTDEDSADDSPSEQI
FT                   NQGYEAKGIHKLAQITPSVVRDHFARKPAKRKDMWLFVADTSFRLYIGIKEKGAFQHSS
FT                   FLRGARVAAAGLIKIWNGQLRSLTPLSGHYRPPSANFHAFVHALQDQGVDMSHVSITKS
FT                   YAILAGMEGYVRTKHELRALHETLDGSKEKLLHRRQNDRHAESDARVSDEKAIHKDQAE
FT                   CPSAVADEESLSVHDKKGDGRTLPARVKIHQASALQDPINPSGRPATMPKMINDTQNA"
FT   CDS_pept        join(complement(1120198..1120614),
FT                   complement(1119759..1120124),complement(1119372..1119709),
FT                   complement(1118964..1119314),complement(1118323..1118905))
FT                   /codon_start=1
FT                   /gene_family="HOG000178186" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265207"
FT                   /orf_name="AFUA_3G03920"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86674.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053525"
FT                   /db_xref="HOGENOM:HBG332727"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051FC7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF03"
FT                   /transl_table=1
FT                   /translation="MYSTATNSRSHELVDQLPSPSSSSGQQLSVIGRSRFAALPLAPKL
FT                   PIPRSGSTPTSRQRTPRACELCRERKTKCDGAKPICKQCRLLKTACTYSGSKRERQQLA
FT                   IECARAKVKVYESVLRQIYEESLENGRTSIEEIFHKHFRASPELFSSLLGSKSLFEQQP
FT                   SPPNPGLSLHRMHMTWARRGGSRTSHLCHEPQLRTKGIRAWASLVDDEVASHLLSLYFA
FT                   WENPTWQLVEQHLFLRDLASGSRKFCSPLLVHTLLFFGCSSSYRLDRITDRQEEKSLGK
FT                   KLYAEIQRLWQIEKDQLNLPVAQSSILIGILCCTLGIDRLGTKYILHGAELCHKLDLHC
FT                   ETPAYLYSNVDRDELGPISKCHKLVAWAVFDVQALVAQVYRKMPVWKQPPAVCFSLDEA
FT                   AVLDEGAEWSPYPFRFPVQQPFYYTAACYRSALVMIVHEIVIAGIEFSKTGISSDDWQC
FT                   ARQQHQKLCDWMNSLPSCLMPQSNTTPHILCLHLYYQATLVFLGDMFILYSKVTRNDES
FT                   NLAWFDPWRVKSRALDTVGSLTLQYKQYHGWKSSPLVFLHYFCLAGVHTISQLAPQEPK
FT                   WSLILESCVLGLWHMSLGWGRLCTAFLRTIELVLRASKVDESLIPTRVTVIFEQLNTTR
FT                   WTATDVSSLSADYVVHHVPVPNESAAGSEFRAEGLETLIRSMDHLSINR"
FT   CDS_pept        join(1123042..1124392,1124474..1124616)
FT                   /codon_start=1
FT                   /gene_family="HOG000178129" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207921"
FT                   /orf_name="AFUA_3G03930"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86675.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051532"
FT                   /db_xref="HOGENOM:HBG323882"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051FC93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF02"
FT                   /transl_table=1
FT                   /translation="MFLLTIVAVSSFLVLLLYKILISPYFLSPLSKIPNAHFTAPISDY
FT                   WIERKRRSGEEVLTIYNLHREHGPVVRLGPNELSVNSLGGLHVIYTGAFEKHSFYRDTF
FT                   VNFLTDNLVGMLPNDSHARQKRMLSKIYSKSYLHESVDLRNASSIILSQRLLPVLKNAA
FT                   EKGEAINVLPLFQAVGMDFTSAFLFGTANSTTFLFDLPGWKRWLVEYERFKTLSGKERY
FT                   LGFIERWCLSLCSRVQSNEHPNDVPVATNPVVYSQLRQSLEKHPDQRPLDLALASELLD
FT                   HLVAGHETSGITFVYMMWELSKRPRLQAELRQELLTLSPSLRYPLVELGDGSLPLLPSP
FT                   AAIDSLPLLDAVVRETLRVHSPAPAPLPRITPSSSEGIAIEGYDRIPGGVKVSSSSYTL
FT                   HRISEVYPQPFEWLPERWLDPGPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVMAA
FT                   VYSNYTTSIVDDEGIEQDYAFISLPKGRKLMLKFTPVKL"
FT   CDS_pept        join(complement(1125814..1126119),
FT                   complement(1125167..1125745))
FT                   /codon_start=1
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207922"
FT                   /orf_name="AFUA_3G03940"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase, putative"
FT                   /EC_number="3.1.3.-"
FT                   /function="phosphatase activity"
FT                   /protein_id="EAL86676.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG053526"
FT                   /db_xref="HOGENOM:HBG329837"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000052032A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF01"
FT                   /transl_table=1
FT                   /translation="MQDSGHILFDNLGCGTKRRQMLDEQIKTGERSFRDVSEEMWGSLR
FT                   VPFEDGFEVMEKELEIDPGFQEFHEFCIANGIDFNVISAGLKPILRRVLETFLGEQTIV
FT                   ANDADIKSDGSEWKPIWRHDTELGHDKALSVQEGRAEAAKYCIDGQIPLIVFIGDGVSD
FT                   LPAAREADVLFARKGLRLEEYCKENNISYIPFETFTDIKQNMELIMKEDQETTQGQGTP
FT                   ARFNPRANMWRRISSQQSVRPKPWNTLVTSANYLHQVPQFIAATPSKEEKMFLWPENFT
FT                   EYRPRGIPEDVHA"
FT   CDS_pept        join(complement(1127695..1127851),
FT                   complement(1127135..1127637))
FT                   /codon_start=1
FT                   /gene_family="HOG000178107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265208"
FT                   /orf_name="AFUA_3G03950"
FT                   /product="Endoglucanase, putative "
FT                   /protein_id="EAL86677.1"
FT                   /db_xref="HOGENOM:HBG053527"
FT                   /db_xref="UniParc:UPI000051FA31"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WF00"
FT                   /transl_table=1
FT                   /translation="MMLSKVVMGLLTASLAAAHMEMSWPYPLRSRFDPQVPEEDIDYSM
FT                   TSPLNSDGSNFPCKGYQTNTPWRATAQYTAGQTYNMTITGSATHGGGSCQLSLSYDNGK
FT                   TFKVIQSMEGGCPLVSKYNFKIPGDVANGQALFAWTWYNLIGNRELYMNCADVVISGGT
FT                   GTPSSFESAYPDLFVANVGNGCSTVEGRETVFANPGDQVIYGGTVTPSSPAFPICH"
FT   CDS_pept        1130339..1131637
FT                   /codon_start=1
FT                   /gene_family="HOG000178096" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265209"
FT                   /orf_name="AFUA_3G03960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86678.1"
FT                   /db_xref="HOGENOM:HBG053528"
FT                   /db_xref="UniParc:UPI000051FC8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ9"
FT                   /transl_table=1
FT                   /translation="MTRNFWNSQHPFSTKSALVSVLQILASPARSTAHDEPRATTTVIV
FT                   PATKIYYPPSESAPVPVTSPDRWVLPLVGLSRDATTPWGANVTSGNGTVNAYTISLGQG
FT                   DSDNDCGGNGTQLLSRTQYPLVDAQFIGDLNGNRANLSVSQNSHHILNLGNDSHLTVTT
FT                   SSDDEDFPISTVPFGLNLGHKGEWNGSLALGGLYDANRLTDDATSWISIAETMNNNGTF
FT                   LQTGKQTLSAVIVRIWQYNPSPSITNPSINARVKRSGPFSASDESEPSVVYSARLDLTS
FT                   DMLILPRDWCGRNITLEINMFPNRVASVSSSILIGIPGNLTDSSSRCSFEQDTEVIVLG
FT                   RPFFQAAYLYVDVTGELRILPANQYDLPPKPVPFNATARPVLPDRRTSTYSPGAAGGTL
FT                   VKGSWGDRNLPVGTTVNRALVVLLVLAGFAFLL"
FT   CDS_pept        join(complement(1133347..1133479),
FT                   complement(1131975..1133281))
FT                   /codon_start=1
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265210"
FT                   /orf_name="AFUA_3G03970"
FT                   /product="Cytochrome b5 reductase, putative "
FT                   /EC_number="1.6.2.2"
FT                   /function="cytochrome-b5 reductase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86679.1"
FT                   /db_xref="GO:0004128"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053529"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051E6F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ8"
FT                   /transl_table=1
FT                   /translation="MTVSTMADVSGAQKSPAVALPEYTLKEVALHNRKDDNWIVIHGQV
FT                   YDVTKYQKDHPGGADVLAEVAGSDATEAFEDIGHSEDSREILEEFLIGTLQGAKEYVAP
FT                   KKVRIIAQSPVETPASSSATRYVGAVTSLLGAVASLIYVYRRGSLYALDTTGSLHRYLS
FT                   QPLRGVRLPQGGFANGFLAATLICAAAGGVIARKAAKLTKIESGFLQYPPHIKARKVPR
FT                   ADPHLLKGFLDSKEFQRLPLIQKDQLSSNVYRFVFGLPDSNGVIGLPIGQHVAIRAVID
FT                   GVTVSRSYTPVSNNLDRGRLELVVKCYPDGVLSGKYLANLQVGDEVEFRGPKGAMRYKP
FT                   GFCKKMGMVAGGTGITPMYQLIRAICEDERDTTEISLIYANRTEADILLRDELEQFARK
FT                   YPKNFKLWYMLDTAPENWAYGSGFVNQEVLSERLFAPSPDTKVLLCGPPGMVSATKKML
FT                   AAIGFQKPGPVSKMTDQIFCF"
FT   CDS_pept        join(1134609..1134750,1134805..1135641,1135695..1136404)
FT                   /codon_start=1
FT                   /gene_family="HOG000161766" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751291"
FT                   /orf_name="AFUA_3G03980"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86680.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053530"
FT                   /db_xref="HOGENOM:HBG329806"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI000051EB97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ7"
FT                   /transl_table=1
FT                   /translation="MSTTTTKLFHLLGEPLSTAKEIQFESTTTYGDLRHLVAAHFAIVE
FT                   PSGIGFISQDSILHDVPEIAASDEIISITIDGKAVREIPGPKGLPVIGNFFEVYPDHLG
FT                   NHQRLFEQYGPIFKTTNMGRTVYHTNDPQLSSIIFAETDFFTKKINAAHPLHPIKNQEA
FT                   GVFLGDTDTPEWRTAHKFLPPALGPKAVRHYAPMMQETVEDAFTVFDALDERGEAWNVY
FT                   QYMLKLGSQAVGKLVLGIDFKHFSSIDEPPHELVYRIAESLELNKKVTAWGDWYAKLPF
FT                   GDPQRLRNARGRIIEMVNESIQNAARGGIEDLPLQDAALKASNMVDYALRATDNKGEKL
FT                   PKTSLMQALVVATGAGFTTTSSLLSWLIYGLVTYPGVQERLLQELIDNGIDADTQLTAD
FT                   LTDRLTFLDKFIKETQRRHNPSYQPGRTAKVDMILPGGYKLPQDSVVIGALHHLHNNPD
FT                   VWSNPARFDPDRWDTEEVKNRHKTAYIPFATGPRMCIGFNFALQEVKVFLPKLVYRYKF
FT                   TRENDGHIEYDPMFQLIRPTNLYVRAERRVKWPPRSDNAVPSPSL"
FT   CDS_pept        join(complement(1136868..1137318),
FT                   complement(1136718..1136803))
FT                   /codon_start=1
FT                   /gene_family="HOG000178085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056620"
FT                   /orf_name="AFUA_3G03990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86681.1"
FT                   /db_xref="HOGENOM:HBG053531"
FT                   /db_xref="HOGENOM:HBG328709"
FT                   /db_xref="UniParc:UPI000051EDEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ6"
FT                   /transl_table=1
FT                   /translation="MRDRLIITAMSTMAFASAQACDIVPAVTHTFYGFPDNDPPGPAIA
FT                   YDCGRGLTAGGIGTFDDPLTFASAPGEFTQCEVIFSPYLHKYIRFEDLCSQCVEEWTSS
FT                   GIRHIDIWTGSNTTDGGQDQINCEMRLTPAGDLSVVRNPSMDLDVDATPLFVPGGNPSC
FT                   NVDHVFPNESAATFC"
FT   CDS_pept        join(1137798..1138201,1138264..1138752,1138811..1138952,
FT                   1139015..1139398)
FT                   /codon_start=1
FT                   /gene_family="HOG000178084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265211"
FT                   /orf_name="AFUA_3G04000"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86682.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG032383"
FT                   /db_xref="HOGENOM:HBG397407"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000052058C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ5"
FT                   /transl_table=1
FT                   /translation="MASTDSVPGRFNGLHRRVLGELGLLTLWHSSLDVKVLCAQRFIRL
FT                   FAYGGSTLILASYLSALGISDDRIGLFMTLTLVGDVAISFFLTLFADGIGRRAVLALGS
FT                   ALMACSGVVFGLFDNYWILLTAAVLGVISPSGNEIGPFRAVEESTLAHLTAKEHRSDIF
FT                   VWYSLIGTAGTALGMMVCGWSINLLKTTRDWQYLNACRIVFFAYAGIGAVKFLLSICLS
FT                   HEVEAAKKDKNSATASRQRRAADGPETQPLLGERANEDNQKKSLFSFLGSSDLVSLVVT
FT                   LFVLFGLDSFASGLASLSWMTYFFKRKFSLPEGELGSIFFTTSLISAASMLVASSIAKR
FT                   IGNVKTMVFTHLPSAICLALIPVPSALPAALTFLILRACSQSMDVAPRSAFLAAALPPE
FT                   KRTAIMGAINVVKTCSQSLGPFITGVLADHNLFGASFTLAGVLKAIYDIGMLINFAGRE
FT                   CAQRMASDRPGESA"
FT   CDS_pept        join(complement(1141759..1141823),
FT                   complement(1141658..1141705),complement(1141532..1141594),
FT                   complement(1141258..1141432),complement(1141085..1141178),
FT                   complement(1140743..1141010),complement(1140519..1140648),
FT                   complement(1139876..1140364))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265212"
FT                   /orf_name="AFUA_3G04010"
FT                   /product="MFS transporter, putative "
FT                   /protein_id="EAL86683.1"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E47D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ4"
FT                   /transl_table=1
FT                   /translation="MSFGNAYQQKLTRSILFKLDTRILPILALLFLCSFLDRTNVGNAK
FT                   ILGLQNDLNITGHHELPSNLIIKKASPKIWLPTLTMVWGIITMCLGFVRNFAGFVAVRA
FT                   ILGVAEGGLLPGMVLYLSFFYKRSDLALRIGLFYTAASLSGAFGGLLARGLAAIGPRGG
FT                   LEGWRWIMIIEGLLASQLFEQNVYAISDTLQTFACGALSYLCLPNNIETAAFLTVEERQ
FT                   FARERMQLDNLSVPEGTIEAEHEAFRWSEVVRGVLDLKMWLSATAYFAILSGLYSFGLF
FT                   VGSLIINRSTMYSVADRMPSSSPVIVALISDRLQLRGVIMLFILPIAIAGYGAIANIES
FT                   ARVKYGMTFLMATGMYSSVPCILVWNSNNSAGHYKRATTSAMQLAIANCGGFVASETSF
FT                   LLLAEVPRLTCVVSIAFNYPDKDKPDYHRGHTIVLGLLIFAWVM"
FT   CDS_pept        join(1142462..1142620,1142703..1143395)
FT                   /codon_start=1
FT                   /gene_family="HOG000178062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265213"
FT                   /orf_name="AFUA_3G04020"
FT                   /product="Conserved mitochondrial protein "
FT                   /protein_id="EAL86684.1"
FT                   /db_xref="HOGENOM:HBG053533"
FT                   /db_xref="HOGENOM:HBG737830"
FT                   /db_xref="UniParc:UPI00005207FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ3"
FT                   /transl_table=1
FT                   /translation="MSKLSSSLKALINAPSARPNTVPAPRNIRSVYQKIQQSALANNVS
FT                   SPSWLALSTAATMTMNSPESLAILFQLVASAQTEDESIATAELMREVGLKCISFNGIPR
FT                   TINCLNAFKASLPESVSKRLSRTPTRAPDPGNINEIGRRGRALWDSIYRPFETKLVNKL
FT                   ADSHPDLPVHILNSHYGALLSDPAGRTTGANAGRIVTSIVAISCLRAQSGVGPQVTSHV
FT                   FGLRKAIEDGSWVDDAETEQGARWLASDEGTTWILASVDDIVQSISEGAGSNFAPLRTS
FT                   KL"
FT   CDS_pept        join(complement(1145547..1145838),
FT                   complement(1145210..1145494),complement(1144950..1145136),
FT                   complement(1144589..1144890),complement(1144460..1144539),
FT                   complement(1144375..1144406),complement(1143927..1144323),
FT                   complement(1143801..1143806))
FT                   /codon_start=1
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903358"
FT                   /orf_name="AFUA_3G04030"
FT                   /product="Coenzyme A transferase, putative "
FT                   /EC_number="2.8.3.-"
FT                   /function="CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EAL86685.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008410"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="HOGENOM:HBG028546"
FT                   /db_xref="HOGENOM:HBG353770"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI000051FC7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ2"
FT                   /transl_table=1
FT                   /translation="MATLRGSAIVSPMWRTHTVTRPRLHLGTCYKACARPGLLTTTIRY
FT                   VRYSTATPQQQTLARKIERGVSKLFRDADEAVSDLKSGSTILSSGFGLCGVADTLLSAI
FT                   NRRGVENLHSLTAVSNNAGAPGRGGLSTLTQAGQVDRLILSYLGNNKALEKKYLTGKIA
FT                   IELCPQGTLAERLRAGGAGIPAFFTPTGAHTLLQAGEIPVRLDESGKVLERGTPRETRI
FT                   FNGKTYLMETALTGDVAILRAWKADEAGNCVFRYTTKAFGPVMAKAATLTIVEAENIVP
FT                   VGSIDPNDVDLPGIFVDRVVPATAEKHIEIRKLRTPENEDATKTLSDPAMAQRNRIARR
FT                   AAKELKQGYYVNLGVGIPTLAPSFLPEGTKVWVQSENGILGMGPYPTEDEVDPDIINAG
FT                   KETVTLMPGAATFDSTESFGMIRGGHVDVSILGVSEADYACERIEYRANDKQALQVSAK
FT                   GDLANYMIPGKVFKGMGGAMDLISNPDQTKIVVATSHTAKDGSPKVVAECSLPLTGANC
FT                   VSTIITELG"
FT   CDS_pept        join(complement(1147953..1148470),
FT                   complement(1147367..1147891),complement(1147163..1147235),
FT                   complement(1147016..1147092),complement(1146889..1146959),
FT                   complement(1146172..1146829),complement(1146011..1146107))
FT                   /codon_start=1
FT                   /gene_family="HOG000217773" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265214"
FT                   /orf_name="AFUA_3G04040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86686.1"
FT                   /db_xref="HOGENOM:HBG053534"
FT                   /db_xref="HOGENOM:HBG329780"
FT                   /db_xref="UniParc:UPI000051F2C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ1"
FT                   /transl_table=1
FT                   /translation="MLTSACSKRKGLDKALHQIEEAIKRPKTDAAGSDAARKLISDLQD
FT                   LLSRTQGHSARSEVEETSDDPDQSRTKSPQGAAAGDNLALDDAENPLQLLARASDLQFS
FT                   SAECRDAPILSTSSGSQSSLRPNSSPNEDLPIARSFFVPVKAKLDLGPDMDPIELGLTT
FT                   LHEAELLFSFFYENLAHTRWGLDPTVHTVSFVRSQSAFLFTSMLAAAARFNPSTAALSK
FT                   RLTRHCTSLAYKVIVQRYRSVEIVLAFMVNVPWMAPGSSSGDDDTCSYIAMALTVALDL
FT                   SLNKIVTPSTGFDSTLQNRLAKADCIDAKRALYMDGFEAVDPASEWGRRLLRRRERAWI
FT                   ALFVLERGWHISDIADSRDGPMNSMAVLRRNLDELLRKVKSRCDSCRLGDIGSEAAQSI
FT                   KKLIEDFYDQWYAAWALEIGGPSRCLPPYVEILVTHTQLSTYGGVINHPTAPLEVKRFF
FT                   RAAGLSSALNVMRAAIQGESRLKSMPNNTVIMIAFAACSALSLSVTPADSRSILAPSVR
FT                   HLIEETADVLERIGAVPAHREGASVLYGRLLRELVRRAHVGFVSQKHIESAPVESLQPS
FT                   STLSDYCPIPSLTQPPMDPSTLWPETLQFSAMSDHQIIDAVNRADSAFGMNIPDVLLED
FT                   LMNWDCNTLGADYPLRCNNLECGCEVVGHWVPVGAQK"
FT   tRNA            complement(1149195..1149267)
FT                   /gene_name="tRNA-Lys"
FT   tRNA            complement(1149451..1149522)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        complement(1149946..1151289)
FT                   /codon_start=1
FT                   /gene_family="HOG000178051" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751292"
FT                   /orf_name="AFUA_3G04050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86687.1"
FT                   /db_xref="HOGENOM:HBG053535"
FT                   /db_xref="HOGENOM:HBG328732"
FT                   /db_xref="UniParc:UPI000051E47E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEZ0"
FT                   /transl_table=1
FT                   /translation="MAPSHSFPLASLSLILHQTSCAFAAPWIVTKVYEQDVYTEDYGYR
FT                   TTTRTLIDEITPTASPMPAALSTATHVTSDSYDDAVTVVQVLYPSGAGIESTYKYYNYQ
FT                   DSNIITQYFVDMVLTAPTSCSSQWTVTTAVPVYVPNAIEDALLATSMSTSYSVDDRQPF
FT                   QPTTYTRALAFIDPTQLPASSLNRLSNSYQHTIYREYGCYDSSADSGSSYSYYDGSDGG
FT                   SWLYDRYYYGVISPLGILLACILGWFGVWLIVGLIESWFQFQRLMRGWQARRGFPISWC
FT                   MLAPIVSCLLLLFCRKGFQARTFEEAQVLQEKWQQMVFWRKVGLWLRWGFGFSYPPMLG
FT                   PAPVKVGRPSKRPVAATAPLLGVSLPRSVMSDVHSDSGSNRGDSAASGPAMAYSPTPGQ
FT                   TLQVPPSIPSNRQQQAPNQPIPEVPSTTSGALPANTHATETASEPRTS"
FT   CDS_pept        join(complement(1153678..1153722),
FT                   complement(1152995..1153579))
FT                   /codon_start=1
FT                   /gene_family="HOG000178040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265215"
FT                   /orf_name="AFUA_3G04060"
FT                   /product="SNF7 family protein Fti1/Did2, putative "
FT                   /biological_process="protein transport"
FT                   /protein_id="EAL86688.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG202451"
FT                   /db_xref="HOGENOM:HBG329774"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0000520352"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY9"
FT                   /transl_table=1
FT                   /translation="MVRKDPIFEARTNVKLHSNRLKKEAARAEATFKSEKAKADKAMKN
FT                   REFQIARIHAASAVREKRRQVTLRAEAARADVIINELKAAQSTRDTSRTLALASRGLDA
FT                   ASKSVNLENLVSHANNFLARSEDFKIASSAIEDVAQGVSMQEYGAEGEAEVDRLMEQLA
FT                   DEAGVDMRLALDADAAPKEDVKEQKQADSELEDGLGARLRALRAAS"
FT   CDS_pept        join(complement(1155342..1155550),
FT                   complement(1154191..1155283))
FT                   /codon_start=1
FT                   /gene_family="HOG000178029" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265216"
FT                   /orf_name="AFUA_3G04070"
FT                   /product="BZIP transcription factor HacA "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86689.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG053536"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000051F541"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY8"
FT                   /transl_table=1
FT                   /translation="MEDNFASVVESLSGTSASALPLLTVSPADTSLKAPETKVQETKTE
FT                   EKKPPKKRKSWGQELPIPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERKRLE
FT                   MEKLENEKIQMEQQNQFLLQRLSQMEAENNRLSQQLAQLTAEVRNSRNSTPKPGSPATA
FT                   SPTLTPTLFKQEGDELPLERIPFPTPSITDYSPTLKPSSLAESSDVTQHPAAVLCDLQC
FT                   QLADSKDLEVPSRFLTSALAWNMTLQMTLQLLFLTMTSTAYSTVIHPLSQILRSLKTGS
FT                   PLTFSTQEIYQHFHLILWLISTPSLSPSKASKRPTVFRMRLLTRLLACNPALARPLRDA
FT                   TGRALQLAVSENVSRGTWSAGDDAGRLRWESLLTLVWAIDRFERTRGRGRILFAKFERG
FT                   ARRDTLGNRHRSPRSSWSSKRLSETLTSLMDKER"
FT   mobile_element  complement(1158085..1160301)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(1160309..1160662)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        complement(1161730..1162014)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265217"
FT                   /orf_name="AFUA_3G04100"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL86690.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053537"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000051E70E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY7"
FT                   /transl_table=1
FT                   /translation="MNNASGGTHSKGTATTGGTTTQAAKTNLTTTAAKGRTATPSLDEE
FT                   TRKRLMVEGKCFHCFKPGHISPNYLEKQIKQLKVLEQPVPEEQGVSENN"
FT   CDS_pept        join(complement(1165724..1166101),
FT                   complement(1165429..1165670),complement(1164499..1165372))
FT                   /codon_start=1
FT                   /gene_family="HOG000178028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265218"
FT                   /orf_name="AFUA_3G04110"
FT                   /product="RRNA processing protein Bystin, putative "
FT                   /protein_id="EAL86691.1"
FT                   /db_xref="HOGENOM:HBG028479"
FT                   /db_xref="HOGENOM:HBG738986"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniParc:UPI000051F2A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY6"
FT                   /transl_table=1
FT                   /translation="MPKVISSRAAAAAARRHNPLAEDIITSGHLRTQSSKKSKRQGRQD
FT                   DDGEDGERYIDAKMTRKILQIGQELAEEDAAEHEAAIGAANMATNSAFNFESRFEDDEA
FT                   LSDDEEKFREDEWGDEEEVEEVEVDPNDLDMFNKFIPGGDEDPIFNPRGTDTGRSTNLA
FT                   DLILEKIAEHEAKQSGNGGPMIQGGGLPEDAVQIPAKAVEVYEKVGMILSRYKSGPLPK
FT                   PFKILPSVPNWPTLLSITRPESWTANAVYAGTRIFISSKPAVAQEFISTVLLYRVREEI
FT                   HETKKLNVHTYNALKKALYKPACFFKGLLFPLVSSGTCTLREAHIVSSVIARVSIPVLH
FT                   SAAALLRMCDLAAEQSLRSLESTGAVNVFIRVFLEKKYALPYKVIDALVFHFLRFRACD
FT                   NAEDSMMTDGPSGAATKAYKLPVLWHQSLLVFAQRYRNDITEDQREALLDLLLVRGHKD
FT                   IGPEVRRELLAGRGRGVVVPDPEKQGALDAGDDTMDVTF"
FT   CDS_pept        1167158..1169014
FT                   /codon_start=1
FT                   /gene_family="HOG000178007" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265219"
FT                   /orf_name="AFUA_3G04120"
FT                   /product="Histone-lysine N-methyltransferase (Bre2),
FT                   putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL86692.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG053540"
FT                   /db_xref="HOGENOM:HBG329723"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI000051E948"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY5"
FT                   /transl_table=1
FT                   /translation="MSSIQPVGSSGPSSNINSPTLPPGTAPFFSGTVTGQNARSSPAPP
FT                   SNASVQTDGTRSKRNKRDSRKKREAKGLDQESIPPKKKAAVAPNSALPSSDISILRPLL
FT                   LAEPRASDLLPPQPRQLSFVSRKTSDVLGQSWDFYEVVDKLTNKNGFRYSYAIADPGFP
FT                   HIKYRQTDVPPYHARFSFEDSPAAIFFSEDARAVTASSAWHTARANVCAREGAYYYEAR
FT                   VINGIPNNSQSISANESSHRTPKGHVRLGFARREADLDANVGVDCYGYGIRDVNGEVVN
FT                   RMRCEYFFPKGESIREGDVIGMLITLPPLSLHKKVVEGTYDPAVDGDGTSPTSEAHTST
FT                   NLIRDRIPFHYKSDFCWQQSNVFSTKHLRDYAFNLKETPTFGPPSPFNSEDPSLRTLPG
FT                   SSITIFKNGEKMGTPFKELYAFLPPASRLANGTNNLGIGERENADDGMIGYYPAVSCYG
FT                   GGAVECRFEGPWWVGPPSHADNGEPVRGIGERFNEQIVEDVVADIVDEVEAMLIWGGVD
FT                   GDVVGNAEVDSAGAGAVGGSEVLKGGVGAAFDPRLDSVPGAAEFADTENISNGLEAGVT
FT                   DADAGHLTTEDTLSVGHEGSPNPATPSAPLENTVPTEDVEMS"
FT   CDS_pept        join(complement(1170985..1171123),
FT                   complement(1170584..1170908),complement(1170334..1170509),
FT                   complement(1169380..1170263))
FT                   /codon_start=1
FT                   /gene_family="HOG000116699" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903359"
FT                   /orf_name="AFUA_3G04130"
FT                   /product="Glutamyl-tRNA amidotransferase, A subunit,
FT                   putative"
FT                   /function="glutaminyl-tRNA synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /function="transferase activity"
FT                   /biological_process="translation"
FT                   /protein_id="EAL86693.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0050567"
FT                   /db_xref="HOGENOM:HBG447642"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI0000520353"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY4"
FT                   /transl_table=1
FT                   /translation="MSLLREAEKCIANQRSHAALNAFITTVQHLGPLREQVRDAELRRE
FT                   SGRSKSEVDGRLIAFKDNICTRDFPTTCASGILAKFTSPFNATVVEQLSEAGAIVAGKT
FT                   NLDEFGMGSHCLNSCFGPVKNQRQCQEGRILSAGGSSGGSAVSVATDQCYAALGTDTGG
FT                   SVRLPAAYTGTVGFKPSYGLVSRWGVVAYANSLDTVGILAKNASTARDVFRIVNRHDPR
FT                   DPTNLSPRSRSRIASHLQQPALLSRMTSSLRIGVPIEYNISELSPSVRRAWALSIAFLR
FT                   EQGHTIHPVSLPTTKLALSAYYVLAPAEASSNLAKYDGIRYGSRCNSPDSGGQPESYLY
FT                   AKTRGDGFGLEVKRRILLGAFSLSADAINNYFIQAQRVRRLVQHDFNAVFRAEQPISPS
FT                   RQKGDTELKSKQAEVDVLICPTAPSCPPQLADLVETDSIFSSLNAYTNDVFTVPASLAG
FT                   LPAASVPVRVNCRDEGSSDADLAGIQIIGQYGDDELVLKVSESLEGKIF"
FT   CDS_pept        join(1171784..1172013,1172083..1173124)
FT                   /codon_start=1
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265220"
FT                   /orf_name="AFUA_3G04150"
FT                   /product="Mitochondrial enoyl reductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86694.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FC70"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY3"
FT                   /transl_table=1
FT                   /translation="MISRTVVKSATRSSGAGVSLAFKSRASPLRFPAPSDHHQVPLPNT
FT                   RLGQTRFISVYGYTQSKALVYSQYGEPKDVLRLHKHSISPPHGTQVTLRLLAAPLNPAD
FT                   VNQIQGVYPSKPPFQTTLGTVEPSAVAGNEGAFEVIATGSNVKNLAKGDWVVMKQTGQG
FT                   TWRTHAQLDESQVIRIENKEGLSPLQVSTVSVNPVTAYRMIKDFCDWDWMRAGEEWLIQ
FT                   NGANSGVGRAAIQLAREWGIKTINVVRERRTPEETDALKRELYDLGANAVVTESELLSG
FT                   EFKSMVNEFTRQGKEPIRLALNCVGGKSATALAKTLAPGSHLVTYGAMSKQPVTLPSGL
FT                   LIFKNLVFDGFWVSRWGDKHPELKENTINDVLKLTRAGRFKDIPVEYIRWTWETEAAEL
FT                   VAGVQETLSGFRKGKGLLKYEGDE"
FT   CDS_pept        join(complement(1174976..1175172),
FT                   complement(1173244..1174927))
FT                   /codon_start=1
FT                   /gene_family="HOG000177996" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207923"
FT                   /orf_name="AFUA_3G04160"
FT                   /product="Ser/Thr protein phosphatase family "
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="EAL86695.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG434271"
FT                   /db_xref="HOGENOM:HBG736951"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI000051EDC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY2"
FT                   /transl_table=1
FT                   /translation="MVWNIALTRMKYLAYWALLYSSSPGLAIQPSAPDAIPAPIRDLQW
FT                   GQLNFLHTTDTHGWLAGHLQESKRASYGADWGDYISFTTRMREKALAQGNDLLIIDTGD
FT                   RVEGNGLYDASEPKGAYISDILRQQQIDLMSAGNHELYKQNTSETEFLTTVPNFRDSYL
FT                   ASNIDIVHPISGELVPLAPRFKKFTTEKQGIRIVAFGFLFDFSKNYNNTIVYTVEDTIK
FT                   TTWFQEAIRDEEVDLFLVIGHVPVRSKEYNAVFEEIRNVNWDVPIQFFGGHYHIRDYAR
FT                   YDSKAYGLASGRFMETIGFLSIDGLSTSKNRLKPAQATPSFNRRYIDNNLYSFHHHTGH
FT                   DRDSFPTEHGQNISHLIQQSRDVLELDRVHGCAPRDLWMTRVKYPSQDSIYTWLEEKVL
FT                   PSQVKDDSRKGKPALVIVNTGAIRFDIFKGPFTQDTTFIVSPFTSGFRYIKDIPYDKAQ
FT                   TVVDILNKQPQILTAPKDHTNHTPWTLAPPEQSMHMHDKIVESDDVAAHYLTDQSRLPM
FT                   STPFTPKVFPGYTTVDDGGIDGDDTVHSPISFYRVPNCIQALINPGTSADPNTVDLVYI
FT                   DFIEPYVALAAKFARLDLDFARDSDVYMPFETLTDLILDWVKHNWKCEDA"
FT   CDS_pept        join(1175521..1175771,1175877..1176000,1176065..1176351,
FT                   1176407..1176878)
FT                   /codon_start=1
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265221"
FT                   /orf_name="AFUA_3G04170"
FT                   /product="Pyruvate dehydrogenase E1 beta subunit PdbA,
FT                   putative"
FT                   /EC_number="1.2.4.1"
FT                   /function="pyruvate dehydrogenase (acetyl-transferring)
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86696.1"
FT                   /db_xref="GO:0004739"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG450176"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI000052057D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY1"
FT                   /transl_table=1
FT                   /translation="MAAPRLFRPAARLLSSRLSATPFRSTFQKSACAPSILRARGYATE
FT                   SGTKEVTVRDALNEALAEELESNPKTFILGEEVAQYNGAYKVTKGLLDRFGPKRVIDTP
FT                   ITEAGFCGLAVGAALAGLHPICEFMTFNFAMQAIDQIINSAAKTHYMSGGIQPCNITFR
FT                   GPNGFAAGVAAQHSQDYSAWYGSIPGLKVVAPWSAEDAKGLMKAAIRDPNPVVVLENEL
FT                   LYGQAFPMSEAAQKDDFVLPLGKAKIERPGKDLTIVSLSRCVGQSLNAATELKQKYGVE
FT                   AEVINLRSVKPLDVETIIQSLKKTGRLMCVESGFPMFGVGSEILALSMEYGFDYLTAPA
FT                   VRVTGAEVPTPYAVGLEQMSFPQEDTIVGQAAKLLRL"
FT   CDS_pept        join(complement(1178356..1178361),
FT                   complement(1178201..1178234),complement(1177978..1178159),
FT                   complement(1177325..1177906))
FT                   /codon_start=1
FT                   /gene_family="HOG000217774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265222"
FT                   /orf_name="AFUA_3G04180"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL86697.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053541"
FT                   /db_xref="HOGENOM:HBG330212"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000051EDEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEY0"
FT                   /transl_table=1
FT                   /translation="MALIAAIHLLHRSLLLYEVRLPWHRYASRNASASNGYRVTTLISS
FT                   SGNLKCEVTDVSLLLSCLYQRGFTNPTPKTESARSALSSFTCTLCNKSYSRHPEYEAHI
FT                   SSYDHQHRKRLQDLKQLSRDPNAAEKARRAERKADVEAGLRVIGTTPASGAGGTGGGGG
FT                   FKKGGFKSSFTTVKGPVSATVSTRKNVLGDDDDDDANQAVGAGEPSELVRNKPRQDTDA
FT                   QHGNAESDTDEEYANNDTEANYYDPRKPTECSSRCPAFQNELTIS"
FT   CDS_pept        join(1178759..1178969,1179038..1179825)
FT                   /codon_start=1
FT                   /gene_family="HOG000217776" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056621"
FT                   /orf_name="AFUA_3G04190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86698.1"
FT                   /db_xref="HOGENOM:HBG053542"
FT                   /db_xref="HOGENOM:HBG330174"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="UniParc:UPI000051E925"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX9"
FT                   /transl_table=1
FT                   /translation="MPPQDLSLPKVDDVDTRSLISMQELDPSPVSEEFGDIENGDFIHE
FT                   AQDVPAHGGLSLPKLGLRGHNWDSWLSAIQRFSTYPPTLFFTLHFANTSLIPLMTRSVP
FT                   AAENYLLLTRPLYQSPSLEHAILTVPILAHVASGIVLRNVRSSRRARLYGAETRSQRYS
FT                   LTFWPRMTLQARLGYMLVPLLGAHVLVNRIVPLMVDGGSSGVGLGYVAHGFVRSPVFWN
FT                   IYYLIFVAVGVWHIVGGWANWMGWRVTTARKERINKKGSLEGYLGYTDSEHRMRKQRKI
FT                   WWIVNGIAVVGASIWLAGALGIIGLGGRGSGWEASSWDGMYDRVPIIGAWL"
FT   CDS_pept        1180181..1182424
FT                   /codon_start=1
FT                   /gene_family="HOG000177995" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207924"
FT                   /orf_name="AFUA_3G04200"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase "
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="EAL86699.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="HOGENOM:HBG053543"
FT                   /db_xref="HOGENOM:HBG386594"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI000051E485"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX8"
FT                   /transl_table=1
FT                   /translation="MWMSSHRPFQNLTIFRSIVRTIRPDFPGFSHLSTIYAVTHPHSGI
FT                   VLPQFYHSASSLMDDPTTADGASRLVQHDGQAYQAVKEGRAYILNPPTQAAASKGTKKD
FT                   LKPEDQLQSVFYNPIQQFNRDLSVLAIKAYGEHVLALKKLKAERKRNGSSRGKKRKRED
FT                   EEDKEQDEVDVEQPSAANGNIGASVSTSDQQTPSFTILDALSATGLRALRYASEIPFTT
FT                   CVVANDLSNSAIQRMKTNIEYNGLGKLIRPNLGDARAYMYSLLNQPSSQNSGTHAGKFD
FT                   VIDLDPYGTAAPFMDAAVQGVKDGGLLCVTCTDAGVWASNGYPEKAYALYGGVPIKGSH
FT                   SHEGGLRLILHGLATSAAKYGLAIEPLLSLSIDFYARVFVRVHRSPAEVKFTSGNTMLV
FT                   FNCDSGCGAWTTQPLTQTKQKLDKKGNPYYHYGFAQGPTAGTHCEHCGFKTHVGGPMWA
FT                   GPLHNPHFIQKILDMLPDVDRDIYHTVERIEGMLTTALEEDLNLDTISSSTPTGTLAAE
FT                   KELTEVSTSREYSAIIPRLDPALRDPFPFYFTLSSLAKVLHTSTISADAFRGALRSLGY
FT                   RSTRSHAKPNTIRTDAPWDVIWEIMREWVRQKAPVKEGAIRPGTPGAAIMAKSRENSRK
FT                   DKGEDSLNILREELMSAAESGKDISDLVTKVEAAIYRSSHRYPPRIQGAELRQQTEGPQ
FT                   SPQTAPAVKQNLNTLEVVFDEALGREASHSKKRLVRYQINPRANWGPLNRASG"
FT   CDS_pept        join(complement(1187934..1188450),
FT                   complement(1182908..1187853),complement(1182737..1182847))
FT                   /codon_start=1
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265223"
FT                   /orf_name="AFUA_3G04210"
FT                   /product="Fatty acid synthase alpha subunit FasA "
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL86700.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG053544"
FT                   /db_xref="HOGENOM:HBG325769"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI000051FC94"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX7"
FT                   /transl_table=1
FT                   /translation="MRPEIEQELAHTLLVELLAYQFASPVRWIETQDVILAEKRTERIV
FT                   EIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDAKEIYYDVDPVEEEAEAPAS
FT                   SPAAPTAPVAAAAPAPTAVTPAPSAGPAAAVDDIPVTAVDVLRTLVAQKLKKGLSDVPL
FT                   SKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGASMQATFNGQLGKQSSS
FT                   LIARLVSSKMPGGFNITAVRKYLETRWGLGPGRQDGVLLLALTMEPPSRIGSEPDAKAY
FT                   LDDVTNKYAANAGINLSAPAAGSDSGSGAGGMLMDPAAIDALTKDQRALFKQQLEIIAR
FT                   YLKMDLRAGQKAFIASQETQNALQAQLDLWQAEHGDVYASGIEPAFDSLKARVYDSSWN
FT                   WARQDALSMYYDIIFGRLKVVDREIVSQCIRIMNRSNPLLLDFMQYHIDNCPTERGETY
FT                   QLAKELGQQLIENCKEVLGVAPVYKDVAIPTGPQTTIDARGNIAYKEVPRASARKLEHY
FT                   VKQMAEGGPISEYSNRTKVQNDLKNVYKLIRKQHRMSKSSQLQFNALYKEVIRALSMNE
FT                   NQIMPQENGHSKKAGRNGVKRNGSPRAGKVETIPFLHLKKKHEHGWEYNKKLTGIYLDV
FT                   LESAARSGLTFQGKNVLMTGAGAGSIGAEVLQGLISGGAKVIVTTSRFSREVTEYYQAM
FT                   YARYGARGSQLVVVPFNQGSKQDVEALVDYIYDTKKGLGWDLDFVVPFAAIPENGREID
FT                   SIDSKSELAHRIMLTNLLRLLGCIKTQKQTHGFETRPAQVILPLSPNHGTFGNDGLYSE
FT                   SKLALETLFNRWYSENWSNYLTICGAVIGWTRGTGLMSGNNMVAEGVEKLGVRTFSQQE
FT                   MAFNLLGLMAPAIVNLCQLDPVWADLNGGLQFIPDLKSLMTKLRTDIMETSDVRQAVIK
FT                   ETAIENKVVNGEESELLYKKVIAEPRANIKFQFPTLPDWEQDVKPLNESLKGMVNLDKV
FT                   VVVTGFAEVGPWGNSRTRWEMEAYGKFSLEGCVEMAWIMGLIKHHNGPLKGKAYSGWVD
FT                   AKTGEPVDDKDVKAKYEKYILEHSGIRLIEPELFKGYDPKKKQLLQEIVIQEDLEPFEA
FT                   SRETAEEFKREHGEKVEIFELPESGEFTVRLKKGATLLIPKALQFDRLVAGQIPTGWDA
FT                   RRYGIPDDIIEQVDPVTLFVLVCTAEAMLSAGVTDPYEFYKYVHLSEVGNCIGSGIGGT
FT                   HALRGMYKDRYLDKPLQKDILQESFINTMSAWVNMLLLSSTGPIKTPVGACATAVESVD
FT                   IGYETIVEGKARVCFVGGFDDFQEEGSYEFANMKATSNAEDEFAHGRTPQEMSRPTTTT
FT                   RAGFMESQGCGMQLIMSAQLALDMGVPIYGIIALTTTATDKIGRSVPAPGQGVLTTARE
FT                   NPGKFPSPLLDIKYRRRQLDLRRKQIKEWQESELLYLQEEIEAMKAQGLASSDLSDYMQ
FT                   ERARHIEREAVRQEKDAQFSLGNNFWKQDSRIAPLRGALATWGLTIDDIGVASFHGTST
FT                   VANDKNESDVICQQMKHLGRKKGNAVLGIFQKYLTGHPKGAAGAWMFNGCLQVLDSGLV
FT                   PGNRNADNVDKVMEKFDYIVYPSRSIQTDGIKAFSVTSFGFGQKGAQVIGIHPKYLYAT
FT                   LDRSQFEAYKAKVQSRQKKAYRFFHNGLINNSIFVAKNKAPYEDNIQSNVFLNPDYRVA
FT                   VDKKTSELKFPPLPPKASDKDAESTRQVVESLAKAHAEDNSRIGVDVENIDAVNIENET
FT                   FIERNFTASEQEYCRKASSPQSSFAGRWSAKEAVFKSLGVCSKGAGAPLKDIEILSDTS
FT                   GAPVVNLHGAAAEAARQAGVKQVSVSISHSDSQAVAVAVSKF"
FT   CDS_pept        join(1190959..1196751,1196803..1197288)
FT                   /codon_start=1
FT                   /gene_family="HOG000177963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903360"
FT                   /orf_name="AFUA_3G04220"
FT                   /product="Fatty acid synthase beta subunit, putative "
FT                   /function="fatty acid synthase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /protein_id="EAL86701.1"
FT                   /db_xref="GO:0004312"
FT                   /db_xref="GO:0005835"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053545"
FT                   /db_xref="HOGENOM:HBG736477"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016452"
FT                   /db_xref="UniParc:UPI000051EB84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX6"
FT                   /transl_table=1
FT                   /translation="MYGASTGPQTGINTPRSSQSLRPLILTHGSLEFSFLVPTSLHFYA
FT                   SQLKETFTASLPQPTDELAQDDEPSSVAELVARYIGHVAREVEEGEDDAQGTCLEVLKL
FT                   ALNEFERAFMRGNDVHAVAAALPGITAKKILVVEAYYAGRAAAGRPTKPYESALFRAAS
FT                   EEKASIYSVFGGQGNIEEYFDELREIYTTYPSFVEDLISSSADLLQQLSREPEASKLYP
FT                   KGLDVIQWLQDRDSQPDTDYLVAAPVSLPLIGLVQLAHFVVTCKVLGRQPGEILERFSG
FT                   TTGHSQGVVTAAAIASATTWESFAKAAKDALTMLFWIGLRSQQAYPRTSIAPSVLQDSI
FT                   ENGEGVPTPMLSIRDLPRSAVQEHIDTTNQHLPVDRHISISLVNSARNFVVTGPPLSLY
FT                   GLNLRLRKVKAPTGLDQNRVPFTQRKVRFVNRFLPITAPFHSQYLYAAYDRILEDLEDI
FT                   EISAKSLAIPVYDTKTGDDLRQSGDTNIVPSLVRMITHDAVNWEKATVFQGATHIVDFG
FT                   PGGISGLGVLTNRNKDGTGVRVILAGAMDGTNAEVGYKPELFDRDEHSVKYAIDWVKEY
FT                   GPRLVKNAMGQTFVDTKMSRLLGIPPIMVAGMTPTTVPWDFVAATMNAGYHIELAGGGY
FT                   YNGKSMTEAISKIEKTIPPGRGITVNLIYVNPRAMAWQIPLIGKLRADGVPIEGLTIGA
FT                   GVPSIEVANEYIETLGIKHIAFKPGSVDAIQQVINIAKANPKFPVILQWTGGRGGGHHS
FT                   FEDFHQPILQMYSRIRRCENIVLVAGSGFGGAEDTYPYLSGAWSSSFGYPPMPFDGCLF
FT                   GSRLMIAKEAHTSKNAKKAIADAPGLDDKDWEKTYKGPAGGVVTVLSEMGEPIHKLATR
FT                   GVLFWHEMDQKIFKLDKAKRVPELKKQRDYIIKKLNDDFQKVWFGRNAAGEAVDLEDMT
FT                   YAEVVHRMVELMYVKHESRWIDASLKKLTGDFIRRVEERFTTKEGQASLLQNYSELDTP
FT                   YPAIDNILAAYPEAATQLINAQDVHHFLLLCQRRGQKPVPFVPALDENFEYWFKKDSLW
FT                   QSEDLEAVVGQDVGRTCILQGPMAAKFSNTIDEPVQQILDGIHQGHIKGLLQDVYGGDE
FT                   SKIPVIEYFGGRLHEAVSELDIDGLTISEDTNKISYRLSSSPSGDLPDLDLWLRLLAGK
FT                   SYSWRHALFLADVFVQGHRFQTNPMKRIVAPTPGMYVEISYPEEPSKTTICVREPYQSG
FT                   KLVKTVEVKVNDQGQISLTLFEGRTAEGGVVPLSFLFTYHPEAGYAPIREVMDGRNDRI
FT                   KEFYYRVWFGSKDVPFDTPTTATFSGGRETITAQAVADFVHAVGNTGEAFVDRPGKEVF
FT                   APMDFAIVVGWKAITKPIFPRTIDGDLLKLVHLSNGFKMVPGAQPLKVGDVLDTTAQIN
FT                   AVINQDSGKMVEVCGTIHRDGQPIMHVTSQFLYRGSYQDFENTFQRKDEVPMQVHLASS
FT                   RDVAILRSKEWFRLDEPDVELLGQTLTFRLQSLVRFKNKSVFSHVQTVGQVLLELPTKE
FT                   VIQVATVDYETGTSHGNPVIDYLQRNGTSIEQPVYFENPIPLSGKTPLVLRAPASNETY
FT                   ARVSGDYNPIHVSRVFSSYANLPGTITHGMYTSAAVRSFVETWAAENNIGRVRGFHVSL
FT                   VGMVLPNDMITVKLQHVGMVAGRKIIKVEASNKETEDKVLLGEAEVEQPVTSYVFTGQG
FT                   SQEQGMGMELYSSSPVAREVWDRADRHFIENYGLSIIDIVKNNPKELTVYFGGPRGKAI
FT                   RQNYMSMTFETVNADGTIKSEKIFKQINEDTISYTYRSPSGLLSATQFTQPALTLMEKA
FT                   SFEDMRSKGLVQRDSSFAGHSLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVERDE
FT                   QGRSNYSMCAVNPSRISKTFNEQALQYVVENIAEQTGWLLEIVNYNVANMQYVAAGDLR
FT                   ALDCLTNLLNYLKAQNIDIPALMQSMSLDDLKAHLVKIIHECVKQTESKPRPIVLERGF
FT                   ATIPLKGIDVPFHSTFLRSGVKPFRSFLLKKINKTTIDPSKLIGKYIPNVTARPFEITK
FT                   EYFEDVYRLTNSPRIAHILANWDKYEEGGENTSRATGTNTA"
FT   CDS_pept        join(complement(1198803..1200152),
FT                   complement(1198440..1198742),complement(1198034..1198384))
FT                   /codon_start=1
FT                   /gene_family="HOG000177951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265224"
FT                   /orf_name="AFUA_3G04230"
FT                   /product="Transcription initiation factor IIF subunit
FT                   alpha, putative"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86702.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG053547"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI000051EDD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX5"
FT                   /transl_table=1
FT                   /translation="MTLPANDANSQTHTSANKAPPMRFRRPKIADPLVRPKKRVIARPA
FT                   ATSAPSVGIAAKPTTRPVISNVTPATQADKAAPGAPQNDFSVNGFSGPLLSETYVDYPI
FT                   VITKRSLRVGLKHHIARFASKKTIDPRDESQFTRPVRLQRRDPRAKTQELNQDKGQAQK
FT                   LTPQSSLQLGDAEREELEARKAAREKERAENLAQIAPSMGSAPKRSNIPKQRTQQVSKT
FT                   DMTPEEVARARIKYEEALPWHLEDFDNKNIWVGNYEAALSETHAVFIPENGRMRMIPVE
FT                   KWYKFGAKNQFRALTIEEAERFMAKKIKDPRWFMEKQQEQAQRKELEQFARQRKVYAGK
FT                   QGTPAGVDGLEADEMDFEEDRFADDEEHDDLFNEDEETKAAEKRIKQDQLKANVFDLKD
FT                   EKDYEEEELREKREREARRILGKKVRKALKKREKNYDYSSGSDANPYSDDESSDDSEAE
FT                   RLREEERKAEEDKNKKDSAPSTRGNVTPSGRPKHTEPLKKGPGAASRKRLGSPNVSDAS
FT                   GTDTSRKKAKSKHSSQPTPQPTSRALSPTAPPGQVGKKRIRNVAGAGSVSDADGGAASG
FT                   GEMSESGKIKKLKLNPPAATSQGGTPQGSRAGSPTPIGSKGLAASRASSPESLRGKISL
FT                   EVPCLHRNLSAYRTNFCVQGKLASLHRYLRGL"
FT   mobile_element  complement(1201100..1201393)
FT                   /mobile_element_type="transposon:mariner transposon family"
FT   CDS_pept        join(1203628..1204523,1204608..1206465)
FT                   /codon_start=1
FT                   /gene_family="HOG000177929" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751293"
FT                   /orf_name="AFUA_3G04240"
FT                   /product="Lipase/serine esterase, putative "
FT                   /protein_id="EAL86703.1"
FT                   /db_xref="HOGENOM:HBG053548"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI000051EDC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX4"
FT                   /transl_table=1
FT                   /translation="MLFSNRYTVTYTPVTDNVHPLPDALHVKVKNTSAIALRAAYLHGP
FT                   YTLYASCYPSTFDPHGHSQDEEIEGIPQFEPYLKAGGSWKAMIPIPKCLRQIPETSASP
FT                   ASIQKVTWVIEIISQVIFSTTAIVNYELLIGRDEESVELPYSGGLSVGRLHLAAHLQDH
FT                   VNPTTKGRQVVATKGVFSKSVCLRIDDTTSLWNTPPFPSEHDALDHTGSPSDIPPTERE
FT                   SMERAERPDTTRQNCARRKKVHLVVLTHGLHSNLGADMLYLKESIDAATKKTQSGASCK
FT                   LRQHLDPQAPKGVSSLDRSIRDNDSVDQDDIDDEQVIVRGFAGNAVRTERGIQYLGKRL
FT                   AKYVLFMTYPDQPYRPLKQSRTKTFTESLGAWKTAKESVINDPSGSRTRADEAEDEHRY
FT                   YQITSISFIGHSLGGLVQTYAIAYIQKHSPEFFNLIRPVNFIALATPFLGLSNENPMYV
FT                   RFALDLGLVGRTGQDLGLSWTAPRVRSGWEAVIGGRGTSTKPREHVDHGPKPLLRVLPC
FT                   GPAHEALSKFDRRTIYSNVVNDGIVPLRTSCLLFLDWRGLERVEKARRQNGLVSTMAEW
FT                   GWAELTGANSVSLRSPRSPIDSNASFSRIDHRDSGRTNSPSEEVQRQRQAETVQSASIV
FT                   DSPVLSTGESANHPPQVELGGSRHNQEPKISSVQSSLNPLSAFFSIFRPKKATTVSSRH
FT                   KHTKVYKRSQTLSTTSDFAHASTSRPFPLEEPISRSSYEESGLNAPPRTTFFESAGDLL
FT                   MPPLPPVQFIINPASRPKTIFHDRIYYPEDIPPPLSAKRKTSPLSSFESKVSDGPRDSG
FT                   CDESRSTNDGNSIAGGLKVEEKIARAYHRGMSWRKVLVRLEPDAHNNIIVRRMFTNAYG
FT                   WPVVKHLVDSHFRQDSLDEGQKRPGESVQDAYIPVGTTCDMGGALS"
FT   CDS_pept        join(complement(1207932..1208055),
FT                   complement(1207798..1207873),complement(1206988..1207666))
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056622"
FT                   /orf_name="AFUA_3G04250"
FT                   /product="Inositol monophosphatase, putative "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="EAL86704.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000051FC7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX3"
FT                   /transl_table=1
FT                   /translation="MGAETIDLKDIHDFLIDLAFKAGEIITNALPNTGSTGSKKNNLVT
FT                   EYDRAVEKMISTALAGRYPQYQFHGEETYDPASPLTDAPTFVVDPIDGTVNFVHGFPYA
FT                   CISLGFAIDRKPVVGVVYNPFNNTLYSAIRGEGAYLNRNTKLPLNARSLEPLNGLENAL
FT                   IGVEWGSERAGNNWVTKVRTFEKLGKTKGDGGAMVRSMRSMGSAALNLCAVACGNLDLY
FT                   WEGGCWAWDVCAGWVILTEAGGTIVDGNPGNWEATVDGRKYLAVRGSPNQAGQKELIEE
FT                   FWGHIQGHLEY"
FT   CDS_pept        join(1209103..1209212,1209362..1209384,1209523..1210301)
FT                   /codon_start=1
FT                   /gene_family="HOG000177950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207925"
FT                   /orf_name="AFUA_3G04260"
FT                   /product="DNA-binding protein HGH1, putative "
FT                   /function="DNA binding"
FT                   /protein_id="EAL86705.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG053549"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="UniParc:UPI000051FEB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEX2"
FT                   /transl_table=1
FT                   /translation="MQHAKTLLASRPPIRTSSNVISFSQCAISSFWSEIILDSYGEDND
FT                   KLSRLITLKRRTAESVSTSTMAIDQLMDCFVKGAEGALNKKANFDYLSYLFADLSKSEI
FT                   GRAYFTTRQDYDGVVPVTKLTVFTEHESTVRRKGVASTIKNVAFDIPFHPTLLSADDAN
FT                   LLPYVLLPITGPEEFSEEESMAMLPDLQLLPPDKRRDGDNSIIVTHLETLLLLTTTREG
FT                   RDKMRAINVYPIIRECHLHVDDEGVREACDRLVQVLMRDEEGEGDASQARIDGTSSISS
FT                   KSDNYIQQGSEQNGDETVVELF"
FT   mobile_element  1217552..1220128
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1222609..1223958
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(complement(1229676..1232097),
FT                   complement(1228278..1229619),complement(1228125..1228209))
FT                   /codon_start=1
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056623"
FT                   /orf_name="AFUA_3G04300"
FT                   /product="Actin cytoskeleton organization and biogenesis
FT                   protein, putative"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="EAL86709.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG117938"
FT                   /db_xref="HOGENOM:HBG398541"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniParc:UPI000052032B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW8"
FT                   /transl_table=1
FT                   /translation="MTQSNSIQDFPPSATQDNCSSDIGCATGSDERNALIATPLPNMVP
FT                   DQTGDKSSFTLLYDPVSPSSRASPSNGQFHQNKPQTSDVMTDHAGGARVALSARSSSRT
FT                   PRRLSGSTATSSVSEAETGPSSIGRIGVCALDVKARSKPSQNILTRLQAKGGFEVIVFG
FT                   DKVILDEAVENWPVCDFLIAFFSDGFPLEKAIAYARLRKPFCVNDLPMQKVLWDRRLCL
FT                   RILDHMNVPTPKRLEVNRDGGPRLESPELAQHVYRLTGVKLEGPEDGTGGGSQKTQVVT
FT                   MSEDGEALIVDGKSIRKPFVEKPVNGENHNIHIYFPNDHQYGGGGRRLFRKVGNKSSEY
FT                   DPHLVVPRSVTEKDTSYIYEQFLRVDNSEDVKAYTVGPDFCHAETRKSPVVDGVVRRNT
FT                   HGKELRYITKLSQDEAAIASKISNGFGQRICGFDMLRVGDKSYVIDVNGWSFVKDNNDY
FT                   YDKCASILSDMFLNEKRKREGLQRSLEMVSPDTSHHVRHSVSHRHTLKTLLKSPSTSKL
FT                   YGGHKSLDNSFQDLAALPPASCGAESMDYKRSRTSPDARQIDSDIGDLDQKNRELTGHP
FT                   DETIPPPPPPASKHSWKLKGMVAVIRHADRTPKQKFKFTFHSQPFIDLLKGHQEEVVIK
FT                   GQAALASVSEAVRLAMDQKLEDMEKLKLLRTSLEKKGGWPGTKVQIKPMFRKRTQEELS
FT                   MHSSENSNSDGAQINWTQVADDASGDKENFPRTSTRSDSISGTTFSRFSAAENDLILDK
FT                   LQLVIKWGGEPTHAARYQSQDLGLNMRDDLKLMNKEALNNVRIFTSSERRVSTSAQIWA
FT                   CSFLDQKELPDDFIQVRKDLLDDSNAAKDVMDKVKKKLKLLLREGSAPSQFTWPKDNIP
FT                   EPSVVLATVVELMKFHRNVMRHNFEKLNNSPHCASSISPLSDNPTSQDVIQGTVSPTLT
FT                   SIQGRWCTGEDPMLFKERWEKLFAEFCDTEKVDPSKLSELYDSMKFDALHNRHFLEWVF
FT                   MPPDEGTNEHERHSSNSNNTNRHDLAEDRLPGHDSITSEGIEENVENPTLSHLLRFKKR
FT                   AHAFDSIPHLRALDDSYDHYFKLYPGSSPTKTKMDGRLSKLRELYKLAKVLFDYVTPQE
FT                   YGITDSEKLEIGLLTSLPLLQEIVRDLEEVQASPDAKSFFYFTKESHIYTLLNCIIEGG
FT                   IQTKIARSAIPELDYLSQICFELYEAKDCESSTSSYSIRISISPGCHAFDPLDVQLDSR
FT                   HAIGCAPRRSLTAHQDWKEVIETLKAKFDTVKLPKTFIAVNLSDKHVSSYISLPSCM"
FT   CDS_pept        join(1232905..1233027,1233095..1234591,1234644..1234901,
FT                   1234960..1235652)
FT                   /codon_start=1
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207926"
FT                   /orf_name="AFUA_3G04310"
FT                   /product="SnoRNA binding protein, putative "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="EAL86710.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG053553"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000051EB85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW7"
FT                   /transl_table=1
FT                   /translation="MPSLDEDEFRVPLPKRQKRIPEFQPINSAKTLESRIFSPYRTLGL
FT                   VSPTAVPFTHVRLGKSTFQITTCVGRALHTYDLRRGLSLIFVSRPQTPEAITATFAWRE
FT                   KVFAAWGNLRPGTCGGIWVFKRGKKVAALEVPSGRAGPIIKVLVFGAWIVGCTGTSIEV
FT                   WKNTTYEHYTTLIPHGIEAVSGDHIYGGQMCSMPTYINKVFVGRVDGCVDIWNVRTGQL
FT                   LHTIPAAWPSVGAVTALQPTPVLSHIAIAHADGSLFIRNVDTEQIILSLRSGSSHITSL
FT                   AFRTDSLGAGADGQSPGVLATASADSGDITLWDLNNAGRVTGVLRNAHRTLQNEIASGV
FT                   NCVDFLDGQPLLVSTGKDNSLRTWIFDETPFSPIPRQLHFRSGHSAPVTVLSFLPSATD
FT                   GSEANGKWLLSASKDCSLWGLSVRKDSQNTEISQGAVEKKAKKMSAQGPVSLDIQHRTQ
FT                   GVRASEITCIACSLNRDGGMGVTTSGPIWANPRAADAAASNKTGWESIITGHRGDKFAR
FT                   TWFWGRKRAGRWTFETSDGSVVKSVAITQCGTFALIGSSMGSIDVFNLQSGQHRQCFPA
FT                   RGLKSRRTGELGLANGSQEKNIGHTKAVTGLVVDSLNRTAISCGLDGKVKFWDFHSGLL
FT                   LDELDWHPMTAITGLRYNSSSDLVAFSCDDLSIRVVDIETRKLIREFWGCVGQINDFIF
FT                   SNDSRWIVAASMDSRVRVWDLSTGHLIDIFRVPSTCTSLSMSATGEFLATAHSDNVGIR
FT                   LWTNRSLFIPISTQNLDESVFADSHIPITSAEESAGALEAAFAEEDHQDEAEGPVLCDE
FT                   QLSTEMVTLSAIPRSRWQTLLHLDLIRVWSHASSTICFIIADCC"
FT   mobile_element  1241922..1242806
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1242935..1243138
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1243850..1244251
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1262338..1263159
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   mobile_element  1264036..1264353
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   mobile_element  1264416..1265366
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   mobile_element  1266618..1267004
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   gap             1267443..1275842
FT                   /estimated_length="8400"
FT   CDS_pept        1283799..1285058
FT                   /codon_start=1
FT                   /gene_family="HOG000193307" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265225"
FT                   /orf_name="AFUA_3G05320"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL93031.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053340"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000051E569"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWC2"
FT                   /transl_table=1
FT                   /translation="MTTSGDILKLFSKFSPRMEFSDSPSGFFGGLREIFARLALEEEMA
FT                   CRADKLEFVGYPTFGSQCDTFEDVVRPFYSVWSSFSTKKSFAWKDIHRYSDAPDRRVRR
FT                   LMEKENKRLREEGIREFNEAVRSLVAFVKKRDPRYKRGTQSEAQRRELLRQTAAAQAAK
FT                   SRAVNQAKLREHVIPDWAKSEEAEEEDVDSSGSELEQFECIICRKAFKSLNQFNAHERS
FT                   KKHVKAVKQLRWEMRAENESLNLDQYMAPYTDHVQLERCNDDSAASSFSREESGKVQCG
FT                   GNASDQNIAPIMEDTQEERGREFTKADTIFPVTHTSRDSSNSSATILNPTGSDDISERA
FT                   DDAVDLLCKKLSASSLGQSQSTEIKKTSKAKQKRARKAAQQARVHHAGLICTTCNAAFP
FT                   SKTQLFAHLRKYDHAQPPIR"
FT   CDS_pept        join(complement(1285893..1287493),
FT                   complement(1285366..1285789))
FT                   /codon_start=1
FT                   /gene_family="HOG000193308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265226"
FT                   /orf_name="AFUA_3G05330"
FT                   /product="R3H and G-patch domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL93030.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG053339"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI000052065C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWC3"
FT                   /transl_table=1
FT                   /translation="MNSLVAAHRHPQLSMQQEARNTEERNIWRMGTNLRHQAVQFVSAG
FT                   IQENDDRNEESLDMQREEMAITPPKLPPEQSNGDSMRYPPPTTIAPDGENATDTEHINH
FT                   IATRGDNTSEDEIVFTGRHLKAKYARGPSDRNRSPISCPSKKNNAGSLAHRKEHENPDY
FT                   RRGHEPSPQSHGSTHPWLPHHSHKIPTQSCATTEDALGHLLHATESTLPERTDQIQPRA
FT                   IDETVDFIPFKSTHASIREQYSRLSEEEENDILTDYIANIDDDYGDYCQWTELCRSTST
FT                   ESENGRMDRSANTLVSAELVNVNCCGPPNNGERIISCERGQMLTECEDESDPDLTWRGM
FT                   PSQLHPNSYLMLKSPGFTAKSNGFAVLCTSLPDKHSTTGSSECSDFKTKGIGKHSEIET
FT                   ESNFLSRPHRNHNKAKRNHFASATAFADALESDPFYGFDIMDFNRPSLRNKTKGNQRAF
FT                   DLSLSDSELELQLERAWRNDREKKKTRKQKREELRAGGLLGRTANAPDLRAKYSSGFDV
FT                   DDLRSELRSFLLSSKERKAVHDMAGALSLKSQSRGKGSSRFPMLYKTSRTPKHTQKTIA
FT                   QVEKILSKPQFSHRGPKARTQNNKKLAKASRGRPTSSVSYMEGDVVGASAPEIGAENKG
FT                   RAMLERMGWSSGTPLGAINNKGILLPVAHVVKNSKAGLG"
FT   CDS_pept        join(1289282..1289466,1289523..1289853,1290006..1290170)
FT                   /codon_start=1
FT                   /gene_family="HOG000217217" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056624"
FT                   /orf_name="AFUA_3G05340"
FT                   /product="Autophagy cysteine endopeptidase Atg4, putative "
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL93029.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG053338"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="UniParc:UPI000051EA1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWC4"
FT                   /transl_table=1
FT                   /translation="MTDDTADVYEDKFLDAANDGRGSFRPTLILIGTRLGIDRITPVYW
FT                   DAVKTTLQLPQSVGIAGGRPSASHYFVGVQGSHLFYLDPHQTRPALPQRNIDDPYTDEE
FT                   IETYHTRRLRRIHIRDMDPSMLIGFIIKDREDWAHWKSGVSAQEKPIVHVLSESNTAVF
FT                   KGREGAIDEIPISGRGRKIVQPAPKSELCYTAFSSRMNHEHIQPKGHQQVKKKGKISNH
FT                   PMTH"
FT   CDS_pept        join(complement(1290688..1290859),
FT                   complement(1290566..1290637),complement(1290425..1290512),
FT                   complement(1290284..1290374))
FT                   /codon_start=1
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265227"
FT                   /gene_name="htb1"
FT                   /orf_name="AFUA_3G05350"
FT                   /product="Histone H2B"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL93028.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000051EEC2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WWC5"
FT                   /transl_table=1
FT                   /translation="MPPKAAEKKPSTGGKAPAGKAPAEKKEAGKKTAAAATGDKKKRGK
FT                   TRKETYSSYIYKVLKQVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTIS
FT                   SREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSAK"
FT   mat_peptide     join(complement(1290688..1290856),
FT                   complement(1290566..1290637),complement(1290425..1290512),
FT                   complement(1290287..1290374))
FT                   /product="Histone H2B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WWC5 "
FT   CDS_pept        join(1291520..1291572,1291628..1291716,1291788..1292443)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265228"
FT                   /gene_name="hta1"
FT                   /orf_name="AFUA_3G05360"
FT                   /product="Histone H2A"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL93027.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG053337"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000051EEBD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WWC6"
FT                   /transl_table=1
FT                   /translation="MTGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQRV
FT                   GAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTI
FT                   AQGGVLPNIHQSRFRTLFSSSLYFLTNFQTFYQRRLLRVERVLARSFNCPIFLSFLFGF
FT                   LNRRALVSHDVITGFWTGHNYGSVFHAFTYGCTLCLRALNDTDSFLNEICLSETMGILV
FT                   NLTLSRHKGLYLQSFLQYTTKAFLHFNINVQSNVQDRSFEVRY"
FT   CDS_pept        join(1293761..1294013,1294061..1294116,1294181..1294516,
FT                   1294604..1294996,1295051..1295110,1295159..1295213,
FT                   1295265..1295332,1295385..1295456,1295512..1295556)
FT                   /codon_start=1
FT                   /gene_family="HOG000281563" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265229"
FT                   /orf_name="AFUA_3G05370"
FT                   /product="Dihydrolipoamide succinyltransferase, putative "
FT                   /EC_number="2.3.1.61"
FT                   /function="dihydrolipoyllysine-residue succinyltransferase
FT                   activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="oxoglutarate dehydrogenase complex "
FT                   /protein_id="EAL93026.1"
FT                   /db_xref="GO:0004149"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0045252"
FT                   /db_xref="HOGENOM:HBG395225"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000051E7D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWC7"
FT                   /transl_table=1
FT                   /translation="MLRSWGKEVRAHYAALADRRHSIEPIYPGAVSPASAAIRSEITVS
FT                   QFALDSMTLFADLAAADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKI
FT                   DVSVNAPESGTIKELLVNEEDTVTVGQDLVKLELGGAPGPKEETATEKPKEPADVGKRP
FT                   PVESNKPQPSEAPKASSPPPEQPPTAKPQPPAPKSDSPSDVKPSFEGREERRVKMNRMR
FT                   LRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVL
FT                   AMKDVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAI
FT                   ADLGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDRPTVV
FT                   NGKVEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG"
FT   CDS_pept        join(complement(1297737..1297762),
FT                   complement(1295748..1296492))
FT                   /codon_start=1
FT                   /gene_family="HOG000193330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265230"
FT                   /orf_name="AFUA_3G05380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL93025.1"
FT                   /db_xref="HOGENOM:HBG053336"
FT                   /db_xref="UniParc:UPI000051FB0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWC8"
FT                   /transl_table=1
FT                   /translation="MDRLAPPERPHFVVYHSALAPTLIHAETMSQDMRIKLQLLNFITT
FT                   CNQDQYHSTPANSQSPPHGFGEQKEGCALSTDRQEYPPHSKPLAQRPHLDTNNDRTQPT
FT                   PDIGSAIAYAFISLCIVANDHLPNTNWADIAAQLMLKAASEKHSSHGSTTPDIFYELIA
FT                   QAPESVKKWPEWQRVADKYETYLQPPFRVLPSRDLETALQRPPTHRLGTIIIEFLFDLM
FT                   RRLSPPILLQLERGKLCGLSRAETQGLKTKVGLR"
FT   CDS_pept        join(1297892..1297993,1298099..1298728)
FT                   /codon_start=1
FT                   /gene_family="HOG000257189" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265231"
FT                   /orf_name="AFUA_3G05390"
FT                   /product="Protein-L-isoaspartate O-methyltransferase "
FT                   /EC_number="2.1.1.77"
FT                   /function="protein-L-isoaspartate (D-aspartate) O-
FT                   methyltransferase activity"
FT                   /protein_id="EAL93024.1"
FT                   /db_xref="GO:0004719"
FT                   /db_xref="HOGENOM:HBG215016"
FT                   /db_xref="HOGENOM:HBG699907"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="UniParc:UPI000051F606"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWC9"
FT                   /transl_table=1
FT                   /translation="MAWYCSGTTNAELIENLSKEGLIKNDRVKKAMMGVDRAHYAPSRP
FT                   YSDSPQPIGHGATISAPHMHGHACEYLVEFIKPGSRVLDIGSGSGYLTHVFANLVTDRS
FT                   TNDASGQVIGVDHIPELVDLALANMSKSEQGRTLLNSGKVKFITADGRLGWREGAPYDA
FT                   IHVGAAADKLHPVLIEQLRAPGRLFIPVDVENDDGPLSSLGLGGGQYIWVVDKKEDGSV
FT                   HKEKIFQVSYVPLTDAPKRSA"
FT   CDS_pept        join(complement(1299717..1300694),
FT                   complement(1299062..1299652))
FT                   /codon_start=1
FT                   /gene_family="HOG000193351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056625"
FT                   /orf_name="AFUA_3G05400"
FT                   /product="DnaJ and TPR domain protein "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL93023.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG270192"
FT                   /db_xref="HOGENOM:HBG325852"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00005203FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD0"
FT                   /transl_table=1
FT                   /translation="MLITLESFTVLLACFSVACGLQSAEIPPDTPLASLVASAKAHLAS
FT                   GSARDALLYFDAAVSRDPSNYLTIFQRGAAYLSLGRTAQALDDFDRVLQLKPDFESALL
FT                   QRARLRTKTADWDGALHDFERAGKRLSDEYRETQEARDAAFQAFDAEKQGAWDDCVGRA
FT                   NTAISKASTSLSLRQTRAHCRFEKGEVEEGISDLVHVLQLSPGLIEPHLQISSMLFYAL
FT                   GDSERGISQIRKCLHSDPDSKACAQLYKKERQLIKRLEKLQKAMDSRKFNNAINLLVGV
FT                   GDEKGLLNEVKDEFESAREAGHIHPGAPTNLHSSLVERTCEAYREVGMLKRAAPYCTEI
FT                   LRLKPHSLAALLFKGQIALDEERFEDAIRTLNEAREHHPGSQEVQTLMQKAHVLLKRFK
FT                   HKDYYKVLGVSRDSDERTIKRAYRQLTKQHHPDKAVSQGVSKEEAEKKMAAINEAYEVL
FT                   SDPELRARYDNGDDPNDPESQRGNPFQGNPFGAAGGQQFFFQQGAPHFKFSGQGFNFPR
FT                   GFPFR"
FT   CDS_pept        1301929..1302699
FT                   /codon_start=1
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207927"
FT                   /orf_name="AFUA_3G05410"
FT                   /product="Mitochondrial translation release factor (RF-1),
FT                   putative"
FT                   /function="translation release factor activity "
FT                   /protein_id="EAL93022.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="HOGENOM:HBG266905"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI0000520683"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD1"
FT                   /transl_table=1
FT                   /translation="MYTAFCSRRGLQSNVIKLDVQDGPSDDRLSEAVVEIDADGAYDLL
FT                   RTESGVHRVQRVPATETKGRTHTSAVSVMVLPSFPEAGPSMDSALNFDDPNSDYYVDPQ
FT                   EVRTEKMRASGAGGQHVNKTESAIRLTHIPTGIVVSMQDSRSQHANRKKAWQVLRAKLA
FT                   EARQEAREQELVELRRGVLGGVARMGRGDKIRTYNYGQSRCTDHRSGITVHNLDNVLDG
FT                   GESLETIMDSVRTWLADQEIAAISAENSINAVGK"
FT   CDS_pept        join(complement(1304283..1304315),
FT                   complement(1304174..1304228),complement(1304091..1304111),
FT                   complement(1303909..1304040),complement(1303685..1303832),
FT                   complement(1303327..1303584),complement(1303208..1303243),
FT                   complement(1303001..1303150),complement(1302885..1302942))
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265232"
FT                   /orf_name="AFUA_3G05420"
FT                   /product="Mitochondrial tricarboxylate transporter (Ctp),
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL93021.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000F51997"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD2"
FT                   /transl_table=1
FT                   /translation="MVTAEKDPKSKPSSLRSIIAGSSAGAVEIAITYPAEFAKTRSQLN
FT                   RRLPDAKKLPWPPFGKQWYAGCTTLIIGNSLKAGIRFVAFDTFKSLLQDENGNISGPRT
FT                   VIAGFGAGFTESLLAVTPFESIKTQLIDDRKSPNPRMRGFLHGSKIIFQERGLRGFFQG
FT                   FVPTTARQAANSATRFSSYTMLKQLAQGYVAPGEKLGTASTFALGGIAGLITVYVTQPL
FT                   DTVKTRMQSLEASKNYKNSFVCAARIFKDEGLLTFWSGAVPRLARLIMSGGIVFTMYEK
FT                   TMEALDAIDPERKYI"
FT   CDS_pept        join(complement(1307402..1307445),
FT                   complement(1307261..1307333),complement(1306605..1307201),
FT                   complement(1305739..1306548))
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751294"
FT                   /gene_name="dhh1"
FT                   /orf_name="AFUA_3G05430"
FT                   /product="ATP-dependent RNA helicase dhh1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasmic mRNA processing body "
FT                   /protein_id="EAL93020.1"
FT                   /db_xref="GO:0000932"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051F3B6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WWD3"
FT                   /transl_table=1
FT                   /translation="MADALANQLNNTNLGEANSELRWKEQLNMPAKDARPQTEDVTATK
FT                   GLEFEDFYIKRELMMGIFEAGFEKPSPIQEETIPVALTGRDILARAKNGTGKTAAFVIP
FT                   TLERINPKSTKTQALILVPTRELALQTSQVCKTLGKHLGINVMVTTGGTGLMDDIIRLN
FT                   DAVHILVGTPGRVLDLASKGVADLSECPTFVMDEADKLLSPEFTPVIEQLLSFHPKDRQ
FT                   VMLFSATFPLIVKSFKDKHMRNPYEINLMDELTLRGITQYYAFVEEKQKVHCLNTLFSK
FT                   LQINQSIIFCNSTNRVELLAKKITELGYSCFYSHARMLQQHRNRVFHDFRNGVCRNLVC
FT                   SDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKI
FT                   EQELGTEIQPIPQNIDKKLYVYDSPETIPRPISNPSQQRQITNTAANTSTTDRRHHNPP
FT                   NSGQYQFNRGRGSYRGRGQGQRRSAQIESNKFGHPQGQHSGKTSTAPVS"
FT   CDS_pept        join(complement(1312090..1312631),
FT                   complement(1311490..1312034),complement(1311297..1311455),
FT                   complement(1310624..1311200),complement(1310475..1310544),
FT                   complement(1310116..1310381),complement(1309400..1310056),
FT                   complement(1309246..1309348),complement(1308838..1308977),
FT                   complement(1308736..1308784),complement(1308582..1308679),
FT                   complement(1308486..1308528))
FT                   /codon_start=1
FT                   /gene_family="HOG000193352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207928"
FT                   /orf_name="AFUA_3G05440"
FT                   /product="DNA repair protein Rad18, putative "
FT                   /function="ATP binding"
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL93019.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="HOGENOM:HBG053335"
FT                   /db_xref="HOGENOM:HBG325849"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="UniParc:UPI000051F155"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD4"
FT                   /transl_table=1
FT                   /translation="MMASAKRLQASQDPESFNDESNGTSLTSTSVRLPYMLCIQQLNLV
FT                   IQRKRIRRSETSRSEEDNESSDAETTRSCSITEALDDDEDELELRATQAIQEKYSFVNE
FT                   EPNIPAEHGILERVECYNFMCHDHFRVELGPLINFIVGKNGSGKSAVLTAITLCLGGKA
FT                   SATNRGQSLKSFIKEGKESATIIVRLKNQGDGAFMPDDYGKSIIIERHFSKNGTSGFKI
FT                   KAENGRIISTKKAELDSIIDYFTLQFDNPMNVLSQDMARQFLSTSSPADKYRFFVKGVQ
FT                   LEQLDQDYRLIEESADQIEEKLRNREQDIKILRDLKDTADRRLEKSDQQESLRSRIRNV
FT                   RNQVAWAQVEEQEKASHTVFGANSLEGELARTDREIAAAEAQLSEFDINIQDTERECAA
FT                   AAEFLNQTTSRLGQAETSDSLAQAEQRQIKEYLRTTETRIRETQNQIADENRRLADLSG
FT                   GSYSRKEEQVQQAKIEAAEIRKQCEEHQQSARQLYQEAEEAEIAVKLAAAPIDKMKAEV
FT                   DQAESNLRSLSREGIRRTGFHERMPALLKEVETERSFSRKPVGPIGSYVSLLKPEWSSI
FT                   LENALGTTLNSFIVTSKRDMNILSHIMQRVGCDGHIDTSEHEPEPHYDTALRVLQIDNE
FT                   LVRRQLIINHGIEQMLLIERLEDASSVLFDGQRPKNVKRCYCIDRTDRRRGIHLSYSRT
FT                   GDPIQAPVQAYNGSPRMRSDLESQIRIQRDVVAGLRRELSNQEQQLRSARSRLESCKQA
FT                   IERHKRRSKELQVLLQRQEDQVEELTDALERETVEDGHLDVLRTTLQEAEAEKHLNEGS
FT                   LKDSVDAMDAIMRKLKATKQELSAKDAEISTLQEELRVAQGEEHLVQDKRRKIIGLKNT
FT                   AIERVNDIKLNRTRIQQEKDRVAARVVEYEEKASLVSPRVAIDEGETANSLSKKLERLH
FT                   GDLQRSNQQLGGSRDEIAAEVERATAAYQRAMKQIEEFRLLADVEPDITKDSAGRGAKT
FT                   LSGGEKSFSQVCLLLALWEAMGSPVRCLDEFDVYMDHINRKMAIDMLMLAARRSIGRQF
FT                   ILITPGSRAEITLAPDVRVKELAEPERGQMRLLF"
FT   CDS_pept        join(complement(1314917..1314948),
FT                   complement(1314814..1314845),complement(1314695..1314762),
FT                   complement(1313519..1314636),complement(1313258..1313444))
FT                   /codon_start=1
FT                   /gene_family="HOG000216709" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056626"
FT                   /orf_name="AFUA_3G05450"
FT                   /product="Glutamate carboxypeptidase, putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="carboxypeptidase activity"
FT                   /protein_id="EAL93018.1"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="HOGENOM:HBG146302"
FT                   /db_xref="HOGENOM:HBG690347"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniParc:UPI000051EEC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD5"
FT                   /transl_table=1
FT                   /translation="MAPQLEPFFKQVDELSNSFIDRLRKAVAIPSISAHDENRKDVFRM
FT                   AHFLASELEALGAEVEQRPLGKQPGKEHLDLPPVVIARYGNDKNKRTILVYGHYDVQPA
FT                   LKDDGWATEPFELTIDDQGRMFGRGSTDDKGPVLGWLNVIEAHQKAGVELPVNLLCCFE
FT                   GMEEYGSEGLEEFIKSESKKFFKDADAVCISDNYWLGTEKPCLTYGLRGCNYYSVSISG
FT                   PAQDLHSGVFGGSTHEPMTDMVNILSKLVDPKGNILIPGIMDLVAPLTEEENSLYSKIS
FT                   YTMDNLHESLGSKTNIHETKERTLMARWRYPSLSIHGIEGAFSAPGAKTVIPAKVIGKF
FT                   SIRTVPNMESDAVNKLVFDYIKAEFAKLNSKNTLDVWLQHDGKWWVASPKHWNFTAASK
FT                   AVKQVFGVEPDMTREGGSIPVTLSFEQATGKNVLLLPMGSSTDAAHSVNEKLDKKNYIE
FT                   GTKLLGAYLHYVAEEPASEV"
FT   CDS_pept        complement(1315564..1316169)
FT                   /codon_start=1
FT                   /gene_family="HOG000193363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207929"
FT                   /orf_name="AFUA_3G05460"
FT                   /product="60S ribosomal protein L20, putative "
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL93017.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG053333"
FT                   /db_xref="HOGENOM:HBG325848"
FT                   /db_xref="UniParc:UPI000051FD42"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD6"
FT                   /transl_table=1
FT                   /translation="MATFSAVSRRPFIALPFLIPSCEPVALELRRNQSSYRRTKQRLRV
FT                   KPDASFGFSSDQTQDHIIFNPPSSAPSVFHTPTKFLPPDDARRTLRTDVSMKSDQNPEN
FT                   LPPVFNSPTEKKYHLTPSDIEEIRKLRLSDPMTWSRWKLAKRFDCSPMFIGMVCEASPQ
FT                   KKEIQRQVLEAVQSRWGLKRRMAREDRQLRKESWGKDE"
FT   CDS_pept        1317966..1319024
FT                   /codon_start=1
FT                   /gene_family="HOG000217216" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903361"
FT                   /orf_name="AFUA_3G05470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL93016.1"
FT                   /db_xref="HOGENOM:HBG053332"
FT                   /db_xref="UniParc:UPI000051F602"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD7"
FT                   /transl_table=1
FT                   /translation="MDTQDCPDSMIHGQGSSHLNEESIRTCGQRGDIQDTSFDKFQSNV
FT                   TDQSRIERERQRHLREEHKIGNSDQIASAALPGTHVSAADERPKSPDKYPSLSYRSRHL
FT                   SRSASPDCIDQSDPRISSLSPSSIFERDVQKDLLSVHTSPSIPSHISMENHIPPVLEAS
FT                   SVAITDDRLSPDTVEIVTHNVHQSATAGVCGAFAVEPSLPSTCFEHFRDGSEDLEEPHL
FT                   PCKALESTNVRRLSFVSFADVVNAEHAEATDFLSSRGSSHQSPSIRNSSPSPLRSPRLL
FT                   HELDTYPVTSTPNPIKASDLSSSREDFAAGSPRLAAQSSIYPNVGGEFSIETMRQALRR
FT                   TGSQDLIISKDN"
FT   CDS_pept        join(complement(1320108..1321446),
FT                   complement(1319864..1320051))
FT                   /codon_start=1
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751295"
FT                   /orf_name="AFUA_3G05480"
FT                   /product="Cystathionine gamma-synthase, putative "
FT                   /EC_number="4.4.1.8"
FT                   /function="cystathionine beta-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL93015.1"
FT                   /db_xref="GO:0004121"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG262693"
FT                   /db_xref="HOGENOM:HBG634482"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051FD67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD8"
FT                   /transl_table=1
FT                   /translation="MKCGYPRFFIHPVIQDLATEVVKLHGNPKTETASLFPSLKTASVC
FT                   RSFILSRISSQESPRIRIVNFVPAPHTESRPQTIRSPLSCVIYPTEYASIAKQVWQHSG
FT                   NGISSRRGEFCLSALRDGFLVEDKEPAQVDQSSQKFSKGPRRYQGRGSANEIVRGGSVP
FT                   ASTPDLSAENTETQDSCEYAQFIEERFGRNLSVLLADQAKQAVRRRIAGVLTANVDLSE
FT                   ALNEASGEGRVAGLTDSDVFLFPSGMSSIFNTHQILLATRGPLKSICFGFPYIDTLKTL
FT                   EKWGPGCLFYGHGSAEDLDDLESRLEAGERFLALFTEFPGNPLLKSPDLKRIYALAQKY
FT                   DFAVVVDETVGNFLNINVLPYADIVVSSLTKVFSGDSNVMGGSAVINPHGRYYQELRAT
FT                   FSRDYEDNLWAEDAVFLERNSRDFVSRIEKINKTTEDITALLKESPVVKEVYYPKYNNS
FT                   RVFYEDFRTPSGGYGGLFSITFHSDAEAIAFFDHLEVLKGPSLGTNFTLR"
FT   CDS_pept        1322287..1325640
FT                   /codon_start=1
FT                   /gene_family="HOG000193385" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056627"
FT                   /orf_name="AFUA_3G05490"
FT                   /product="Pre-rRNA processing protein Utp22 "
FT                   /protein_id="EAL93014.1"
FT                   /db_xref="HOGENOM:HBG058708"
FT                   /db_xref="HOGENOM:HBG325847"
FT                   /db_xref="InterPro:IPR005554"
FT                   /db_xref="UniParc:UPI000051F3B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWD9"
FT                   /transl_table=1
FT                   /translation="MSAHTAKRRKLSPRPENGSTQKFSSDGRDAELSKSIRSNRKVQDD
FT                   RAGELAIASGLYKSSFFKLQLDELLSSSKPNYDKQVSRVQDTLHRVKEAIEQLHERPPM
FT                   LPCEAERELRTTHGIVVPFPDPRPSRETKYSVSYVPPTNINVVGSFASKTGIKQTEKYT
FT                   IDLAVTMPRSLFQEKDYVNYRFFHKRAYYIACLAAGLREAQDLGLDVKFATQEGDSLRP
FT                   VLILEPSSATSALALARSQIRVITAIEDDLFPISRTLPTKNNVRHVSRENTGNSEPTPF
FT                   YNSALRSEATVGSYHKHLHSTIRQCDAYQDACLLGRIWLRQRGFASSFHMGGFGGFEWA
FT                   LLMSLLLEGGGANGKPVLLKSYSCYQLFKATIQFLAGRDFTKPLLFSTVDEVSFPGDGP
FT                   VVYDGKRGINILYKMTPWSYAFLRHEAGMTLKMLNESRDDNFEKVFIVKVNEPMLRFDR
FT                   IIVLPSFDNRNILQAIRNQRAIYGVLLRALGDRVKLIHISSRSIEPWSVLASPSSKKLK
FT                   ERISVGLLMNPENVSRVVDHGPSAEQKEEAASFRSFWGEKAELRRFKDGSILESLVWSD
FT                   HPSSKSIVFQILSYILRRHFNFVDEDIHYIGDEFEERLNSYGSGIISYTSPSFQLIADA
FT                   FSSLEKSIQDMEGVPLTVRHLAPASPLLRYAALRVQHPSSISGERVDVVLQFESSARWP
FT                   DDLVAIQMTKVAFLVKIGDCLESSGVATSCRVGLENETSRILNNAYLDIFHASGVVFRL
FT                   RIHHDREQTLLERLLKQKGESAQAKQEVAYALAMYKRTFLQSPRLTQAIRTLCTRHPLL
FT                   SPTVRLLKHWFLCHLFKGHVCDELMELFAVRVFTQSYPWDTPSSVMAGFLRTLHLLSRW
FT                   DWQQEPLMVDLGGQLDQNAVEVIRTRFAAWRKIDPAMNNVALFVASDIDTDGISWTQYG
FT                   MPSKVVAARMSSLAKAAVRLMREKGYALDVSDLFHTSLAPYDFVLSLRSKALTELLAPP
FT                   PSSSSSSSSSRFKNLQQQIIPERADKLTVARTFVRELQACFSPNILFFHGDEQCDVIAG
FT                   LWNPSTVKPKVWSLKMTYSTKPVALVKPEVKGSEDVSINQTAILNEIARLGAHLIEGID
FT                   VYNEDAENSA"
FT   CDS_pept        join(complement(1329300..1329790),
FT                   complement(1326128..1329106),complement(1325845..1326046))
FT                   /codon_start=1
FT                   /gene_family="HOG000193396" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265233"
FT                   /orf_name="AFUA_3G05500"
FT                   /product="Nuclear envelope pore membrane protein, putative "
FT                   /protein_id="EAL93013.1"
FT                   /db_xref="HOGENOM:HBG059451"
FT                   /db_xref="HOGENOM:HBG325846"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniParc:UPI000051F84D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE0"
FT                   /transl_table=1
FT                   /translation="MNGTPRLRSAFPQTPQTLQRTREYNITPTRPKPRDVGLRRSPVKV
FT                   PQTKADAPLVPTGVIDAPSQRLYVVAFYIALNAWRVYESWTASDELDSTWLFLKWTSID
FT                   GVFLFGLQALRIPWLEWAFPTTLAIFLIHVVGNMFLMFQIPVRILPCRTMVDLLTPRRF
FT                   HSAVLNPDQIPFCLDSQRSTVNLPIRVNQTDPVLIELLRLDLSTGENETITISSKQLKQ
FT                   MKRQAGKKLSSSDAPEHRDILYPIRRTGIYRLQRVVDESNLEVRMRSSDALVVSCPRAL
FT                   IKNSHTHKCKGELSNLVLEVEGTPPLKIKYSRQVNKLDRGFSFQNIQPDHLRSPLLGQR
FT                   SSGILFDAEQPEITWAQSQTIEVPLNESLNVGGEWFYNIEEVHDGCGNIANYSTLLDEA
FT                   DRSSPKSLPHWHQFSVHERPRLSLSGCDDQHFIEVAKGEHVNLPLKFHPVGQGYDYDGP
FT                   FSLGYSFRGNELDERDSSDKVRQLSLKDLDQKPQIKESGWYMLNSISSQFCSGEILEPS
FT                   SCYLHNPPEPELALKYEKIFDKCANNSVGLLLDLDLTGSPPFRLRYSIEHSKGVETKSL
FT                   TVDGLRTQLDFTPSEAGFYRYRFLDIADTVYAPRSLKDKVPVLEQDVKPPASAHFLGSR
FT                   EVRRACFGEPVSIDVSFLGESPWTLHYELAHNGKKSKHVLESHAEIATIVTERLVSGGE
FT                   YNLVLTSVKDRSNCKRTLKDSIRIDARSKPPHVSFGQIDKKRTVSALQGAKVDIPLRLS
FT                   GERPWTVNYRNLDDDSPAIEKTFWQENSVLSVTQEGHYNLIGVTDSSCPGSVDQAARDF
FT                   EVSWIPRPHIAAVDGSPVVIGSPIEKRDVCQGEDDSVELRLTGNPPYTIQCEQQRKMGR
FT                   GTSSIRTRSLKTALHVTSMEMDTSEAGLYTYKFKEVGDSLYDYDPRSEPVLVTQRVNPL
FT                   PSARFNSPGHIYGFCKEDVSGEESIPVTLEGVAPFFLEIIIKHHSNAKPEVVSIPNISS
FT                   NRYNLPIPRRYLNLGQHVVSIHKVRDARGCQRTFENDASTVRVAVSDVPTIIPLESKID
FT                   YCVGERLSFSLSGHAPFDVFYTFDGVSRKATSRTTNFRRIAERPGIFTITAVSDGASGK
FT                   CKAHKNITKTIHEMPSVRISRGQTSVVDIHEGGEAELQFEFWGTPPFEFTYIRSSIPRK
FT                   GKKSEVLDIKHDISYEHRKTIKTSDEGTYEVVAIKDKFCSFSSQAQVEKPQKLLAGA"
FT   CDS_pept        join(1331511..1331800,1331899..1332083,1332176..1332687)
FT                   /codon_start=1
FT                   /gene_family="HOG000193407" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056628"
FT                   /orf_name="AFUA_3G05510"
FT                   /product="Ubiquitin C-terminal hydrolase 37 "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL93012.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG053331"
FT                   /db_xref="HOGENOM:HBG325845"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI000051F618"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE1"
FT                   /transl_table=1
FT                   /translation="MILINRKQAAQKGFGLQTRSVSLYVSYSFPLTYLAKTASNACASV
FT                   ALLNIVNNIEGVDLGENLRHFREFTMPFTPALRGDAINNFEFVKRIHNSFARKMDILNS
FT                   DLQLKVEATSKRSRSGKDRHDEFETDAGFHFIAFVPALGKVWKFDGLERQPQALVRPNI
FT                   LTRMAEYEEDQIEFSILSVAKDPLVELEDKLAINVKCLEAVNRWLASREQAEGTCPGPE
FT                   NPVSLLENTILGPDSSFNLTRHRIDAVTIPPEREVQYAKASAEELRQHRYWLSNEQREL
FT                   RASILEEQQSHWADDNYATGRRYDYGPAVRAWIRFLARKRVIESLTR"
FT   CDS_pept        1334516..1335391
FT                   /codon_start=1
FT                   /gene_family="HOG000193418" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265234"
FT                   /orf_name="AFUA_3G05520"
FT                   /product="Oxysterol binding protein (Orp8), putative "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="EAL93011.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG053330"
FT                   /db_xref="HOGENOM:HBG325844"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00005201AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE2"
FT                   /transl_table=1
FT                   /translation="MDDGDHGKAVKICYLTEQTSHHPPVSAFFIDCPERGVSARGFDQL
FT                   SAKFTGTSIRVAPGQHNLGIFVNIEKRDNEEYQLTHPSAHLGGLLRGALAVSVSDTCFI
FT                   TCSKTRIKVILQYLEEGWIGRAQNKVEGLIFRYDPNQDTITRIKDVPDGDVLARISGSW
FT                   HGEIYYTVAGTAEPRLLIDVTPLFPVPKTLPPEEDQLSNESLKFWAGVTKAIKEKRYSE
FT                   ATRLKQEIEERQREKAAERQQKNESWQPRFFTGSVTPMGRPELTEEGYTALQGLRNGDY
FT                   KLAESEIKGA"
FT   CDS_pept        join(complement(1339041..1339841),
FT                   complement(1336202..1338583),complement(1335955..1336128))
FT                   /codon_start=1
FT                   /gene_family="HOG000193429" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265235"
FT                   /orf_name="AFUA_3G05530"
FT                   /product="Condensin complex subunit 1 "
FT                   /function="binding"
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome condensation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL93010.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0030261"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG053329"
FT                   /db_xref="HOGENOM:HBG325843"
FT                   /db_xref="InterPro:IPR007673"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051EEB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE3"
FT                   /transl_table=1
FT                   /translation="MEDRIQFDINESLKYYLSDPASVPTNDADPELLDCESDLEHLTPA
FT                   LIDNVLNPIVDAVAESPEALARQSFFDSLQFLLKCAMAPSSFSEFPGHGGTLSELLNSC
FT                   RYSSFLPTKSLSKLLDLIVSGLSLETDIIHGDLEAEEQDAIQHHKQLLEMYGFLLQWAL
FT                   SAVEVKAAEKPAEAAPARRGAGKSGRSKTSNRDGTWDWTAQIQISMETMCKVMKLKLSR
FT                   IFMTTSDRDTFINLFTRAIYLILESEQRVKSLAIRMHAFKVLCIASYTLRCAVVEVCGN
FT                   LIADLSRQEERSENYKTQINAFFDVLEERFLDVNPYCRCRAIQVYMRICDLEQKFPKRR
FT                   QAVAELAARSLEDKSSNVRRNAIKLLAKLVSTHPFSVMHGGQLSYKEWAARLENVDAEL
FT                   NALRPPETPGFDGGEASHVDSELLDDATQIPEDSPSKAPRMTDAEKAAAIQRAAEQAAT
FT                   SELLARLQLTRKYYNEAIRFIEVLHSASVVVSQLLSSRNKSEVIEAMDFFVVLDAYKVE
FT                   TARSGIRRMLRLIWTKGNSDEGKGVQTHLIDCYKGLFFDAPDSFGPNDAANYVARNIIS
FT                   LTFGSTPAELTCLEQLLSTMMKAGHISDAVIAKLWQVYGVQRKEISKTQRRGAIIILGM
FT                   LALADPEVVIKETEVMLRIGLGNIGRSDLLLAKYTCIALKRMVPGRQAKSKDAGIPKLA
FT                   NDHPVLSKLAAMVEIVSDSKEWYGVAEQAIGAIYTLSKHPDVLCSDILKRKTRAVFQPQ
FT                   LQRPSSTASGDEEEQRPGTASTDGQGPRPRTSSAALSQLLFIVGHIAIKQIVHLELCEL
FT                   DFKRRKAEQEKHKAANTAAHKDNQTGEDDELDLIGGTTEDDFTEAMSHIRERELLYGEN
FT                   SLLSNFGPLVAEICSNSNAYPDRNLQAAATLCMAKLMCVSAEYCEKNLPLLITIMERSE
FT                   DPTVRSNAVIALGDMAVCFNHLIDENTDFLYRRLNDDDVSVKRTCLMTLTFLILAGQVK
FT                   VKGQLGEMAKCLEDDDKRIADLARMFFTELATKDNAVYNHFVDMFSLLSAERNLEETAL
FT                   RRIVKFLIGFVEKEKHARQLAEKLAARLPRCETERQWNDVAYALSLLPHKNEDITKTIS
FT                   AGFNKVVTAKS"
FT   CDS_pept        join(1340659..1340926,1341014..1341458,1341562..1341578,
FT                   1341657..1342321)
FT                   /codon_start=1
FT                   /gene_family="HOG000193450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265236"
FT                   /orf_name="AFUA_3G05540"
FT                   /product="Cell cycle protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL93009.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG154249"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051FF80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE4"
FT                   /transl_table=1
FT                   /translation="MHAPLTGVFGLQKSGATDHHCTQAHMAVVDDGTATDSDASVDSRR
FT                   AEGDHEDEDEEEEVDDSVREDMKKLEDTFPGISDRFRLVNRIGEGTFSTVYKAEDLLYD
FT                   HYKNDWDTFQETQSSNWSSPPAKRRRVEESVTKRRKPRYVALKKIYVTSSPLRIQNELE
FT                   LLHDLRGCRSVCPLITAFRHQDQVVAVLPFFPHTDFRIQYRTFMVADMRHYFRSLFTAL
FT                   NSVHKHNILHRDIKPTLWSGGSTCLCANPNFVRRSRLLQSYYYTHCSSSTLSVGYPKND
FT                   SRPARRANRAGTRGFRAPEVLFKCTSQTTKIDMWSAGVILLTLLGRRFPFFNSADDVDA
FT                   MIEMASIFGTRRMKTAAAMHGQIFETNIPTIGEKGYGWEKLVKWASCVEELTESERQAT
FT                   RLLAGLMELDPYKRLSAREALQHEFFTNPIEHDVEWGGLPEDSADTGEDEEGDRDDDEA
FT                   DEVAMV"
FT   CDS_pept        complement(1342592..1343614)
FT                   /codon_start=1
FT                   /gene_family="HOG000193461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265237"
FT                   /orf_name="AFUA_3G05550"
FT                   /product="OTU-like cysteine protease, putative "
FT                   /function="peptidase activity"
FT                   /protein_id="EAL93008.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG508874"
FT                   /db_xref="HOGENOM:HBG736385"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI000051EA1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE5"
FT                   /transl_table=1
FT                   /translation="MRIRVRGPAGQSTVTLDDTATVNDLRAHIVEKTGLTAYDVKYGYP
FT                   DLKPLVLDGFPSEQKIRDLGISLNGEQLLVTRKEDSAPTSLPQAPSARGSQRPVSTAQD
FT                   DDDDGKVSLTRKAHEGVSDDPPEIASPEHSGTFVLRIMPDDNSCLFRAVGSAIMGGMDT
FT                   MTELRSIVAQTIQANPDVYSEAVLEKKADDYCRWIQQENSWGGAIELSILSKHFDIEIC
FT                   SIDVQTLRVDRFNEGPPTRCVLVYSGIHYDTIALSPSDPPYTHAYAPPEFDTKVFDAAD
FT                   PVVLEKALALCEILQRKHYYTDTAGFRIRCNTCGGIFIGEKGATTHATQTGHYNFGEAS
FT                   "
FT   CDS_pept        join(1344618..1344787,1344924..1345086,1345164..1346582,
FT                   1346679..1347677)
FT                   /codon_start=1
FT                   /gene_family="HOG000193462" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903362"
FT                   /orf_name="AFUA_3G05560"
FT                   /product="RSC complex subunit (RSC1), putative "
FT                   /function="DNA binding"
FT                   /protein_id="EAL93007.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG053327"
FT                   /db_xref="HOGENOM:HBG325842"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI000051FD57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE6"
FT                   /transl_table=1
FT                   /translation="MEKASEPSQTQPAPEEPVKSIEDDGKGDSSSTGGVTDEQWRSMMD
FT                   VVLAIYEFREEDGHDPSRLFQRSVNKRNVPDYYEIIKEPMALSILKQKINKREYKNFAE
FT                   FVRDCALIPHNAQTYNRPNSQAYEDALVIKVRTTRKDFDSISVGEYRGADPLSPYKDVF
FT                   IAEFEKLVKQGIITAEEAELPDLGEIPEADPLPEEEDEEDEDDDDEDDEDDSDDDGRRK
FT                   KKRGPRPGWKRDAGKDDGHKSADPELRKKRGRPPRVDTPMEARIKAVLKGIRKLKGPLG
FT                   MLKVRHFERLPDKATYPDYYVEIKEPIAIDIIKRKSKRKKYNSVDHFMRDMDLMFNNAK
FT                   AYNQPDSQIYKDAVDLQVEARRLAEIEKRKPDSEYLMEDGRLPLPDGILYKGELWKVGD
FT                   WVHIQNPNDVTKPIVAQIYRTWQDSEGEKWVNACWYYRPEQTVHHFEKHFYPNEVVKTG
FT                   QYRDHRIEEVVDRCFVMFFTRYNRGRPRGLPPDKEVYVCEARYNEEKHKLNKIKTWASC
FT                   LPDEVREKDYEMDLFDVPRRIKKIPSPIKHLLKSDAKETDDLPKPTWGADNAPPIVGAV
FT                   HRRPRDENESPPPEPTPSPPPSLPQPVLSTVPPRLPVITQPSTRPSVGSPGTAPAVGAV
FT                   PVPARSPAAPIPPTQGSPLPAPPVAYQQPQVPPVQVYQPALQRRPSAFVPQTPHSPAYQ
FT                   PSPVPHPYAAAQPTPYTPYQAGRVHVPPASVYNPNAPRPIEVFRLSEAANAAIPEDIRE
FT                   QFHCDDSGHVLFFSAPPLDIVSSLQQKLGHSLKYLAAKAERRKLVEQRKRKDDLERVER
FT                   EERVKRLRADEGTSLAAHVEALTAKAIEIMTSHVMIGTEKIYDHLYSNQAETAKQADAD
FT                   ARARRITADHISQEKTAQIQAYSNKATTVSLKGSAMYMDDIDPTI"
FT   CDS_pept        join(complement(1350753..1351143),
FT                   complement(1350448..1350569),complement(1348912..1350315))
FT                   /codon_start=1
FT                   /gene_family="HOG000193473" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265238"
FT                   /orf_name="AFUA_3G05570"
FT                   /product="Spindle poison sensitivity protein Scp3, putative"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL93006.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053326"
FT                   /db_xref="HOGENOM:HBG324125"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000F519F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE7"
FT                   /transl_table=1
FT                   /translation="MTTLRYLQCTRYQVLLRTPSRPILTKLTPPDLPTVLTSLPFLPHR
FT                   SQRECPHSLTHTLFLIIPIKVYRLIIIFQSLSFRCSCPRTSPSLCEMKNRTPLPVPSGA
FT                   PSVQNGHSRNPSSGLDMAARSPPNQSNTKHVPCKFFRQGACQAGPACPFLHSTDAAIDY
FT                   APCKYFTKGNCKFGAKCALAHILPDGRRVNRPTPGMGMGGGHLNLGGRVNPQAYVNQDS
FT                   ALTNSVLSQQRLGIHDPRYASQLPPQEDFSTLQQQQQQQQPHPPPFDAIPTIDAGLASD
FT                   AGSKYGSPAEDTRFPMSPSHRYLTALDAQLPASFDSQGISHVARYGPVAASVPSKFGLD
FT                   LASPPAQRMGGPSDVLRNLRDTAYGSDFRKPSSFMGSSPPGISEDGVGPRFLHSARPVK
FT                   SRMLSASVPRPTVLDDWDDSNFPMEEDYLPINLHDDVLTPQEKLRRLSRTDHDLSSSHR
FT                   DLSGLGMTSTSFSKVGSPLASSPSRFGALFAKQRQQKKDEDSHGTSFSHIGSPLRESSL
FT                   NLGTSPSLGPIGSRQISGDVSPYVTSPGRQSSTSMISQQLISMSLHPAPTRHSPAVGSN
FT                   SRLDRTISSPVSTSKIDEEQSDLVFSMEEEDSTKRNSTSWATNKVESNDGASTPTSNSG
FT                   FQP"
FT   CDS_pept        join(complement(1353037..1353079),
FT                   complement(1351964..1352481))
FT                   /codon_start=1
FT                   /gene_family="HOG000193487" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265239"
FT                   /orf_name="AFUA_3G05575"
FT                   /product="TBP interacting domain protein, putative "
FT                   /protein_id="EBA27484.1"
FT                   /db_xref="InterPro:IPR010776"
FT                   /db_xref="UniParc:UPI0000F519B9"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9G5"
FT                   /transl_table=1
FT                   /translation="MTQKKAKAADMLDGGKHTVYHAVQEASDEFTIETMAMMNERNGQL
FT                   EKQLTTLKTKEKKARTELATLSTKPLLCELRHDVGQLEQETQAISSRLKKIQKRDSIQM
FT                   SPEERAELGKEWRRWNRIASVRKRICRDLWSRCLEVSPDNVCREELWVSTTTLDAALRR
FT                   RSAVVSADFGHQESLGLEGSLLR"
FT   CDS_pept        join(complement(1355240..1355968),
FT                   complement(1355060..1355179),complement(1353667..1354998))
FT                   /codon_start=1
FT                   /gene_family="HOG000193498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265240"
FT                   /orf_name="AFUA_3G05580"
FT                   /product="Chitin synthase activator (Chs3), putative "
FT                   /function="binding"
FT                   /protein_id="EAL93005.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG053325"
FT                   /db_xref="HOGENOM:HBG324123"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000F5195A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWE8"
FT                   /transl_table=1
FT                   /translation="MPEVPENMQDNIAHLEHEARIPHHNQYAPVQHDRSRFPERSSSVA
FT                   VAQGQPSPGAGYDAAHHEHSAVYDMGPSTVSPFPVLRNPPPNVPPTDEQREASLERARI
FT                   AVLSSNDPEMQLAWAQDALAYVEVAVQNEARLSLIQPPRPQTPTVERQLKLDAMNIVNF
FT                   LADQYHPKADFIRGMWLEFGKFGHRVDKKAAFRAYTRAADRGYARAEYRIGMQFESSGE
FT                   PEKAIKHYEKGVALADSASYYRLGMMILLGQHGQRQDYQMGLDYISLAAQSCDENAPQG
FT                   AYVYGMLLARELPQVNVPESYLPLDLNAARVNIEKAAYHGFAKAQVKMGAAYELGQLGC
FT                   DFNPALSLHYNALAARQGEPEAEMAISKWFLCGHEGVFEKNDELAFKFAHRAALSGFPT
FT                   AEFALGYFYEVGIYVDVDLKEARSWYAKAAANGNKDATSRIDSISRSKTLSRKDHENVA
FT                   IARIKSRYGSHQRESSLESTQENLEMPDPSRISLSDTGHSAAPYPDRPGSRSRPVYPQG
FT                   YSMADPRPSSAFGINPNISANAPNYNRAASYGPGPQNYRNPGPGVPPSVGPMSPTGVHS
FT                   PSGTPKLDIGYSAPLDQPPNTDARRRPQRLDGAPPDRKPVRTAASPHSQASSMGSPRPQ
FT                   ASPSAASFPQSSGTSTPNPSGTPASAASQKPTTQPSKPSAGGLPGKGPKTFEEMGVPTA
FT                   QKDSDCVSFSFLPDRCNEANLCLRSSCDTLAE"
FT   CDS_pept        join(1358386..1358529,1358583..1359224,1359258..1359944,
FT                   1360010..1360180,1360257..1360961)
FT                   /codon_start=1
FT                   /gene_family="HOG000241266" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265241"
FT                   /gene_name="chl1"
FT                   /orf_name="AFUA_3G05590"
FT                   /product="ATP-dependent RNA helicase chl1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL93004.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG211585"
FT                   /db_xref="HOGENOM:HBG381928"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="UniParc:UPI000051F3C6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WWE9"
FT                   /transl_table=1
FT                   /translation="MLEFAKRESARAVTEKRRALEARLEKIKVEEEKQRHATDHPKEAR
FT                   KRRRVDTSSGDPGPEQDDQFILDDYDSDADERMASSKKLSDISGLSTSTLELLERFKEQ
FT                   FSAPVEDEIGHEDDDVKIFYCSRTHSQLSQFSSELRRVKMPSSMPAELSTSDANTDEVQ
FT                   ERVKHLTLGSRKNLCINPKVMSLGNAAAINERCLELQQPGIAAEKRCPYLPSKEDEGQI
FT                   LQFRDHTLATIKDIEDMGKLGKRMGICPYYASRSVLKHSENVLLKAQKIVTLPYPLLLQ
FT                   RSARDALDLSIKNHVVIIDEAHNLMDAICNIHSVTIRLSQLQTALLQLTTYAHKHKARL
FT                   KGKNRSYIAQIIRLVSSIRDHLRSILGQNLPAEGTVDPSDLMAGKGVDQINPYKLSRYL
FT                   QESKLARKVDGYVEFLKNKNQQSDDKPSSPVLFLVQSFLLSLMNPSAEGRFFYLKCHDD
FT                   IQLRYMLLDPTNQFREIVEDARAVILAGGTMSPMSDYRNHLFSYIAPSRLDTFSYGHVI
FT                   PPENLIAHTLVNGVLGSEFDFTYDSRDSEKMILDLGRTVATLCQAIPDGVVAFFPSYDY
FT                   LSRIVAIWRKPLEGEKGETILSLIEREKSILYEGRDMGPKTDDLLQEYTRTIDSGQGAL
FT                   LLSVVGGKLSEGINFSDKLGRGVLIIGLPFPNIRSAVWQAKIQYVEQKTYNSSSGSEKD
FT                   RQSIAKAAGKDFYENACMRAVNQCIGRAIRHRNDYAAIVMIDRRYEKANIQGKLPAWIK
FT                   ESMLRRSVRRPASALAADLSNFFSGRSPR"
FT   CDS_pept        join(1361310..1361341,1361506..1361704,1361886..1362104)
FT                   /codon_start=1
FT                   /gene_family="HOG000231263" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751296"
FT                   /orf_name="AFUA_3G05600"
FT                   /product="60S ribosomal protein L27a, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL93003.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG380059"
FT                   /db_xref="HOGENOM:HBG727142"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniParc:UPI000051EA24"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF0"
FT                   /transl_table=1
FT                   /translation="MPTRFSKTRKARGHVSAGYGRVGKHRKHPGGRGLAGGQHHHRTNL
FT                   DKFHPGYFGKVGMRYFHKTNQQFWKPTINLDKLWSLIPTETREAYLSGQKTDTAPVIDL
FT                   LSLGYSKVLGKGRIPEIPIVVRARYFSRDAEQKIKEAGGVVELVA"
FT   CDS_pept        join(complement(1363447..1363825),
FT                   complement(1362631..1363349))
FT                   /codon_start=1
FT                   /gene_family="HOG000193509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265242"
FT                   /orf_name="AFUA_3G05610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL93002.1"
FT                   /db_xref="HOGENOM:HBG053324"
FT                   /db_xref="HOGENOM:HBG325839"
FT                   /db_xref="UniParc:UPI000051FB0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF1"
FT                   /transl_table=1
FT                   /translation="MTDPLKTLDTTSPSNPPSVSQKKYPIAGILTTVFGIDEIPSQASE
FT                   IACLWLLHPRLATQERMTGLATLVIADWNNRIKDGRAGSTKGLIAVSFDQRNHGTRLVD
FT                   PLANEAWRDGNPRHAQDMFSIFQGTARDVSLLMDYLPAYVFPQGERMISKHMVLGVSLG
FT                   GHAAWSCLLHEPRVKAGVVIIGCPDYVNLMVDRARLSKLPSWVNSDPPGSRILGSEAFP
FT                   SSLLETISKLDPASIFLSYVNSNSDAGPPRNNPLPEPTENEKQALRPVLRRCLAGKKIL
FT                   NLSGGADKLVPYHRGEVFLTWLKKAIAPDGWFADGAVTFEDIIDEKAGHEVTPKMVDEA
FT                   VRFITETLASSDDAKKSAYVRESKI"
FT   mobile_element  1364093..1365640
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        1366559..1371982
FT                   /codon_start=1
FT                   /gene_family="HOG000193520" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903363"
FT                   /orf_name="AFUA_3G05630"
FT                   /product="Phospholipase D1 (PLD1), putative "
FT                   /EC_number="3.1.4.4"
FT                   /function="NAPE-specific phospholipase D activity "
FT                   /function="phosphatidylinositol binding"
FT                   /function="phospholipase D activity"
FT                   /biological_process="cell communication"
FT                   /protein_id="EAL93000.1"
FT                   /db_xref="GO:0004630"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="GO:0070290"
FT                   /db_xref="HOGENOM:HBG053322"
FT                   /db_xref="HOGENOM:HBG325838"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="UniParc:UPI000051EC49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF3"
FT                   /transl_table=1
FT                   /translation="MTDSAIAASALRDSENISNRLDPKGPDLLTVASGVKLGSPFLSQS
FT                   ENERSASHFRDGKADPTDERRIADDAQSIKENVNHANEGGGKPRSEKAGGLKDAWNDGQ
FT                   GEQPFLPSLRRPNESLDSPQQSPDHKQHQSTTPGAAVSPRRPSVQFTHETSDIDAAPEG
FT                   TGSRPPSVLDDEPDSGLKGKQSIFTKLKSLASPSFTSHSRSASGATISDMRQTNTDLAT
FT                   PGSERGAFRFPDTLEEEGSDIDADAEESAGEQEVRQRRKKKKISRRQPEPQSAPQTEPN
FT                   TPKTTRRPSFHLPASFGPFENYRANLFARRVSTGDFAQQREGVSEDEGRDRLNRDAWRR
FT                   RIANARALTYGSRQADTPGNQEERRPSNFKRFTGLGGPSENAEGNAPHWRRHRAERGSS
FT                   LSAQKWRQIKAGFKFMRRKPESTVDHAKSAELLAELTSGVPAALILASMFQRDEHGSKR
FT                   IPILLEQLKVRVTDSKFEPHSGDRHLVFRIELEYGSGMTRMKWIIHRTLRDFANLHLKY
FT                   KLHFGTQKYIQLRNTEGGQNLPRFPRSAFPYLRGVRGLESEIEDEEDEGGYETAAEATS
FT                   GNERSGRRKQQQGQRRLSGGISRRQSSITNTEGETNAGPSGAAEPGQSTKREPYPERQR
FT                   KKLEAYLQKMIRFLIFKADSNRLCKFLELSALGVRLASEGSYHGKEGYLIIQSSKGLDF
FT                   RRALTPAMVKKRHSPKWFLVRHSYLVCVDSPEEMNIYDVFLVDPFFKLQTQKISLRNQK
FT                   AKELAKSAKESARHPQHHTLRLENSERKLRLLARNERQLHQFEDSIRFMVNNTPWVKPN
FT                   RFDSFAPVRQNCFAQWLVDARDHMWMVSRAINQAKDVIYIHDWWLSPELYLRRPAAISQ
FT                   KWRLDRLLQRKAREGVKIFVIMYRNINSAIPIDSEYSKFSLLDLHPNIFVQRSPNQFRQ
FT                   NTFFWAHHEKLCLIDHTVAFVGGIDLCFGRWDTPQHLLTDDKPTGFETPDGPKDADHCQ
FT                   LWPGKDYSNPRIQDFYDLDKPYEEMYDRNVIPRMPWHDISMHVVGQPARDLTRHFVQRW
FT                   NYILRQRKPTRPTPFLLPPPDFDPADLEALGLDGTCEVQILRSSSMWSTGTPDVTEHSI
FT                   MNAYVKLIEESDHFVYIENQFFISTCEIDGRKIENLIGDALVERIIRAHKNQEAWRAVI
FT                   VIPLMPGFQNTVDSEGGTSVRLIMQCQYRSICRGETSIFGRLRALGIDPEDYIQFFSLR
FT                   AWGKIGPQKQLVTEQLYIHAKCMVVDDRAAIIGSANINERSMLGSRDSEVAAVVRDTDM
FT                   IWSSMNGRPYLVGRFPHTLRMRLMREHLGIDVDELMEHSIATEEELRKIQIAEEGSRSP
FT                   ENADKADSESLMMERQDERDMIERRHRIQDEFLSRSEDLHSFNHDVDWEQGNNPNLKAN
FT                   RKLTADPRVTSNAEHKKDVDGHGVDHLDIALEAGLADGRDSQMLEDSVEVLVSPIASEG
FT                   KGTIRQPKLASQRNTQPGSPIARESSRESPSTTVHDADPTPVLDGLPAARHPALPGTNT
FT                   ENDNGLLSPSSDITDAAKYPHPLIPDLKHIFIDKDCMRDPVIDIFYLDTWQAVAEKNTK
FT                   IYRAVFRCMPDSEVKSWKEYKEYATYGERFSEMQSQHSAKISQPSHQKPTGPPGTNTSA
FT                   AGAGMRSLVAHSGSSGEVHATEHKGQQRPDEKREAREGGRDAVDRMQPDLAKQETLSSI
FT                   DEKTALEVAEATGAGPTQSGRSEESGFNKEAAEQQEPQAVDYSEALNRNATNQTRRRRR
FT                   RATTLSKREFHATDDVMDKQQAEELLNKVQGHLIMWPYDWFVTSWPILVVL"
FT   CDS_pept        complement(1372636..1374264)
FT                   /codon_start=1
FT                   /gene_family="HOG000193531" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903364"
FT                   /orf_name="AFUA_3G05640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92999.1"
FT                   /db_xref="HOGENOM:HBG053321"
FT                   /db_xref="HOGENOM:HBG325837"
FT                   /db_xref="UniParc:UPI00003E6151"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF4"
FT                   /transl_table=1
FT                   /translation="MLNAAVAAPRCFVYPTDRAAMRLGFALRLSSPAPLFSTAPFRRQL
FT                   HASGVRSIEPVIFRNSLEKTLEAHRSSNRASLIRKVINHDCPAETPPPILPLENRAGHD
FT                   QSSQKASSVSNAESESPRSSAPARRAQRKARSPSQVATPQPQTTEYPQLQWHADETKGR
FT                   PAQSPWLKYLTTDWKTPDAVSRLDAEIRALELYMTPTPSERTEIDRLVADMGRLLAGIV
FT                   PSPPQVTGSWRTRFALSHSGLDFVLPVPDSDRSTRDVRKPSATRPKVLQTYKKLLHEVG
FT                   HALQQSPSFAERVRIIGSRFPVLSAIHRPTGRLLQFHCGEGLPASVEYIMDYQAEYPSI
FT                   RPLYVTARLILEARGRYGRTQMSIESDALVMLLVAFLKMNHGRFQRPDCLGEQLIAFLR
FT                   AYGSDIDLTTTGVSVDPPSWFNASTVKRASALYAPDDLPAHLRGQRSLISLKRTAAARR
FT                   NLPAASRLCVQDPTNYMNDLGRSCVRTLELQHTFSLAHDRLGASLKRWDDSEPAANVSI
FT                   LTRALQANFSDFENLRAKSLKLNAT"
FT   CDS_pept        join(1376111..1376536,1376623..1378876,1378939..1379108)
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751297"
FT                   /orf_name="AFUA_3G05650"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase subunit
FT                   Tps2, putative"
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="EAL92998.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG325836"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051EEBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF5"
FT                   /transl_table=1
FT                   /translation="MAANQDTPTKVPDGQPNPVMVGPGMKSLGEEAYTNASNATPSLET
FT                   DKKHPLVNDAPSYFSQVPGTKQSSTVSDTALPGSPADAARDAKSPIELLRRLSLGRSPM
FT                   IPDVDPREQYPGLNLTGRIISAAFCIPYKVGYRPGSDWDLKPRPGTSALFDSFAYLGSG
FT                   ETKWSHTLVGWTGEVEPIQDVSVPLQHIPVSSGARLPPALNGVAVPLNKAAAPVPVDSK
FT                   QRPPSHPLLEGFRVSQEDRARLDAQLSSGRYGKIAPVWLSDESEEPEESSIFLEDQGRW
FT                   RRYAEKELYPLLHYKQHGPTDGRSERKWWGDYVRMNRLFADRIIEEYQEGDIVWIHDYH
FT                   LFLLPSLLRQRIPNIYIGFFLHAPFPSSEFMRCLAKRKEVLTGVLGANMIGFQTFSYSR
FT                   HFSSCCTRVLGFDSNNAGVDAYGAHVAVDVFPIGIDVKAIQKAAYGYPEIEEAVVGLRT
FT                   LYAGKKIIVGRDRLDSVRGVAQKLQAFEQFLERYPEWREKVVLIQVTSPTSVEEEKEDP
FT                   ENKIASQISNLVSTINGRFGSISFSPVKYYPQYLSQHEYFALLRVADVGLITTVRDGMN
FT                   TTSLEYILCQHNTHGPLILSEFSGTAGTLSSAIHINPWDTTGVAEAINRALTMSPEEKK
FT                   AQHVKLYKHVTTNTISTWSNHFVTRLLTNLSSFDQSVATPALDRAKLLKQYRKARKRLF
FT                   MFDYDGTLTPIVKDPQAAIPSDRVLRTLKTLAADPRNAVWIISGRDQAFLDEWMGHIPE
FT                   LGLSAEHGCFIRQPRSDDWENLAESSDMGWQKEVMEVFQHFTERTQGSFIERKRVALTW
FT                   HYRRADPEYGAFQARECRKMLEETVAKRWEVEVMAGKANLEVRPTFVNKGFIAARLVQE
FT                   YGTDPAQAPEFVLCLGDDFTDEDMFRALKKSGLPAGHVFSVTVGASSKQTEASWHLLEP
FT                   ADVIGTISMLNNSSSAQEY"
FT   CDS_pept        1380363..1381817
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265243"
FT                   /orf_name="AFUA_3G05660"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL92997.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053320"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000052065B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF6"
FT                   /transl_table=1
FT                   /translation="MAQDHTPDAVPVNEKDPPNQQLDDTTSDRFVPLAGFPRDEESGVN
FT                   NGVDPRSKSLSRTTTNTSHIGTLAARTLSLVRTRESGKDIGPPPDGGLFAWTQVLLAHF
FT                   VIFNTWGYINGFGVFQTYYTEHLGRPPSDISWVGSIQIFLLFFIGTLSGRATDAGFFKV
FT                   TLATGALLEVFCIFMTSLCTEYWQLFLTQGVGQGIGCGLMFCPTVALMATYFTTKRALA
FT                   IGIVACGSATGGLVFPAVVVRLLPQVGYAWTMRVLGFITLATLLPPVVFLKQRLPPRKS
FT                   GPLVEWAAFKELPYLFFAIGMFLNFWGLYVGFFYIGSFGRNIIGVSETTSVYILLVMNG
FT                   IGILGRLMPNTMADWYTGPLNMLIPFSLVTGLVSFCWAGVDEIHGLYAWSAFYGLAAAG
FT                   IQSLFPATLTSLTTDLKKAGVRMGMVLSVVAVAALIGSPIAGALVQTAGGQYLYAQMFM
FT                   GSAILAGTLTLIAARVAKLGFTWHRM"
FT   CDS_pept        join(1382401..1382446,1382518..1382585,1382684..1383355)
FT                   /codon_start=1
FT                   /gene_family="HOG000193542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751298"
FT                   /orf_name="AFUA_3G05670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92996.1"
FT                   /db_xref="HOGENOM:HBG053319"
FT                   /db_xref="InterPro:IPR019380"
FT                   /db_xref="UniParc:UPI00005201C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF7"
FT                   /transl_table=1
FT                   /translation="MAPRGRGKFSKPSRGGGKHFSRDVQPVDKDGNPVSLWREPGDDIP
FT                   SSGEEDASEEASGSEESLDEDDVQAGPSTIAGSSAGPAAMTREERRAAAKAKKLAAIAR
FT                   RNNVAAQPGDLPPSDSEEEESDGGDDEDLLPANPNHTAKSRSQLHKDPAAAPEKAAGGD
FT                   LSQLSRREREAIEAQQARERYMKLHAEGKTEEARADLARLALIREQREADRLRKLAEKE
FT                   EKEALLREKAAAREREMKRREETKGKKKGGSKKGGSKKD"
FT   CDS_pept        join(complement(1385040..1385149),
FT                   complement(1384827..1384930),complement(1384317..1384654),
FT                   complement(1383915..1384226))
FT                   /codon_start=1
FT                   /gene_family="HOG000193563" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056629"
FT                   /orf_name="AFUA_3G05690"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL92995.1"
FT                   /db_xref="HOGENOM:HBG011740"
FT                   /db_xref="HOGENOM:HBG395669"
FT                   /db_xref="InterPro:IPR007881"
FT                   /db_xref="UniParc:UPI000051FB00"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF8"
FT                   /transl_table=1
FT                   /translation="MNPTISVPRQHASPASFGGTTPTSRGSSIRMPRFFKRLFKFPQMD
FT                   FEMAIWEMTSLLIAPKKVFKSIYYHVKTKNTWHRPDPSFTYLLSFFLLLTALAWGLAYA
FT                   PAFGSIVRLSLLFIFVHFIGSSLVVSTIAYFAIPRLFGPDGAAASLSGFRGSRGRRRGA
FT                   AQGLFVQPGEKDQLEFGYCFDVSNRAFFPLYLHLYVVQFLLLPLLTRSPSNFLATFLGN
FT                   TLYLSALIYYTYITFLGYNALPFLHNTELLLLPILVLSILWLVSLIAGWGVVMHGHSVE
FT                   WLFWGV"
FT   CDS_pept        join(1387505..1390064,1390127..1392015)
FT                   /codon_start=1
FT                   /gene_family="HOG000193564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265244"
FT                   /orf_name="AFUA_3G05700"
FT                   /product="Sec7 domain protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL92994.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG053318"
FT                   /db_xref="HOGENOM:HBG325830"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000051F607"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWF9"
FT                   /transl_table=1
FT                   /translation="MNRPARSSSIRKDAHTNRSPPRTPPSQASNCKTFKRGLRPRPSLR
FT                   ETFLDDTNPADNANNSSNDSSEERDPHDLSLSPKHAARTSIVDNMLLSLDQFTFSTGNS
FT                   ILDDYRLFNSVFESELYGRNSQESAGPNRYRGHTFSSSLSSEADFGYDDSSTRYGTQPA
FT                   SAARGRRSNSSSQYHSSLGRFGSTRSREGTNSRGQLNDYRAVTGADQTTRGTRKSSKAS
FT                   SSTNLDFGSALIRGRADSSGERRSASFDYGTRPPFISTDFDSTFYDSTDAAPTPSVPAG
FT                   PRKLHSSAQNDYVGVLNSQSSRTPVASRRNSIKSSRTNHARTIRQDTIGTSSILRGADS
FT                   ELANLTDDGLDPPPAISASLDPPAPSPTISFNKPAMLASPDSTPAKERQGFFRRVFGSS
FT                   KNTASGPSESIQSDSTLPQENDPKETIAAGGSLRSRRQPLRTNVPGANALREGQPHVVN
FT                   KKSSFFRRRKKSISTTDNLPPPIILPQELGPKAVEILKPEPSPVSSLRKVMNPYLADGI
FT                   GAACDKSNSGPIRVAGAGPADNMDPILTSARNEKENVSTAPAKGGQTSKYSLYPPPTAG
FT                   SGHDTSFLMNSSGDEESTARTAEMDSTSSVDRKQEKVAVEDALNSSEGDKGGHTTDGTS
FT                   HIMIPTTTKSAPALSPVVESISPASVSPLEDSEYLTTETAAVNSATRTAGHRQRSSSGG
FT                   DQRPQPSKLSIPAMKADASSQVSPADSDEFFTAANTPAVPSEDPKTPQIIEDIAECSDD
FT                   DSSGGPSSSDRDQAKRLFDSQDQVVGNEPAAAWLGDPGRASIRAAYMELFDWSNMNILA
FT                   ALRSLCTRLVLKGETQQVDRVLDAFSTRWCQCNPRHGFKAVDVVHTICYSLLLLNTDLH
FT                   LADIEQKMTKNQFVRNTMPTIRRVAVEAAPDGFETSRPVNRSKLSTQESASSPGPSQQN
FT                   SSNNPEASNADTDRPSHPPHKLVNRLSRTDLSIKLSGDPESDVGPLVNAPFNGSMRLWE
FT                   QQVETVLRDFYSSVQKQKLPLHGAATDKDGPQPQSSNLLGPGTNHHGLRRSPSTISKSG
FT                   SDIFPRGRSADSRYGTARWSSKPRSRARLYPPSTMGSSRTSLDDQSSLWSPSASSTWSK
FT                   YSLGKLTSASVDSFGSDYPRGDYQQSIGFANALSQAIIREDSAHSITSVEEEGTAHLLE
FT                   DETLQLAGAPWAKEGSLKHKQHLDSVDKRAKDRNWNECFAVIQQGWMRLFSFSNAAKTP
FT                   RQKPKQRPHGGVVVGGGNWTENAQELWKFLLRHTIASALPPPGYSKSRPHVWALSLPTG
FT                   AVHLFQAGTPEIVREFVSSANYWSARLSKEPLVGGISNIEYGWSDAVINSALVHADNNR
FT                   TPPSSGPRASIQSSIRSSIDQQGMRPRLPADRVHISDWAPPQQSMAASTLPEAEQLKAL
FT                   QTYVKNVEDDLSRHNELRPAMILAFSPRHPNAAKAMANWERKSSYLLREIVKFRTYIDS
FT                   LQAAIDAKNKIYATREEDVPS"
FT   CDS_pept        join(1392984..1395110,1395176..1397962)
FT                   /codon_start=1
FT                   /gene_family="HOG000193575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751299"
FT                   /orf_name="AFUA_3G05720"
FT                   /product="Anucleate primary sterigmata (ApsB), putative "
FT                   /protein_id="EAL92993.1"
FT                   /db_xref="HOGENOM:HBG053317"
FT                   /db_xref="HOGENOM:HBG325829"
FT                   /db_xref="InterPro:IPR012943"
FT                   /db_xref="UniParc:UPI000051F605"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG0"
FT                   /transl_table=1
FT                   /translation="MSTNSDLSPPSSPSPIFQITHCAQSNLLPSCVSIPDAFDTDDEVF
FT                   ASVEEFCNPFDLMVQDTTWADPPLGGSTTMDEAHDTDSEVYHTQDETTLDLGRDDDPTS
FT                   TIDPSDHDDSNISHLPPLPDHDDSSLFLSSEDGDHERAENQTLLEEKEMRRKLMDMESS
FT                   FLPEPSTIEVAPSNQAAGIGDTLLQDNCDNAHEPAASETNQSFMTADNTSPDLISTGKE
FT                   VSVPQTPSLGPHDDSTMGLDATPTTVPQHHGDDTTALEAISSSPAADAAARSSARVQST
FT                   FSEGSQSTNRDGQEEADHSTTLDLTRSMQAANLSTQTSFRSSSLERPRLFQNESAQDAE
FT                   AASRTSSRRSNRPKYLNSRQSSHRLSYSSVASNNTEITNNDATLGADYALQSGGAVPGN
FT                   SHPAQGDPRNNLTRSVSLGSMASGISSLSEENVMERRNPSAVAEGGLQTLTEEEGISQS
FT                   RPGSAQQQSQSQPQPHQERQSPTLGDDLGPMTPKVKPRDNIFPTDTAIAERVKDVQVPS
FT                   AFVRQFREDFAGRPSSPEKRAGLPTPGFARSGRTMTLKEQSSTIDRLSKENFDLKMRIH
FT                   FLNEALNRRSEEGIKEMISENVELKSDKLKLQKDNQNLKRKIRDLEKQLKDQQSDKESM
FT                   ANHDPEGSDEDSRDAAQDEEILFMRERQEAYELEIERLRSESIVRESEKRRLAEMVKAL
FT                   SDRPVGSEAGAREERDMWKDMLDAETAAREQAEEENKRIKDEIQALRNELNYVIALPRA
FT                   GQRDRVGSMISYTTASDRDMTRMPTLTSSSSDTLVEEIRLLRQENAELRREVSAQTSML
FT                   TSRNKEKERLYQEIEELKLGQRRDGVRSVAGDSIFDRSASRAQGRSSSRASDGTGPSRS
FT                   DDAEREDLEQRIDQLRDQVSALKLENQTIRAELEERIAEYDALDKQYQADVDGADEMFN
FT                   ALHQERDEAERKMNDCLVNMQIMDAQYTEDIENLEEEVRRKTEECERLEEELRNQDENL
FT                   RALQAEMRSASEGIIRLEEDAQTNLQRYEKVQRELQDCNREMEALEKSLYEANTKVQRL
FT                   TVQIESSQNEIAFLREEQDGDKIRIGDLESELKTCQMSLQSERDKVKELESRLAEERHQ
FT                   REVVGTKEKQEVQRIINELNREASSAREEARRLKKSLSAQEIETATWRERLMDLENNLR
FT                   ETLGDLTGSRSSLISNIMKLQKELESTALELESVRSKLDEKETLLRNRDALLESHGLES
FT                   RKLSELLERERQARRADKQSFEQALKSHHQASRTITQNNSRITELENARSQDRKRFTAL
FT                   EQQFKEQLNERNSMLLTMWKRLSAMCGPDWAHSNSLINGNLPSQEVIGNILFWPGFSRN
FT                   LLLAVKTLENVIGGFKNRIKGVERDLTKQYQNLEHTLGQRIKKLDRLEESVMNLRAQQH
FT                   SRGQSGMSPEIAKLRGENRLLKAELNLLQSHSRSRGPTSAAAVAAGMGQGIQRSPSRTL
FT                   STESGTDAESALTRHRSVIEKSATPHLSRNAHRSSTTGIPQPSSNAPADDGGAIVPSSH
FT                   SRHASGDPVSNERWIHRLRELEKRLKAEREARLLDRSGARKRLEERDAENQRLRAQLER
FT                   QRMRRGLSAETSTDGDYDHGRVRKSEHSDLSNDGDYGRLRNEELSSSEGEGICVDIEV"
FT   CDS_pept        join(complement(1399419..1399574),
FT                   complement(1399306..1399361),complement(1398507..1399236))
FT                   /codon_start=1
FT                   /gene_family="HOG000224023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207930"
FT                   /orf_name="AFUA_3G05730"
FT                   /product="Nicotinate-nucleotide pyrophosphorylase "
FT                   /EC_number="2.4.2.19"
FT                   /function="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="EAL92992.1"
FT                   /db_xref="GO:0004514"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="HOGENOM:HBG280888"
FT                   /db_xref="HOGENOM:HBG751540"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="UniParc:UPI000051EEBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG1"
FT                   /transl_table=1
FT                   /translation="MASVYGDLRHLLPNNYKRLITAWLEEDCPSFDYGGFVVGESEGEA
FT                   RLLGKSKGVVAGVPFFDEVFSQLGCTVEWHVKEGESIDPIKHCATVRGPIRQILLGERV
FT                   ALNILARCSGIATKSTTLVAALRAHGWQGTLAGTRKTTPGFRVVEKYGLLVGGADPHRH
FT                   DLSSMTMLKDNHVWACANNRSAADGGSGSADTQSIAAAIPRAVQAAKAAGGFSTKVEVE
FT                   CRSLEEANAAIDAGADVIMLDNFTPEGVRDAARQLKQDWAGKQKSFLVEVSGGLTEANA
FT                   AAYACPDVDILSTSSIHQGTPIVDFSLKVSLR"
FT   CDS_pept        join(complement(1402875..1403362),
FT                   complement(1402309..1402807))
FT                   /codon_start=1
FT                   /gene_family="HOG000072798" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207931"
FT                   /orf_name="AFUA_3G05740"
FT                   /product="Aldose 1-epimerase, putative "
FT                   /EC_number="5.1.3.3"
FT                   /function="aldose 1-epimerase activity"
FT                   /function="carbohydrate binding"
FT                   /biological_process="hexose metabolic process"
FT                   /protein_id="EAL92991.1"
FT                   /db_xref="GO:0004034"
FT                   /db_xref="GO:0019318"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG429287"
FT                   /db_xref="HOGENOM:HBG703640"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniParc:UPI000051EC4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG2"
FT                   /transl_table=1
FT                   /translation="MSGESEFAFLPLGAIIQEFRVGGKNIVLGFNTQEQYDKYNSAHFG
FT                   ATIGRVANRIKDAVIHNLNDRDYILAKNNGPNSLHGGGKGWGKCVFDGPQTVKHDGKDA
FT                   LLFKYLSKDGEEGFPGTVEVRVWYTASKEDSKTVLTTEYEVEFVGNECEETVVNMTNHS
FT                   YFNLGNGPTIEGTKAQLSTADYLPLDSTGIPLGNIDKFPLDVSKPFVLGAAEPDIDDVF
FT                   LMETDPSKVVLDTRSQPLKLLAQFSHPDTGLHLEVHSTEPAFQFYTGKYINVPAMDGLP
FT                   ARVARAGFCVEPSRYVNAPNEPGWRSMVLLKKGQIFGCKTVYKAWKA"
FT   CDS_pept        join(complement(1407172..1407279),
FT                   complement(1407010..1407107),complement(1406209..1406917))
FT                   /codon_start=1
FT                   /gene_family="HOG000193586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207932"
FT                   /orf_name="AFUA_3G05760"
FT                   /product="C6 transcription factor (Fcr1), putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL92990.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053316"
FT                   /db_xref="HOGENOM:HBG325826"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F3B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG3"
FT                   /transl_table=1
FT                   /translation="MTARQSSPTSDHSHSDGNVRKRVCKACDRCRLKKSKCDGANPCGR
FT                   CRADNAICVFGERKKAHDKVYPKGYVEMLEQQQAWLVYGLQELYRRSSEGEGWPGEPLK
FT                   CEANGHPLTHDLLTRLGALDQSKGERFEENTEVMQQELWKQNAGHMQRQDSSDGSSGSA
FT                   QSPITTSRFADAFSRHQLPPTPPNLSPTARSQAPTIKAEPQMAPHNPAYITPMSMQGVV
FT                   NPIALQGPPQWPNSNFGTFDEMDMMGPSDFTSLSFDDQLSSPMFNRQIPINCVTSASFM
FT                   DTKSDYEDFNQFLNPNPTEITSM"
FT   CDS_pept        join(complement(1411609..1411663),
FT                   complement(1410812..1411246),complement(1410423..1410739))
FT                   /codon_start=1
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265245"
FT                   /orf_name="AFUA_3G05770"
FT                   /product="RAS small monomeric GTPase, putative "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL92989.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG053315"
FT                   /db_xref="HOGENOM:HBG325822"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000051FF98"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG4"
FT                   /transl_table=1
FT                   /translation="MEDEPDKISITICGDGGCEDSYSVTRVIDGVPYFLSITDTAGQEE
FT                   YRGLFALSNLRSDAFLLVYDITNASSLSALDYFMDLIDIEAEQRAEDNARLLKELGDSV
FT                   RGVEVGMPPPVKIIAGNKCDLKDNRAISAREGLEYARKHGCGFMETSARDMVNIEETFA
FT                   LIVRRVTEARRLHYQQNQATANPGQAAASATAQQPAEQTADETMGPANPSKAARTPFSR
FT                   LSIFGKKSSKCAASRSEDQTGEPKAEAVEWKEKPVKPNIWRRLLCC"
FT   CDS_pept        join(1413000..1413744,1413814..1413837,1413955..1414407,
FT                   1414464..1415797)
FT                   /codon_start=1
FT                   /gene_family="HOG000193598" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265246"
FT                   /orf_name="AFUA_3G05780"
FT                   /product="GATA transcription factor LreA "
FT                   /EC_number="2.7.1.-"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="signal transducer activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL92988.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG053314"
FT                   /db_xref="HOGENOM:HBG325820"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniParc:UPI000051EA23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG5"
FT                   /transl_table=1
FT                   /translation="MANNFNNGDYYGNTSFRMTPTTSGSQSNTSHAALDCSNADMMMMM
FT                   TFAPFDPLRMGDFSFSESHGSDMLPSGISADELLGSSSSLPAPPVPLADQLPNALFPYD
FT                   PLSGMENSVPMALDAASAIAYGHSSVYQQSSLMFEQTFNGQPMQQLPSFQNQTMSLDPT
FT                   APYSSTLQSHPSSSNTYWTSSVDAKESTNMAQATSMTSRSTNASKSSESSRSQQLPHRR
FT                   RQHLQAPTTQGLSHRYIQPKRPSPMKTSIKSATTANPSQAEVVSRPNPKIDIGAVDLSC
FT                   AFALCDIHQEDHPIIYVSEAFVRLTGYTEREIVGQNCRFLQDPSGVVQRGMPRKFVDQH
FT                   TAFRLRSTIEHRGEIQATIINYRKGGQPFMNLITMVPVRWNSPDYRFYVGFQVDLVEKP
FT                   DAIKMRNPDGTYMINYQRKQLPNYVAPPPDIYTLHPDYGTYFSHDQVSTILDNLDTPDQ
FT                   SYQQYLDRVLVENADDVIHVLSFEGELLYISPSCRKVLGYDPNELIGKTLSTICHPSDI
FT                   GPVIRDLRSCTNSDPVSVMYRVRTKYSGYMWFESHGSWHIGDRGRQYLVMTGRVCPVYH
FT                   LDQLANIGNGGLAENDLWAKLSISGIILFMSSKARPVLGRVSDDLVGKGIQDLIPADAR
FT                   EDAKQALEVARTGQQTSFSHKIRHKKGHMLQAQTTLYPGDTKEGEKPSFLVAQLRFPKS
FT                   PQTTPGTEEVVPFNITATFSRDASVTGRRNVTAAGQPTSDKSARGSSGDQYVPAPDEPT
FT                   LFAELNTARGSSWQFELRELEKQNRALSDEVQRLLARRKKRKRKQSIVPVEKACAMCQT
FT                   RTTPEWRRGPSGNRDLCNSCGLRWAKQVRNAIQKKAPTT"
FT   CDS_pept        complement(1416358..1417533)
FT                   /codon_start=1
FT                   /gene_family="HOG000193609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751300"
FT                   /orf_name="AFUA_3G05790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92987.1"
FT                   /db_xref="HOGENOM:HBG053313"
FT                   /db_xref="UniParc:UPI000052065A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG6"
FT                   /transl_table=1
FT                   /translation="MPSTFSTHTALRLRGNCPAITSMASSRVQHRHLRYQPAAIRDCYS
FT                   LLARGYSSPSSSPKSHTRSPSSSQPGSPIVPSISSTATTSLSNDVNPPPSTRPADLNLP
FT                   EPVSASAGPADKLKRYVALGRAYLSFYKTGLKNVYHNYRASLPLRRSLGLPVYLPISPP
FT                   PAPSTTSTNNKTTPFREAVKSQNLSRANFQLVRRAAYDVRRMIPFTLILIVCGEMTPLA
FT                   VLALGNAVTPFTCRVPQQIKKARLQHAARKRAALAAHQAQARGSVTGPAAGSDAERELL
FT                   AREFAHPGWVEKASAQEILQACAALGLVRTHTRPAALVPWLYRPRLRRYVEYLALDDEL
FT                   IRQGGGVPAMEAAEVSIAVEERGGVGVADGKEYWEAEREERRWLERWLGRA"
FT   CDS_pept        join(complement(1418118..1418849),
FT                   complement(1417896..1418081))
FT                   /codon_start=1
FT                   /gene_family="HOG000193620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265247"
FT                   /orf_name="AFUA_3G05800"
FT                   /product="Serum paraoxonase/arylesterase family protein "
FT                   /EC_number="3.1.-.-"
FT                   /function="arylesterase activity"
FT                   /protein_id="EAL92986.1"
FT                   /db_xref="GO:0004064"
FT                   /db_xref="HOGENOM:HBG053312"
FT                   /db_xref="HOGENOM:HBG325818"
FT                   /db_xref="InterPro:IPR002640"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI000051E568"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG7"
FT                   /transl_table=1
FT                   /translation="MKSTRLSFENFSGPFVTHGIDIIEDPENPNAVYIFAVNHLPNPEY
FT                   TQDGKDVPQARSQVELFHHVLETATVKHVRSIQHPLIATPNDIYAESPNSFYVTNDHYY
FT                   REGYGRLIEDLIPAAKWSSIVHVLIQDLKSKDADKGIDATVALTGLHSNNGLGHGRSKD
FT                   EMLVVSCMSGTLYRARSNSDNRTISVFDEIHPGGQIDNPTYYADPYRTAADDASGYILA
FT                   GMARPIDLSKHYNDPNAKDGAISGDQFTEWESSVLFEDDGTLIRTASTGLLVPSETKPG
FT                   ERKKAWLFVTGFVSESVIAVEVDL"
FT   CDS_pept        join(complement(1419688..1419896),
FT                   complement(1419107..1419266))
FT                   /codon_start=1
FT                   /gene_family="HOG000048417" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056630"
FT                   /orf_name="AFUA_3G05810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92985.1"
FT                   /db_xref="HOGENOM:HBG053311"
FT                   /db_xref="UniParc:UPI000051FF81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG8"
FT                   /transl_table=1
FT                   /translation="MAIRRMNGMGPLGVLFSLDVFISAQFIKQDHFSNFAQIAVVLRMA
FT                   FDTGERIFVRESCARFWSAMRQWPGQSRSTEKGDNETVTMAGFVPLALLAVLAATLYGP
FT                   VYQQLTIMGVSSGVRHLW"
FT   CDS_pept        join(complement(1422802..1422936),
FT                   complement(1421711..1422578),complement(1421446..1421657),
FT                   complement(1420087..1421388))
FT                   /codon_start=1
FT                   /gene_family="HOG000193631" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903365"
FT                   /orf_name="AFUA_3G05820"
FT                   /product="ZZ type zinc finger domain protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL92984.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG023370"
FT                   /db_xref="HOGENOM:HBG053310"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="UniParc:UPI00005208C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWG9"
FT                   /transl_table=1
FT                   /translation="MATPIPPASPVGPETLITIKVLYNDSTRRFKVPLRELGARVLPQK
FT                   LRQLIGVPPDSNIIFERYSDSAGCYVRLDSENLAVYKQLYRAAKAKLKLRIRATLVNEV
FT                   NEPVAQPSLSENAPEEQGPARYSYLETVLSSPPPVMGAEVVPSGSSESVPDLLGALEKP
FT                   ASVGPQSAQWTKDNTAPAQPGYRDFVLNTDNVDVPIVSHRSPTGVFCIDCNNCGRSIPN
FT                   EHYHCSICEDGDFDLCSQCVNSGVSCQSEDHWLIKRIVEDGIVTNSTTERVAPRKVEEP
FT                   RQSKTGSETLPELAPEEVQKPTPAPEEVQEPTPATAEKYPLQTAERICNSCLKDFEETK
FT                   MVTCTDCEDYDLCITCLLKDAHGHHPAHHFSLLHDRDFCLKSLVQSRCSPGRHHQHAAI
FT                   CDGCEKRIVGVRHKCLTCPDWDYCSECVGNAAQTHPGHRFAPLYEAISEPIQHHEVHYG
FT                   IYCDGPLCKDKPFPRYITGVRYKCSVCHDTDFCAKCEALPTNPHNRTHPLLMLKTPVRG
FT                   VTISNSVTENGFGGPVILTGDQVNRSTSAQANIPAEAGKSSEAPHHEEEATVKQKEVVE
FT                   PSPGAAEKAQSKVYEMPTTDPASSYQAFFIRDTVHDGTVMLPNKVFQQTWTLYNPGPLA
FT                   WPAGSSVRFVGGDSMFNVDTNRPMSLDAVSAAMESNQLLEPLEPGQSADFTVTLKAPSR
FT                   VGTAISYWRLKLANGMPFGHRLWCDVQVRDSMAASTKLEPVGEAPRAPEQQAEAAPVDD
FT                   TERTGSQMIFPTLDKESPVGSAHQAMVEAPLTAPSVSNPSEHDILEDVETLTLDDTNTE
FT                   TGFLTDEEYDVLDASDQDYLEAQSRV"
FT   CDS_pept        join(complement(1425906..1426588),
FT                   complement(1424444..1425842))
FT                   /codon_start=1
FT                   /gene_family="HOG000193642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056631"
FT                   /orf_name="AFUA_3G05830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92983.1"
FT                   /db_xref="HOGENOM:HBG053309"
FT                   /db_xref="HOGENOM:HBG325817"
FT                   /db_xref="InterPro:IPR018545"
FT                   /db_xref="UniParc:UPI000051E574"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH0"
FT                   /transl_table=1
FT                   /translation="MASRRRKIGASRRRRRRDEEGEDEGSLEEELEDDSLSEGSVISHP
FT                   GDDDDDDDDDDDDADGEGSDESDGEASSSPHLDRTNRPQVNGLVPEINQRSGRRHSSSP
FT                   GKRHIDTAVSDTEAMMNGLTLSDQASEVAEIHFDDMKGESGSLTGRTPSAPPTEAKRET
FT                   FAERKRREHERYAKERDENPAFVPTRGRFFLHDKRSTEPGPNGHRPFSKSKSRPYGLIV
FT                   DGNVRRHSKPDASEGQWTHDLHETVAGDEPTNKPSAVPESMSDFAPKPVPTAPRSTPPN
FT                   RSFSSTTLIGNVPVVVFLQGMARPIPFPAVPKKQHTRLPQHRPPLRRDKPVRISLPGQS
FT                   PRYIFPSTERSFIFIPRALRPNQQGYRGRGRGGFYGGRRPSFYAGSVYTPSVTASRRSS
FT                   MGKPASHDGYPSPAASVLSRHTVVTTENGKPIVRLPPPSRPLGGVPPAAAATGPAAVVP
FT                   ASLPQPMPQPQPQQPSYRESRPAPIPMHQPRPQKAVSVADIETPARFSFNAPQPQQEQP
FT                   FQHQVPMPINGPGYGADVQSAHAAGTPSSHIPERAIHAQPFQPYGFQQAQPFYPAAYPP
FT                   GTVFYPVSGTEFPPFNAAGMPGASLVPYPPAGQQAPYVVPGAHASSAEQPSQPGTVAHE
FT                   AGGTVYFYDTTQMWPNASYATPSAPGPGGVIGIGGMMTPPGTTFYYPQPQGGVYYAPQ"
FT   CDS_pept        complement(1427517..1428635)
FT                   /codon_start=1
FT                   /gene_family="HOG000193653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265248"
FT                   /orf_name="AFUA_3G05840"
FT                   /product="RNA binding protein Rnp24, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL92982.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058300"
FT                   /db_xref="HOGENOM:HBG325816"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FD39"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH1"
FT                   /transl_table=1
FT                   /translation="MAGLGEGSQKKRKLTDVPEIEIDVSAPEPPSKKALRKAKKKVAEP
FT                   TTDPTTKQEAAVPSKKQEDEAPKKRSDHGIWIGNLAFSVTKDDLRKFLTSNCTFADTTI
FT                   TRIHLPKGQEKFGKAQNKGFAYIDLANEKAVKEAVGLSEQLLSGRRVLIKDAKNFDGRP
FT                   KKSESDSAATVTKPPSKRIFVGNLGFDVTKEVLEEHFGQCGTVAHVHVATFQDSGKCKG
FT                   YAWVEFEDLAAAEAAVKGFVMIDEDEEDDEGSGEEESGKRRKSKKRRQRRVWVNQLLGR
FT                   RMRMEFAEDATTRYKKRFGKDGEGKKKDESVITEVEDGPLERESTGDRPQQSHPEKPKR
FT                   NNKPEYSRYAKETVQKLSGAIVEPQGKKITFD"
FT   CDS_pept        join(1429156..1429295,1429362..1430187)
FT                   /codon_start=1
FT                   /gene_family="HOG000193664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265249"
FT                   /orf_name="AFUA_3G05850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92981.1"
FT                   /db_xref="HOGENOM:HBG053308"
FT                   /db_xref="HOGENOM:HBG325815"
FT                   /db_xref="UniParc:UPI000051FF97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH2"
FT                   /transl_table=1
FT                   /translation="MALSWSYRKKYAKLKVKFELGMKESESLIREELRIEDLSKRIQEQ
FT                   NDQLLEVLLEFNESLHIPADQRFDLSAPGDSSFLPTPERSPMYVDTATAKSILKDAKAQ
FT                   MDAGSMTLEAYRTLEDDIKRGNAFAPRMHYTALQKVPHTAVPPLREDSSTNISLEEKLG
FT                   YLTPEHETEYYLSMDAKLGDEAAALELSRIPEKPSFAERERELALRNPVSVYNWLRRNQ
FT                   PHIFLQDHENASEKSGSRPINARASKRVTQPRKEEDVYDEDGVLMDTGPTPGSTKGKRK
FT                   RDDDTGYRPKGGSSRPSKKKKDDTNSNAKRTSKRSSGVGA"
FT   CDS_pept        join(1430843..1431063,1431155..1432106)
FT                   /codon_start=1
FT                   /gene_family="HOG000193685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265250"
FT                   /orf_name="AFUA_3G05860"
FT                   /product="Exosome complex exonuclease Rrp4, putative "
FT                   /function="exonuclease activity"
FT                   /protein_id="EAL92980.1"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="HOGENOM:HBG351773"
FT                   /db_xref="HOGENOM:HBG735314"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000051E7E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH3"
FT                   /transl_table=1
FT                   /translation="MAITILPPVVQDVDSPHPDSDFDSMSIDSDGGVDLTSRGGSRPSK
FT                   RPRLVEGTKIGAGIVTPGEVVTDDPQWMRGHGTYSNPLSTSIIATVAGTVQKTNKLLSV
FT                   QPLRARYIPEIGDLVVGRIVEVQSRRWKVDIAAPLLAQLPLSAINLPGGILRRRTSADE
FT                   LQIRTFFSEGDLVVAEVQSVHSDGSASLHTRSLKYGKLRNGVFLAVAGTGGSGASSSTV
FT                   KGGPGAGTASAGLLGTSGTGGVVRARRQQWTVNTANGGGEVNIILGVNGYIWIAKHADG
FT                   AAAASSTTENVSITRMEEMVSSSIYSSQNDEIPPQTRREIARLAQCIRVLVQGGVRVDE
FT                   ETVMRAYDASLQVDLEVGDDEDEDERRREGREYLEGTKASGILALATVAR"
FT   CDS_pept        join(1433014..1433204,1433336..1434581)
FT                   /codon_start=1
FT                   /gene_family="HOG000193686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056632"
FT                   /orf_name="AFUA_3G05870"
FT                   /product="IFRD domain protein"
FT                   /function="binding"
FT                   /protein_id="EAL92979.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG053307"
FT                   /db_xref="HOGENOM:HBG325814"
FT                   /db_xref="InterPro:IPR007701"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000052064B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH4"
FT                   /transl_table=1
FT                   /translation="MPDLRRQIFESGKTMSRKAASREGSRRPSRAASAQSSKQSSRNVS
FT                   RHPSDEEDEGNLSDDTAYSLGSLDDVGDIIPDAGTNANWPEELEDVVEDILDRKRSSVL
FT                   AREEAYAAFCRLAKSHYIEDRIRTRVLDLVSAFAKSIKFESSVRETTLALRALSLLTIT
FT                   AFDNTIYENVEPLLTRTIRDSTSPVIKAAAIHCLGVCTSFGGAGEDSIVDQMTFFLDIA
FT                   ASDGHSIDAADDGATVTAALQEWGYLATEIEDLEAESEEAVQIFMDQLNSNDPARQIAA
FT                   GENIALLYEKSYTPQEDDDDEDEEVKSDEEEFMGARDRDGPKLVKRYNAYHNTHELEQQ
FT                   LQSLATVHKKHISKRDKKNLHSNFASILTTVENPRRGPMYNKAIDQDSNRQYGSKVRVK
FT                   IGREGVMSIDRWWKWIRLNSLRRVLQGGFAVHYFEGNRAVLDSLPLMVRAPPSERTSAR
FT                   KSTRPRNNHRWAVHDQSDED"
FT   CDS_pept        join(complement(1438016..1438051),
FT                   complement(1435038..1437899))
FT                   /codon_start=1
FT                   /gene_family="HOG000193697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056633"
FT                   /orf_name="AFUA_3G05880"
FT                   /product="Oxysterol binding protein (Osh3), putative "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="EAL92978.2"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG053305"
FT                   /db_xref="HOGENOM:HBG397047"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0000F519DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH5"
FT                   /transl_table=1
FT                   /translation="MAAMEELEIHSKSYFVRWVNVKPDHTISWSIQPHKKSLNFGIFKH
FT                   PGHSGVLSSTNHPAGDYHSTDSSENLPSAAAAAGSRTSVIEKLTSIGLKQVRWIGKCEA
FT                   DKIVKGTYDVPHNEGGNYALVFDNTFSKQISKTVTLVLLTYPTHSGPTNHSTTQLAREV
FT                   EFAENANATARNRGNSILSKAPSQAVSTTSGTTHTGLLHKRRRKRHQGWARRYFSLDFT
FT                   SSTLSYYHDRNSSALRGSIPLSLAAVACNEKSREISIDSGTEVWHLRASNDQDFIAWKR
FT                   ALEKASSKASAEDSHAPEVLLRVPSQRFLTNAAEEREWMQVEHLVSKVSGSRDAVRRLA
FT                   RDTDPKYLNNSSALTPYERPRGRSPSPHPEANGEDYFEARERRPFWKRKPSSNSNQTAK
FT                   RSTATTTTTTTTIAASSQLAVPSPAADAASLAGDRKPSSIASHPDQAEEIHDHLMALLR
FT                   DLDHVVSEFSALIAESRHRRHPPGMTAQSRLSMESEMSQEFFDAVDGGNTSPLLTIKGD
FT                   SDDEGAGDTARQTEDEVVADDAPSDSEEEAAEPVTPHGGEKDSSLFPSRPKSLSPLPLS
FT                   PVRRRGNIAAPTVMPPSLIGFLRKNVGKDLSQISMPVSSNEPLSLLQRAAEVLEYSTLL
FT                   DQAAKAADSLERLMYVTAFAISSLSSNRVRERAIRKPFNPMLGETYELVREDLGFRFIA
FT                   EKVSHRPVQLAYQADSKDWSLAQSPMPTQKFWGKSAEIITEGKFRLTLHTTGEHFSWSA
FT                   ASSFLRNIIAGEKYVEPVGEMPVLNETTGQKSVSTFKAGGMFSGRSEEVITKAVDPYNN
FT                   ELPLGLTGTWTSSLQLTKNGSATGTVIWKAGPLVPNAPKHYGLTAFAATLNEITPIEEK
FT                   RLPVTDSRLRPDQRALEDGDVDRAEQVKVQLEEAQRARRREMEAAGESWTPRWFKRVDA
FT                   DEDAEDVWALKPGKDGYWEERARGTWTGVVPVFEA"
FT   CDS_pept        join(complement(1443299..1443481),
FT                   complement(1443035..1443214),complement(1439306..1442957),
FT                   complement(1438969..1439216))
FT                   /codon_start=1
FT                   /gene_family="HOG000193710" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056634"
FT                   /gene_name="spt6"
FT                   /orf_name="AFUA_3G05890"
FT                   /product="Transcription elongation factor spt6 "
FT                   /function="transcription elongation regulator activity "
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL92977.1"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="HOGENOM:HBG112190"
FT                   /db_xref="HOGENOM:HBG397800"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR017072"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="UniParc:UPI000051F3C5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WWH6"
FT                   /transl_table=1
FT                   /translation="MSARDFVEGEAVLDDEENENEEEQEEDYDGEVHEGAGTMNHYNDS
FT                   SEEEEEDDDDEEAARAIREGFIVDEDEEIEERAERRREKRKRRREEREREDEHLDEEDL
FT                   ELIGELNPAFQSAAATESKFKRLKRGHKDHRQASQGIDDIFNSDEDEEAAGDYGRPSHR
FT                   RPMHDEMKDFIEEDVFTDDELEREREDLEIARPAKRGVTGLGATDAAGLDENALEDMRA
FT                   AFGDGNEYLFALEMEEQEEEQEEDQEKHLDLKDVFEPSQLAERMLTEEDNQIRLLDEPE
FT                   RHQLARKPYRNLVLTEEQFREEAAWIANLMLLKKRIEPELREPFQRSVAKVLEFLVTDD
FT                   WEVPFIFQHRKDYMIHATKVPVAGAPADGDTSQYTIKAEKLLNMTDLWDIFDHDLKFRA
FT                   LVEKRNTIQKTYDNLQSLFNVNDSVVQDMLSTAVTMEELQDVQDYVHFQYASQLRDINL
FT                   MNGEANGDTHRRKATGRSFFERVRNGKAYGLVRAFGITADAFAQNALKEGRRQYTEDPA
FT                   ERPEEMADSFIDNDFSNASHVLKAAKALFAEEIVMSPKMRKVIRQAYYMNGAVDCFRTE
FT                   KGLRRIDEQHPYYEFKYLRNQQLSDIARQPELYLRMLKAEEEGLVEVKVRFENFDHFRQ
FT                   RLYPDIESDNYSEIADAWNRTRREVLDMALGKLERLINRSVKENIRQECENHVAKECRE
FT                   AFSQRLDQAPYKPKGMVLGTVPRVLAMSTGTGIVGRDPIHWAYVEEDGRVLENGKFVDL
FT                   SIGDRDRSIPDGKDVEALIELLERRRPDVIGVSGMSPETRKLYKLLTELVEKKDLRGAT
FT                   YTDERDEEISDPLEVVIVNDEVARLYQHSERAKKDHPSFGPLTHYCVALAKYLQSPLKE
FT                   YASLGRDIVSIQFKRGQQLVAQELLLKQLETALVDMVNLVGVDINEAVTDPATANLLPY
FT                   VCGLGPRKAAHLLKIVNMNGGVVNNRVELLGVNAQYPAMGVKVWNNCASFLFIDFENAD
FT                   PDADPLDNTRVHPEDYDIARKMAADALELDEEDIKAETDENGPGAIVRKLFRDEAQDRV
FT                   NDLILEEYAEQLEKNLNQRKRATLETIRAELQQPYEELRKQFALLSTDDVFTMLTGETS
FT                   DTLAEGMVVPISIKRITDDHIDGKLDCGVDVLVPESELTDRYDIPVRALYSLHQTLPAK
FT                   VLFLNKKNFLCNVSLREEQVSRPTPRPRDHMRGEWDDRQEAKDREMLQEKTQSGGRVMR
FT                   VIKHPLFRPFNSTQAEEFLGSQSRGDVVIRPSSKGPDHLAVTWKVADGIFQHIDVLELD
FT                   KENEFSVGRTLKVGGRYTYSDLDDLIFNHVKAMAKKVDEMMLHEKYQEGSKDATYSWLN
FT                   TYTKANPRRSAYAFCIDPKHPGYFQLCFKAGENAQLHSWPVKVIPQGYELQRNPYPDMR
FT                   ALCNGFKLLFTNMQAGKR"
FT   CDS_pept        join(1444958..1445245,1445323..1445480,1445557..1446094,
FT                   1446160..1446786)
FT                   /codon_start=1
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751301"
FT                   /orf_name="AFUA_3G05900"
FT                   /product="MAP kinase kinase Ste7"
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL92976.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005208C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH7"
FT                   /transl_table=1
FT                   /translation="MADQFKARTLKRKNVKGLALNSTPKPLPKPSEGDAQIPGAIGNTD
FT                   SNRTDTLEIGLEFRLDLRSEDLITLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKE
FT                   NVRKQILRELQVGHDCNSPHIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVRV
FT                   DVLGKITESVLAGLVYLYEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIADT
FT                   FVGTSTYMAPERIQGGAYTVRSDVWSVGLTVMELAVGRFPFDTSDSSAGDRASAGPMGI
FT                   LDLLQQIVHEPAPKLPKSDAFPPILHEFVAKCLLKKPEERPTPRELYDKDAFLQAAKRT
FT                   PVDLQEWAISMMERHNRKSYLAPPAPKSLKEEAGHPTPPPKPAVSRPSRTPGHVPTSGE
FT                   IPLNIANDSSSSSHSRHYNVPSDSSGHMARTTRSPPPLSLEHLSLETREEEYRTGRRPS
FT                   RNYLGDPVSAIDAPSRPQISSRSASSHNTKSRMPLQTATLPLRAAPPPSGPPPPAPVSA
FT                   GGSWRHQMNQSRGDMTGAV"
FT   CDS_pept        join(complement(1448165..1450275),
FT                   complement(1447686..1448082))
FT                   /codon_start=1
FT                   /gene_family="HOG000193721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751302"
FT                   /orf_name="AFUA_3G05910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92975.1"
FT                   /db_xref="HOGENOM:HBG053304"
FT                   /db_xref="InterPro:IPR014840"
FT                   /db_xref="UniParc:UPI00005201C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH8"
FT                   /transl_table=1
FT                   /translation="MSADPPENGWPSKEDESLSSIDSNARPRRASATTRRSRRKKDDDA
FT                   DVTQKNLARSKPQKDNNNNNNNNNNNNNSKDGAKDAKEKSKPRGSRRQREKSTSTNPNN
FT                   STATPASSSNSINDNPSTTAPLDQNSSNNSRKKPKLEPTPPDEIPKSISVSSITTPSAP
FT                   APAPAPALASTTPTTSTGRSPHLTASSALHLHQPPQHEHPHQQQHQHQLNPSSSLPPYS
FT                   NSIPTHAPSPAYAMNHHSLPPPPPQSQPPPPAPPQRRSGQNYDPIRSAFDTASSAPAPA
FT                   TTSPPAQNPSPRSTFRASASPAISSIIDPPQPTSTQHIYSPIPRPSPSHIPSTLSSPGI
FT                   HPNASQSAHPSLAPSPLPATSPSHGSILAPQHPLPLASQPQQSSPPYSHRSPYPPQQQL
FT                   PQPQPPRSPRNEHKPVAAAPEPVPSSEAPPKSPPKQEAEPPVPPTKQALTKLASPPEEP
FT                   AAMDVDTDEPAQPNAEAKAPKKEKGSTATTATAPSSNAASPKPARPVKEAAPPLPQGSG
FT                   LISNALFGTDDTRSSGSSRTSPNIILHIPLQRDGNQIINFARMAEEQYGFAALHPRLAA
FT                   HKERLARVAAAGAALERNEKGGKGLSAGESADEDLSLDVDRDSDLDGDVAMGGVGVNAT
FT                   ATTNGATGTDASDGKKKRRKKKMEEYDRDDPFVDDSELAWQEHAAASKDGFFVYSGPLV
FT                   PEGEKVQVERADGTIKRGRGRGRGGRSRGGSSTHQVPIAAAVPISQETGLPLRGPGSRG
FT                   GSTTRRPRPSKPRQQAEQDKQGASSATSQGRGGGQAGRGGGAAGTRGGKTPSMLELAPA
FT                   PRPSLAPAPPGPSPLAGPELVSK"
FT   CDS_pept        1451977..1453446
FT                   /codon_start=1
FT                   /gene_family="HOG000193732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265251"
FT                   /orf_name="AFUA_3G05940"
FT                   /product="Transcription factor Rba50, putative "
FT                   /protein_id="EAL92974.1"
FT                   /db_xref="HOGENOM:HBG053303"
FT                   /db_xref="HOGENOM:HBG325811"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="UniParc:UPI0000520682"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWH9"
FT                   /transl_table=1
FT                   /translation="MAFRGQRFTLNLDDDDADLDLDSSQPSLGSSSFGLIGEIRERSPS
FT                   AAIPPAPKPSTASTGFPQHRRRVNQFAFKQRRANRQQESTPPPAATPSTTLSDEKKSID
FT                   EENRRQLASMSPAQIQQEREELMSSLNPSLLERFLRRARIDDDDSITPSEKSSSQPEPP
FT                   LSSASSAQDASTAKSKKSVSFDVEEDSKTATEKPERSQRKRTPPTVTSSVLTPEDLPPA
FT                   QPPADLHPASEMPSHEAFHFPTPPRQDKPPNLDPASPSFLSDLQAHYFPEISHDPSALS
FT                   WLQPPSADPEDPDSTSAYHPASSAEAVHPSALRFSLLGNVLSPATSLSLPTTLGLHHHG
FT                   KDPHAAGYTIPELAILSRSTFPAQRCIAWQVLGRILFRLGKGQFGERGSPLVEGLWSVI
FT                   EREGVVAGMLAEADGAPSGPTRSAAAQDSTAADLNHPSPLPAQGTPVPKGATGIGRHAS
FT                   ASAWAVEGVWLWQMGGGGDRGILKENTIRSQ"
FT   CDS_pept        complement(1453727..1459969)
FT                   /codon_start=1
FT                   /gene_family="HOG000193743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903366"
FT                   /orf_name="AFUA_3G05950"
FT                   /product="20S cyclosome subunit (APC1/BimE), putative "
FT                   /protein_id="EAL92973.1"
FT                   /db_xref="HOGENOM:HBG053302"
FT                   /db_xref="HOGENOM:HBG325809"
FT                   /db_xref="UniParc:UPI000051F3B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWI0"
FT                   /transl_table=1
FT                   /translation="MACVRSLGLHEPSALPFLVAEDLLPPDPSENQYEWSTTVDEGPNG
FT                   LVDDELVWTTSCVVWSRAGVVKRVFRLDIEREEIKHALFTRFSVEKSTESDGQTTQTQG
FT                   LNGNSGSQPGQSRGPQSQPSQNPPGTSPSLHDRPAQGSQAVENEDSSRALVVILKSQAH
FT                   IFFLHGNSHVIPLPFEVDSVFATPRGLLFQRKMQEDDTSIYPMAPPNSFISSFLTTDFR
FT                   ASESLELPSGKVKRPSLTISPAQNTALNCRATKTANLPRVFSLIDPHSEMGLVVTKQSS
FT                   RWLQRSINSKPSGLDALDPADEIVYVSPVNELLGSSRALSKSPLTLVVTVNLNTGLYTL
FT                   WTARYREDETGPSSKKQRRRDTGGTRSKRRSSHFSMATGATTPAARPSAARESFGPRGD
FT                   NWNASGFSHSQYSVDGRPDEDDLASRLGQDFGDLGVPSKTSRRVSSMLARTDLASSQDR
FT                   IAFSDLATGSQTGTVPHGGLRQSIGGTSTRGSLGFNPRGSLPPGTGSVYSTASSFVDAP
FT                   VDRLLEELNDDSLFEGFGNMELKETTSGLPEEVLLSKVESFSTRFSGTFQTPVRSFMPS
FT                   RRVKIITLCHSECEITQNGNSVALALYLLDQDAESMTVVNLRADRVALPKKDAVTAKKQ
FT                   RKKASSEERSLLVQATGIHHFANIQDACRVVDGHTSRILTLGAAHNGDNELYLQSPWSN
FT                   PIKIDIPHSLMLYERYGVSSSTSANRPRDSGMNRIMADSPISISGLDHPSVRGKFDVID
FT                   ATKRRHKLQIQMEPSNELVKDIIQICKFVLRGFEKAGDGILAGWWETVKWLRARGTGET
FT                   DLEWTAMIIVLFAMALQFIDSDQTPVKQARRKKGLLRSSSGSYVDLESWEAMLDKESSS
FT                   CGVVAPWMASSSWGWILEQDAEHDAVKSQGMNARKTDQQASKGSTFRTNTYLVRCIALA
FT                   REFLRTPQGNSTIGPNGHLPTALSCNDTLRRTALCTIVVGLHLFREEQKLSICDAEHER
FT                   KPLGLLAPVLAQIGGWLGWTSWTWADNAYYGSEMASMERWQFEASRISMMDIPPEPFAP
FT                   PSIFAHLETAWGQRSSPFFTLLDLVSTSESAPRNGRLWQECFRLTPRTLALNGLLSEIH
FT                   DISSSFDRVKLLHRWGLTRNVVETFPEGVSTPLYEAIMRTQTQASASWNANLLKLVERE
FT                   DLSMSMDMDTSYPPSIPPQPSLSHDAMRDFHQIGGSALEIDTINSFEASAETDRFSITR
FT                   LIFKDDKRFIEAAKLLNQSKAPVAECIPEPDWTDSDLLEAQKEVVQLVTLRTLSIPAGR
FT                   AMLAFSGRLPLLTEKLPIPSFSLQCVMKPSNVTVSAERAFFSEEKVCWAFFHNGVSTGL
FT                   AISKKSKGIDTSWILFNKPQELTNRHAGFLLALGLNGHLKSLAKWVAFKYLTPKHTMTS
FT                   IGLLLGLSASYLGTMDTLITRLLSVHVTRMLPPGAAELNLSPLTQTAGIMGIGLLYCNS
FT                   QHRRMSEVMLSEIENAEQEESSPSHEDLRDEGYRLAAGFALGFINLGKGKDLRGMRDMH
FT                   IVERLLAIAVGTKTVHLAHVLDRATAGATVALTIIFMKTNDEVLARKIDIPDTTVRFDY
FT                   VRPDLFLLRTLARHVIMWDSIRPSYDWIIESLPKIYRRRYRLTGVSRLKSDDMPFFNII
FT                   AGLCFALGLRFAGSAQLAVRDLLVAYLDQFIRICRLPAVNYDGRLTRNSVRNCQDIVAL
FT                   SAATVMAGTGDLALFRRLRSLHGRVDADTPYGSHMAAHMAIGLLFLGGGSYTVGTSDLA
FT                   IASLICSLYPIFPTTVLDNKCHLQAFRHLWVLAAEPRCLVPRDLDSRRPIHLPITVTNT
FT                   SGQKQTVTAPCLLPDLDSIAKVEIRSADYWPLVLDFTQNKRLYDKFRHGDQSVYLRRKA
FT                   TYNPTGSSVFVATLSGLSEAQDVLPSSATAPNPGRRLLPAAPPKAAALLTSGGSKLVPR
FT                   TAPAQSMWDWIFNLDSLQGLDIHERSLVLPASFPARVRYMGATGGPGDAPWLRVSAVDS
FT                   KLVIESSVQQVIRAAAGRGAAADEVRDRLWQLRLLYSWLDHVRAGEDTEAHGDDDDEEI
FT                   AASKGLWLRREFLEETRWKVWGVQMGSIS"
FT   CDS_pept        join(1460380..1460438,1460504..1462400)
FT                   /codon_start=1
FT                   /gene_family="HOG000193754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207933"
FT                   /orf_name="AFUA_3G05960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92972.1"
FT                   /db_xref="HOGENOM:HBG053301"
FT                   /db_xref="HOGENOM:HBG325808"
FT                   /db_xref="UniParc:UPI00005208E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WWI1"
FT                   /transl_table=1
FT                   /translation="MPSFPTRPLVKLRDDGLQLSYQLPQRVHAAKAYPILAPNGSSIIV
FT                   YGYENGLKVIWRGGK