(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_4

ID   ASFUM1_4; SV 1; linear; genomic DNA; GRV; FUN; 3923705 BP.
XX
AC   CM000172_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   4, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000172.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3923705
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 4"
FT                   /db_xref="taxon:330879"
FT   mobile_element  complement(8257..9054)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(12947..13282)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(14024..15277)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(complement(26296..26407),complement(25923..26261),
FT                   complement(25801..25879),complement(25548..25755),
FT                   complement(25372..25506),complement(25116..25329),
FT                   complement(24758..25071))
FT                   /codon_start=1
FT                   /gene_family="HOG000217527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210053"
FT                   /orf_name="AFUA_4G00100"
FT                   /product="Rhamnogalacturonase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="polygalacturonase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="EAL84408.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="HOGENOM:HBG054320"
FT                   /db_xref="HOGENOM:HBG324408"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051E8DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W933"
FT                   /transl_table=1
FT                   /translation="MPQRIQLDILASICEHHTCTFSSLYPLGSGSGPAHRPFDCNILSY
FT                   GAVADNTTDISTSLESAFNWCVRPNPSSRLVVPEGQYLISRGVVLSNATNWAFQLDGLI
FT                   TVAYGGNWTIDRALILEGLAGTDVLNTTINGEGDQKFLLDVLVIVNAVDFEFYSSNGLG
FT                   AFQGQGYLYRNLNNTDRPRLVRLISPINASVHDLILVDSPKFHIVLDFAINVEAYHLTI
FT                   RGANLGSYDGIDVIGTNYHIHDNEVTNRDECVSVKSPSHHALIENLVCNQAGSGISIGS
FT                   LNVSAEISNILAQNISIIQGNNIAFIKTYPGGSGYVTNVTFSNFRSKASLYGLNINQYW
FT                   QNTFEPDTGSVTLSNLVFRNFSGSVANGVQRPPLYLIVNDLTYATNVTVEDFTVWTESG
FT                   SSIVNKISNVFGHGDDSYGPNNGLVSLGAAEQPHTYTSTNIITASPTGWVPPKSPTWAA
FT                   PSTGYGSK"
FT   CDS_pept        join(complement(27162..27825),complement(26994..27115),
FT                   complement(26675..26941))
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210054"
FT                   /orf_name="AFUA_4G00110"
FT                   /product="TfdA family taurine dioxygenase, putative "
FT                   /EC_number="1.14.11.17"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /function="taurine dioxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84407.1"
FT                   /db_xref="GO:0000908"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054319"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000051EB2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W934"
FT                   /transl_table=1
FT                   /translation="MPDNSITKMTAKEVQLPSKPANLPHLNYHTPRGVSPLESVRAAGL
FT                   EYPNYTPFKLPNLTLHPFTDRGHYADPSKSRLLSAATEIIHLTPDIGTEIAGLQLTALT
FT                   PAQKDDLALLVAERGVVFFRDQDMDVHEQIAFAAYFGELHIHQMAGIIPDLPWVHPIYK
FT                   DRTAVNGRSHQIWHSDVSYELQPPGLTMLRMDTLPAAGPGGSLAGGDTVWASGYALYES
FT                   LSPKLRAFLETLEAKHSGLEQAEKALKTNGCLRRDPIETIHPVVRTHPVTKWKTLYVNE
FT                   NFTKEIIGIEKRVSDALLDTLYRTIAEAYEYQVRWKWTPNAVAIWDNRVTFHTGIFDYC
FT                   MSTPLFYGPC"
FT   CDS_pept        complement(27966..29627)
FT                   /codon_start=1
FT                   /gene_family="HOG000178876" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273679"
FT                   /orf_name="AFUA_4G00120"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84406.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054317"
FT                   /db_xref="HOGENOM:HBG324086"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F9B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W935"
FT                   /transl_table=1
FT                   /translation="MLVSDKQEAKDGSNMHLSEPQEQWHSRSFLSLFERTRKVDLDATA
FT                   TTKSVFDDPVLAKYYLPHPQYENMHRFDADFRWTYREEIAVRRKTDLKIFLWILVMFFG
FT                   LNLDRGNLGNASADSLLQDLHINTNDFNNAQNMYRIGFLISEIPSQMVGKRLGPDRWIP
FT                   VQIILWSLASGGQFFIHNRAGFFACRFFLGFFMGGFIPDAILYLSYFYKKTEMPLRLAF
FT                   FWFVDSISGVIASFIAYGVLHMRGVAGRAGWRWLFLIEALISLIIGVLSFLFLIPGPTQ
FT                   TATWWNPKGYFTEREEKIIVNRVLRDDPSKGDMHNRQALSIGMLWRSLKDYDLWPIYII
FT                   GMLFEIPTSPPKSYLSLSLRAIGFSTFQTTLLGIPVTVFAAFNLLVVTEFTERFHQIAA
FT                   IGILTQLWSLPLLIVLYTSVEALSHWGLYAVTFVLLGWPSPHAAHAGWCSRLSNAVRTR
FT                   TVSAALYNITIQLSGIASSNIYREDDKPYYRRGNSQLIAINVATIVAYMLAKGYYVARN
FT                   RWKKQRWEAMSEIQKAEYLETTTDEGNKRLDFLFDS"
FT   CDS_pept        join(complement(30020..30109),complement(29730..29831))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905460"
FT                   /orf_name="AFUA_4G00130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84405.1"
FT                   /db_xref="HOGENOM:HBG054316"
FT                   /db_xref="UniParc:UPI000051F74A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W936"
FT                   /transl_table=1
FT                   /translation="MQWLFSRQDLTQLTVRAYWTAPSPPCRVAVIDFTITKYPSDAIYT
FT                   YMTTSSVIPSSLQALTLR"
FT   CDS_pept        join(31312..31536,31649..31986,32188..32350)
FT                   /codon_start=1
FT                   /gene_family="HOG000048687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058735"
FT                   /orf_name="AFUA_4G00140"
FT                   /product="RTA1 domain protein, putative "
FT                   /protein_id="EAL84404.1"
FT                   /db_xref="HOGENOM:HBG054315"
FT                   /db_xref="UniParc:UPI0000520797"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W937"
FT                   /transl_table=1
FT                   /translation="MLLEAHQAIALMDPEHCTLDTCPIQNAYIHYQPTIAGNSVYLALF
FT                   GIFLFTQLIQSIFFRMWGFAGAMAAGLVLEKLDLSQPWTGFLLCCPLPAPRLDHHHLPR
FT                   RRDLAVEAQKLCHLLRFMRCHCAHPAERRWSSYLCGRRCRWSTNGIERHDCRSSLPGCC
FT                   TDSFYCPSFSLQSVYDVDISRENISDLANNEIAFMILEGAMVSITCLCLTIMHPGIYLG
FT                   SRNKRKGVLSEDVAMLSMR"
FT   CDS_pept        join(complement(37469..37684),complement(36940..37418),
FT                   complement(36547..36884),complement(35916..36496))
FT                   /codon_start=1
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905461"
FT                   /orf_name="AFUA_4G00150"
FT                   /product="MFS maltose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84403.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054314"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FE69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W938"
FT                   /transl_table=1
FT                   /translation="MDNVTEKQTSALELEEQPVSKGGPVYDVNEKVGLDRAGAINAEDV
FT                   EHKMTVVEAVKAYPAASWWAFVMSCTIIMESYCVFLMGQFIATKRFARDYGVWSDVKQD
FT                   FIIEASWQSAFQCSGPVGAFIGVFIAGPITSWIGYRWATIGGLMFLNAFIFIFYFGNSQ
FT                   GMFLASQILEGIPWGIFVANAPAYCSEIVPMRLRAPATQMLQMFWAIGSIIVGGITYHY
FT                   QSRDDPTAYRIPIALQWMFPTPLAILLYLAPESPWWLVRKGRLADAEKAVRRLGRASAN
FT                   DDPADAVAMMRRTIELEKTEKKPSLVELWKGTDLYRTLIVCGVYASQNLTGNLIANQAV
FT                   YFFKQAGMADNTAFALGLITSALQWIMVMLSWILTTYLGRRTIYVYGQLINCVFLVALG
FT                   IAASVGASKAASNAQASLGLIVSVLFCLGPAPASWVIIGETSSVRLRPLTTGIGRGAYY
FT                   VVNIPCIFLASYMLNADKWNLGGKSGYVWAGTAFICTFMSWLWIPEMKDRSFREIDILF
FT                   KRRVPARKWKQTVVDINDDE"
FT   CDS_pept        join(42990..43223,43262..43893,43951..44062)
FT                   /codon_start=1
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273680"
FT                   /orf_name="AFUA_4G00160"
FT                   /product="Short-chain dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84402.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054313"
FT                   /db_xref="HOGENOM:HBG331316"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51BF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W939"
FT                   /transl_table=1
FT                   /translation="MSGVFGLLFSRLTLPAPSAIQGKTILITGANTGLGREAARHALAL
FT                   GAGTVILGVRSLSKGEDAKANIDASTGCTDKGKRSRLRSASSQICHRGGRLDMAIMNAG
FT                   IASVTYAVTRDGWERGIQVNVLSTALLSLELLPLLLRTKERDSSSQPHLTIVTSDIHKS
FT                   IKFPERNEQNILSAMNDEKQWRESQAVGGATERYGVTKLMDLFITFEIAQLVPRDKSGN
FT                   PLVIVNAVAPGFCKSDLLSREKVPLILKLIQALIARTAEEGSKTLLHAASQGAETHGKW
FT                   LDNQIITEPGNIITSPEAAVLRKKLWAEILSVLHDVNPEIQTEY"
FT   CDS_pept        join(44889..45284,45341..45438,45497..45738,45792..46903,
FT                   46954..47486,47562..48216,48266..48545,48601..48695)
FT                   /codon_start=1
FT                   /gene_family="HOG000190920" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753327"
FT                   /orf_name="AFUA_4G00180"
FT                   /product="Fatty acid oxygenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="EAL84400.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054311"
FT                   /db_xref="HOGENOM:HBG324204"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002007"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="UniParc:UPI0000F51BE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W941"
FT                   /transl_table=1
FT                   /translation="MRPEPQTEGASSKTSDDSHARFVDTAPKRVHEVQRFNEPSREPPK
FT                   GDVGAEQGGAFGRFKDLSEVVHKATRPLPTETGNGTYIEDSSKGGSLWEDLLSLGIEDA
FT                   KTVKDFVKTEALRRPIDDKTMLMERIIQMVAKLPDKSKIREKGTHKFLGILWNSLPHPP
FT                   LSYVGDKYAYRSADGSYNNPTLPRLGAANTEYARTTEASKMRPASMPDPGLIFDSIFAR
FT                   ETFKPHANNVSSIFFTWASLIIHDVFQTGYPDQSINKTSSYLDLSTLYGDNQDEQNMIR
FT                   TFEDGKIKPDCFSEPRLHILPAASGVILIMLNRFHNYVAEQLAIINENGRFTKPKAEII
FT                   DPVEARLAWAKYDNDLFQTARLITCGMYINITLYDYLRTIINLNRDNSTWNLDPRTHDD
FT                   QDEIPTAQGNQCSVEFNLAYRWHSTIGRQDEAWTEKTYREIVGKPGQEATLQDLMDGMR
FT                   KFNARMDKDPSKRTFAGLQRQGNGTFRDVDLVDILTRAIEEVSGSFGPNNVPKVLRSVE
FT                   ILGIQQARKWNIGSLNEFRKFFDLKPYESFEEINPDPYVADQLRHLYEHPDYVELYPGI
FT                   VAEEPKEPMVPGVGIAPGYTVSRAVLSDAVTLVRGDRFYTKEFNARNLTNWGFSEAKYN
FT                   LEINQGCSFYRLALRAFPKWFKYDSIYPHYPMTIPSENRVIMKALGREEDFSWDRPSYI
FT                   PQRISVFDYANVRHILQDASNFRVMWGEATAYVFGSKGWDFMLSGDAPTHANQRNIMSR
FT                   ALYRGQWHDAVKQFYLDITQQLLTEKSCRIGNVNQVDISRDVGNLAHVHFASNVFSLPL
FT                   KSREHPHGIITAHEMFEAMAVIFTAIFFDAEPVKSFELRHKAREAANKLGRLVELNVKA
FT                   IKSSGLIATLLGNMPANRNALFEYGVHMVERLLQSGLDPEQVTWSQVLPTAVAMVPNQA
FT                   QVFTQIIDYYLSDKGRKHLPDIKRFAKEDSPASDEVLLRYCMEAIRLNGIFGSYRKSQT
FT                   NLTLDDKGGKVHIKAGDNVFVSFIDANRDPDVFPKPEEVDLNRPMESYIHYGVGPHTCL
FT                   GSEASKVALTTMLRVVGRLDNLRRAPGAQGELKKIPREHGFYTYMREDQSSFYPFSMSW
FT                   KLHYDGEIPGKEQPVRGDFVCNVPGHWQN"
FT   CDS_pept        52605..53111
FT                   /codon_start=1
FT                   /gene_family="HOG000253046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058736"
FT                   /orf_name="AFUA_4G00195"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27177.1"
FT                   /db_xref="UniParc:UPI0000F51BAF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA86"
FT                   /transl_table=1
FT                   /translation="MGNVNSITQCFPLQRTYTQTSPSRETREVASNVVTIILTSDTPYA
FT                   IKKRLDESIRTAGWTESLALAILRGLENAIETGAQVAEAASKALARATSEAFEFSREHP
FT                   IFVTILALGVLAILTPWVIEVLGFGELGPIEGSFAASWQRTYAGYVPKRSLFSFFQRVG
FT                   MVWKH"
FT   CDS_pept        join(54334..54582,54639..55733)
FT                   /codon_start=1
FT                   /gene_family="HOG000216789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905462"
FT                   /orf_name="AFUA_4G00200"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84398.1"
FT                   /db_xref="HOGENOM:HBG054309"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00005200A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W943"
FT                   /transl_table=1
FT                   /translation="MASIIVLPTELLARIISFLDRSSLKAIRQTSRRLSQIATPQLFAT
FT                   LRLFPDEKSYEAVDRITDHATLKKMVKKVYVNTCEDDYDDYDEEEVELTKDFKDRITKF
FT                   RDFPNVQSAVLRFDKHCCTGHELWMTERPETIAFRTETLRVFFQWLASFETPLRELGIR
FT                   NMQDVNVGDENISANIEKLLQNLCTLRLSIVTEHNDGAPEYDVEFPELHDFFAQIPSVW
FT                   LKPSASSLEHLTLSCDNYFGFYPQLELSEVHFPHLKSLAFGNYCFVRDSQLEWILSHAA
FT                   TLTNLSFDDCAILYDVCLAEEHLNWGPFLKSEMEIRRELDDRVRKKYYRSYDKRWHDYF
FT                   DSFRTKLPHLRQFLIGSNDWGDGVPFEKEAEVRICLRESRYMACYDGYGPSPYMENHHY
FT                   RLPEWERAPPKCDDEDRDSLRLLFEKTGQRVVKIPFLTHGYMSADEEF"
FT   CDS_pept        join(complement(61172..61485),complement(60810..61110),
FT                   complement(57321..60758),complement(55988..57262))
FT                   /codon_start=1
FT                   /gene_family="HOG000168774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905463"
FT                   /orf_name="AFUA_4G00210"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84397.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG054308"
FT                   /db_xref="HOGENOM:HBG324402"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniParc:UPI000052079D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W944"
FT                   /transl_table=1
FT                   /translation="MQGPSQLALFYFANGLPPDDIQDLFQRLRSQSKTESGWTLRAFVV
FT                   QATNALREEIRQLPHHLRNPLTPLDNALDLAVVPDWRRGPLAGALEGVLLCLIEIGSLI
FT                   AYYERTPDPFKFSARTACFTGIGTGLLAAAAAAASPTLADLPRLGAAAVRIALRMGVLV
FT                   AETSQSVEAREPDAPADNWAAVVMDLDEDTVREELNLFNASTNNLGPSRLFISAGGTDN
FT                   VTISGPPSKLRQVFRVSEKLRSARYAQLPVYGGLCHAPHLYNCHHWTWIMEPINGAAFN
FT                   QNMVDTAPLFSAGDDVPFEASTPRQLFESVVCDLLMGMIRWNRAVDGVVELLGQTLPSE
FT                   CQVYAFRPCAVVTGMVASGQVKLPHCQFQTHDLLGWTCHDDTDNGPTCREDSSIAIVGM
FT                   ACRFPGGANDLNQFWDLLEQGADVHRRVPADRYDVESHTDTSGKSRNTSLTPFGCFIDQ
FT                   PGLFDAGFFDMSPREAMQTDPMHRLALMTAYEALEQAGFVPNRTESTHLKRIGTFYGQS
FT                   CDDYREANAGQEVDTYYIPGGCRAFAPGRINYFFKFSGPSFDCDTACSSSLATIQMACT
FT                   SLQHGDTNMAVAGGLNILTNSDGFAGLSRGHFLSKTGGCKTFDCNADGYCRADGIGSIV
FT                   LKRLDDAQRDNDHIFGIILAAATNHSARAISITHPHAPSQAELYRDILTRAGVSPLDVD
FT                   FIEMHGTGTQAGDSTEMESITSVFSPGVPKRSRPLYIGSVKANVGHGEAAAGVMSLIKV
FT                   LLVLQRQAIPKHVGIKTALNPRFPNLDRLNVRIPHDQVPWPRSPTRKRYALVNNFSAAG
FT                   GNTSLLIEEPPVRPEPKADPRAAFTVAVSAKSKASLKNNLRSFLAYLESQPSISLAHLS
FT                   YTTTARRMHHNHRIAVHGSTLSSIMQELEPYLPAVDTHRPVPNTPPSIAFVFSGQGSFY
FT                   TGIARQLYEHHPGFRLQITRLHNICLSHGFPSFRRAITGDLSNDGSEAEPIITHLTIVC
FT                   VSIALCRLWETLGVKPCVVAGASLGEFAALYAAGVLSASDAIYLVGRRAQLLQELCTPN
FT                   THAMLAVRATVEQIRNVLAGQPYEVACINGSSDITLSCSVADIINLQLAIEQHGYKCTR
FT                   LDVPFAFHSAQMDPLLGPFEHIARGVTFKAPNIPVMSPSLGDCVFDGKTINASYMCNVT
FT                   RNPVKFVDALETARGMDLVDAKTVWVEIGPHASYSRFVGSAMPPGTATIASLNRNEDNW
FT                   STFARSMAQLHNLGVDLNWHEWHAPFESELRLLTDLPAYQWNMKNYWIQYNGDWMLRKD
FT                   GKSSAAAASHPHQAIPPALRTSLVHRLVCESVQETRVEVIVESDILHPDFFEAMNGHRM
FT                   NGCAVATTAIHADIAFTLAKYLYSSIMPNSTDAPAINVKNMQVQHGLVARKDRSRPQLI
FT                   RIRGIADVTRGLVSLSWHLVDEQGRRVEESFATAVAEFGNHEAWLEEWSPMTHLVVSRI
FT                   DVLQRLADDGTANRLSRDMVYMLFNNLVDYAEKYRGMQMVVLHGLEAMANVTLAAPEQS
FT                   GGKWTVAPHYIDSVVHLAGFILNGGNGLDPRRNFYVTPGWKSMRFARPLVPGVRYQSYV
FT                   KMMPIREQSGFYAGDVYILHEGQIVGLVGGITFRTFPRSLINTFFSPPDTMTHGGSQAG
FT                   SVHQPACSERTLPVGPARQDSAARETLCQGHGLSRTVMDSSDSSPATTLTPPTLPSVAA
FT                   STESPIVHRAMALIAAETAIELTELSDETAFSSIGVDSLLSLVLAEKFTAEFHLDFRSS
FT                   LFLDCPTIGDLKAWLIDYC"
FT   CDS_pept        join(complement(62725..62856),complement(61850..62665))
FT                   /codon_start=1
FT                   /gene_family="HOG000246879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273681"
FT                   /orf_name="AFUA_4G00220"
FT                   /product="Metallo-beta-lactamase domain protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84396.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054306"
FT                   /db_xref="HOGENOM:HBG324401"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI000051EB2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W945"
FT                   /transl_table=1
FT                   /translation="MDQYSNLFAFEDYLGAQARSIPDLPEVDVLSPRVVRVLGGNPGQM
FT                   QLQGTNTYILGTGAERLLIDSGQGRARWEQLMASLAAEHKFRISTVLLTHWHLDHTGGV
FT                   PHLFRIFPELRGANAIYKYHPDPSQQAIVDGQVFSVEGATVRAVFTPGHSTDHMCFLLQ
FT                   EEEAIFTGDTVLGHGTTGVEDLEEYMQSLRKIQSLGCRIGYPGHGAVIENMQQKVQQEI
FT                   DRKQRRERQVLLALQNIQREKRTVGDANGAATQAELIEAIFGRLPADVADRFFAPYMKD
FT                   ILMKMARDKQVGFRFKGGQKHWFANVSQENPVCR"
FT   CDS_pept        join(63169..63229,63311..63795)
FT                   /codon_start=1
FT                   /gene_family="HOG000189880" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210055"
FT                   /orf_name="AFUA_4G00225"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27176.1"
FT                   /db_xref="InterPro:IPR013901"
FT                   /db_xref="UniParc:UPI0000F51BBD"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA85"
FT                   /transl_table=1
FT                   /translation="MASVQGLIKIVAITGGVWLSGKITAHSLVSVPALLQTRSADGLSP
FT                   CTILRVWRRIYEQGHRHSPQIAACTSTAFAYLAWCASDRTPRLLYGTAACSVMGIVPYT
FT                   LLFMGPTNSRLLERSAAEEEKVPGATRGEDMVNVPSEMTTEELLSHWRFLAGIRGLLPL
FT                   AGGILGLFAALYSNEGAR"
FT   CDS_pept        join(complement(65000..65225),complement(64476..64951),
FT                   complement(64101..64412))
FT                   /codon_start=1
FT                   /gene_family="HOG000276736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905464"
FT                   /orf_name="AFUA_4G00230"
FT                   /product="Oxidoreductase, 2OG-Fe(II) oxygenase family,
FT                   putative"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84395.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054305"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0000F51BBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W946"
FT                   /transl_table=1
FT                   /translation="MTKPQPPPILDFSVFYGHDSQAKAQLVQRVRECCLNNGFFQITGH
FT                   KVSPELQRRTFDCAKRFFDLPLIEKKKIERSPDAFNRGYEAFQSHMSQPGSAPDRKEGL
FT                   FLGPDLAEDHPYCVQKKLNCGPNRWPQGLDDLEEFKLVSMEYYAALFQLAKDVVAVLAL
FT                   TMDYEETFFDPLTEGAIATLRYLHYPPQPVGDAEAGLGTGAHRDYSCITLLLQDGTGGL
FT                   QVLDEPTGQWLDVKPVPGAYIVNLANVFARMTNGHYKSALHRVVNKSGMERYSIPFFFT
FT                   GNPDYVCECLSRFRKEGEPVRHPPATVHEVVAEAVRGTVERANRYNAERQGIHAAQ"
FT   CDS_pept        join(65900..65908,65963..66037,66091..66243)
FT                   /codon_start=1
FT                   /gene_family="HOG000178587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058737"
FT                   /orf_name="AFUA_4G00235"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27175.1"
FT                   /db_xref="HOGENOM:HBG627799"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniParc:UPI0000F51BC5"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA87"
FT                   /transl_table=1
FT                   /translation="MGNGAKAASKRERKAKDTKSTATSQLKANEAAKDIICLTCRQTFL
FT                   KTTRAPALTEHASNKHNKTLQDCFPGFVDAPKK"
FT   CDS_pept        join(complement(68937..68953),complement(68857..68870),
FT                   complement(68591..68798),complement(68364..68541),
FT                   complement(68221..68314),complement(68121..68162),
FT                   complement(67959..68067),complement(67393..67894),
FT                   complement(67249..67337),complement(66977..67190),
FT                   complement(66688..66900))
FT                   /codon_start=1
FT                   /gene_family="HOG000216786" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273682"
FT                   /orf_name="AFUA_4G00240"
FT                   /product="Amino acid transporter, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84394.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054304"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51BD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W947"
FT                   /transl_table=1
FT                   /translation="MIAFTGTIGNGLFLTSGKCLAAAGPGGVVVAYVIMGTVISSVISS
FT                   LGEMTALMPVNAPMMEFPRRFLDRGVGLAVGWIYWFSYVVMAADQIVTVAASIRFQYDD
FT                   GHTFISWATGMNTSPALWISVFLVVVIIVNMIPVKYFGELEYIVGCIKITFISMLIIMM
FT                   LILNLMKPRSSAYYSQPLGTKYWNSPYSFFNSDYRVKDEYGNLHQTISGGTGRLVGVWT
FT                   ACVRAFFSYTGMDMVTVTAAESKALADSEAMKMASRKISLRIITLYALSILTASFLVPT
FT                   DHPFINGEGQSSGARSIFIIAVVEAGLPALGQFFNAMFLFSAATCASDNLYVASRVLHT
FT                   LALRDQTGPEFIIRRLQQCRAGVPMRAVLVSAAVMLVAYLGPTGAPGARLTELSSNCTV
FT                   SFLIVYATICATYLCFYQTLDEAQKYGNNPQTQAGIYDRNHPRYPYKSHAQWLKAGFGM
FT                   VACIILLIFNGVNAFLTEPFDVRTFIASYISIPVFVLLIVSYKIRRHGFNLSQWGPERS
FT                   KDLRNCVQISSNRRKGRLEFPHPGLTVENGKRFLEWLWVWTK"
FT   CDS_pept        join(69578..69758,69815..70491,70574..71149,71205..72101,
FT                   72159..72980,73040..73261)
FT                   /codon_start=1
FT                   /gene_family="HOG000216785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905465"
FT                   /orf_name="AFUA_4G00250"
FT                   /product="WD40 repeat protein"
FT                   /protein_id="EAL84393.2"
FT                   /db_xref="HOGENOM:HBG054303"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000F51BE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W948"
FT                   /transl_table=1
FT                   /translation="MDDKDAGRASCLSHQPSHLGISLHFIAQPVIKPPAGFPRRRPSSM
FT                   KDNGVSGLTQTIRAIKPGQGTPSYSPRIALQKGNGDGLPSPIFSSLTGIWSLLALRSDI
FT                   DDIILELLGRFSLEKVYADADKESYADLILTLLVQLRVIFFIQRLTLPPGGTIPVDWSL
FT                   GFLVSWEVTVRTVEFILQIVLEAREVLWDSPLRDEYLSRLVLSTVQILLLHPKTPPNSR
FT                   LRDRRDRFARVHRALERVCDNYPDTSSSFLAVCRAIADALRAEPNALSLPPRLKQELPS
FT                   LTGDLYPLPDCLSSSSVATFVPQHGSSQSWLSQLLGLYDVAQYVVGANVQFAVNTRKVC
FT                   DPKLERASKSSRDAVLHALNRIRLPPYVSAGHLIPMISKDFRVILPDTPSLGQHRRDGN
FT                   TVDALEALRERLGHRLMVHRVSDGAMMHSVSQITRYIELLDNPGDQLRSASPALYVVNC
FT                   QECHFLGSSLVRQIATLTHLDDAGGASGVALPTESRCAFCGSAVTMVREVSLARYTWEH
FT                   LKPLSPNVEAINAERHLPSQFLLAPSRFDPLRRDSGMASGPSSGPSSPPPFGLSAFPQG
FT                   RTNAPRAEPWVDGPPVLGNQRTSETPPPRTLRPAAGEPPFSADSVGGFEPLSKTTTFTH
FT                   TSSSSSAGIRALSPPTTSDKSRSKWKSRFASSKKETRDLADTSSLSSATLETQKLEEID
FT                   LKNLCRRGKHSAGGKFAQNIKVNLSQDSTYSLFWSQSSIQIWDVSTCPPTFKDAITPDG
FT                   FFILAAVTGTHVAYMTGDRDRKQTLWIQSLERMTTRPVEYRVGPTPWCTSMTVSPSGSF
FT                   VAVGFDKSTVGLFAPSEWQQPRLYRVHARYHQDCKDCPPIATVSFSHDGLALVCSTRSE
FT                   RNGMIQVFLSHFPFSEFQEVLPCRYRVPPPESEDNGISSVLFQPGIGGKEDIICITTWT
FT                   QSGVPILVHPNGGHRTEIRVQSSASSNHKGKLGNRIQAAAFSPSGHELVLANDKGYVYR
FT                   VSNLSSIPIEVRRVATSKEFTTKTESFALAYVHQTDEDLILVSWSDSSKGVGYVRKIPI
FT                   MTTGEVQHLQESNIVNATVHPSQPELPEFQPPEEKVPEKRQILVKPPVELEASEMSPPP
FT                   IQRPSRMGLFGSLHGKK"
FT   CDS_pept        join(complement(75521..75724),complement(75354..75465),
FT                   complement(75078..75295),complement(74979..75023),
FT                   complement(74589..74931),complement(74474..74536),
FT                   complement(74219..74423),complement(73816..74167))
FT                   /codon_start=1
FT                   /gene_family="HOG000200355" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905466"
FT                   /orf_name="AFUA_4G00260"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84392.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054302"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51BFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W949"
FT                   /transl_table=1
FT                   /translation="MEPVKPTMETKASAVSSPTQTEHDTAADGKRPPPLLAKIFAVFLI
FT                   SCISFGSHWSSGVTGAMKSTIKKQLHVSNTQFSLLEASEDFMATVLLLISGVITDRVGG
FT                   AEMIIYGNVIYTIGSILVAAATTVRSFNFMIGGRVILALGDIATQIAQYKMFSSWFPPS
FT                   NGFASTLGFELAVGKIGGFVGKSTANVIAKKTGNFAWVFWTSVFMNLFTNAATVIFWFF
FT                   NRYCNVHYRGRQDTATKEVLTEKNKKFELQKMFQLPWMFWTVMAFSLFQTSTASVFSQN
FT                   ATELAERRFNVDSITAGWYSSLSQYAGFFLVPCLGVFIDVLGNRASVLCVCGIGMFLSM
FT                   VLVNFAETRSGTAASFGIYAIAVSLGPTSIIDSIRTTLWHQSVFGSAYALKVTMNNAMN
FT                   IIIRIITGALQDADDDSYRRVVRVYLFLAAASVVVGLAILLAALMTDSLAPLQWTRRQR
FT                   LTLGPEHIRMIRERHTVTCYARNKLISIYCFSALLLLTVGGWVAYIWGAVTGNNS"
FT   mobile_element  complement(76210..77751)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        79263..79988
FT                   /codon_start=1
FT                   /gene_family="HOG000200366" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210056"
FT                   /orf_name="AFUA_4G00280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84390.2"
FT                   /db_xref="HOGENOM:HBG054300"
FT                   /db_xref="UniParc:UPI0000F51BE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W951"
FT                   /transl_table=1
FT                   /translation="MSHATDLYPSIVCCAYKEPRYSHGSQELQYLFLNQSNRDHHPHTM
FT                   HTPTPLTICTVLTALASCITTSWAQDAPAIKDSTILRSTVSCPDCPERNCYKCTLGHEK
FT                   TLRASTGGRGWERFLIGFKLPAPVTDATKCTVQFPAFVRPNPFAVNVTVARALSSDWDE
FT                   DTVNGENAPESGDIFTSMSLEPYENMQAIDITAACKGAQANGEFSIYVGTQSDSVELWS
FT                   KDSDAPAILHVSGSVCKAS"
FT   CDS_pept        join(80552..80582,80807..80881,80951..81010,81057..81153,
FT                   81209..81963,82011..82132,82187..82270)
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273683"
FT                   /orf_name="AFUA_4G00290"
FT                   /product="Succinyl-CoA synthetase beta subunit, putative "
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /protein_id="EAL84389.2"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054299"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI0000F51BCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W952"
FT                   /transl_table=1
FT                   /translation="MVIPLDYVPEGRHSLQAASTAAEPPRASFPQTSRAVPRGYVVTNP
FT                   GDAEAVVSSIGAPSVLKSQILAGGRGKGKMSSDGKGGIRIVATPEQAFQNASRMLGHYL
FT                   ATQQTPPHGLLVKKLYIYKAVDVEQEFYLALTFDRERYSPVILISDQGGVNIESNQDKL
FT                   HRFWFNLSRGITGETMAGIQKQSCFTDKEMPTIESIIRQMIKLFEERDAILLELNPLVR
FT                   TPEGSFVCLDAKFEFDNAAQFRQPEVFSKEERMPGFEDEYEAQMHGLVYIRLNGHIGNI
FT                   VNGAGLAMATNDLINLHGGKCANFLDIGGKATTETLLKAFEILSRDQQVRGIFVNIFGG
FT                   IVRCDMIAESIIQAAHTLGGFRVPVVVRLQGTNCDAAMKRLSTSELDISTETDLEKAAK
FT                   RIIGLTWS"
FT   CDS_pept        join(83371..83453,83510..84354,84415..86991,87037..87284)
FT                   /codon_start=1
FT                   /gene_family="HOG000200377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210057"
FT                   /orf_name="AFUA_4G00320"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84386.2"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG054295"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0000F51C09"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W955"
FT                   /transl_table=1
FT                   /translation="MLEISEFCTSGRNPSPEIAMAQEREFYKYCQLPQRPGLLHRPPPS
FT                   PRCEINAELLPQSSQDTTLTALAQLGALRLNARRCMISLFDRHTQYILAESTRTLSLQD
FT                   DRVYVDGDGLWLGSSVIPKPDGICHYCCEEDQLNAGPTGPNGGYTALVIPDMTKDDRCS
FT                   KRQYVVNAPHLRFYAGVPIMSRRGIAIGAFAVSDGQPRAGLDPLEIRFMTDTAAAVMNH
FT                   LEMMRSHEQNRRGANMIAGLGSFVEGATLPSSSLRRPVHPHDDEEDQESENSQNIIPQT
FT                   RRHHPTLADGRPPLKERGQHGEAAALPSGSHERPESEKQPRVSSTPNHPRQPEITLASG
FT                   TRVIISRAARVLRDSLEVEGVVFFDASVNSYATLVRNSDGRHSDVESSSSTGDANSSSD
FT                   SDNPTTGHSSTETDDSAVCDVLGYSTAQDDSEKMTGPMRESFLRSLLRHYPRGAIFNID
FT                   ENGGVSSSEGSDTASASYVSREIVYRRDEGSKVQRRWKQRKQERLSLKEENKTLIKVFP
FT                   AARSVTMFPLWDSRRNRWFSGLFVWTAAPRVFSLTGELAYLYAFSNSIMAEIHRLDIEL
FT                   ANKAHATLVGSISHELRSPLHGILGSTELLTDSTMKPAQVALVNTIEHCGRSLLDIINN
FT                   MLDFAKINQFTRKSRSSRFKSTHALRRRPGLPAGIAFKDKPGLGVVNLISDVQLDAVLE
FT                   EVVDSVFAGHCFSAKGGLVARPASQAPARDRDGHLIMKGATERPLSAFNEALTIIYDVE
FT                   PGVQWLFETQAGSWRRILMNLFGNALKYTQSGYISVTLRCSSTPSNAKMKRLARGDGTR
FT                   EGMGSVTLTVRDTGQGIDKQYLQSNVFKPFSQEDPLSPGSGLGLSIVHQTVVSLGGKVD
FT                   ITSTKGIGTEVTVTLDLPRTPQAEVAENERDASIIRKAKDRVRGKSIGLIGFESSSAEE
FT                   DEALVLLRLSLLRMYKEHFGMEVGLVPSNVSDQQVYDIYLVRQSNLDEVDQICRQVTMA
FT                   ESDSRSPPMIVICSTPQMVQKLSTTASQRPSTSIYEFISQPCGPSKMANSLLTCLKRQR
FT                   ERPSCMSAGGLDTAFLNAACASKPRRHSENVSRVDFSLMPEKAIVSVTTTNVDDSAMEV
FT                   TTIEATKRVPSVLLVDDNDVNLKLLVAFMKKAKFPYYTASNGLEALEVYKANAGYIPVV
FT                   LMDISMPVMDGLEATREIRLFEKMHREGSTNAGHSCFKPTTVIVLSGLGSAPVRQEAFN
FT                   SGIDLFLSKPIRFQELVKQIDELMH"
FT   CDS_pept        join(complement(88689..89040),complement(87620..88653))
FT                   /codon_start=1
FT                   /gene_family="HOG000216784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273684"
FT                   /orf_name="AFUA_4G00330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84385.1"
FT                   /db_xref="HOGENOM:HBG054294"
FT                   /db_xref="HOGENOM:HBG324393"
FT                   /db_xref="UniParc:UPI000051F4D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W956"
FT                   /transl_table=1
FT                   /translation="MAQKVPNPTPGSNSTLLRRKPEGTHSQGITSHQVGIAWSWFLVTV
FT                   PIAALTAVFLVLVFHYRLYHGDPPFPNLRLPSAEDEKNVVYVDLSSSMILFTTSWASSV
FT                   APMLSSFVVALASSQATVYTYVDPDQTSYTYLGVPETASLLTQGFTAKTYGARTQCQLI
FT                   SSKCTLQNAASSVKFNCSADFTGLINTPTLQAAFFEDESMSKNLRGKVVSNCSTGNPDY
FT                   FALASVVNLSGGKTPNSTEFVKSLHGVPTYVLGCHTTIYDIEYDRLNNTVTRFQPAASN
FT                   TSVSNIWQTSISQTQDWFPFFQQAAGTAIFSDTAEEFAEKVALALSKATIALGADALGA
FT                   QPALAAQDRETLLVARIPVAPLVAMVAVCLLYVVCGLVLTGIAAWSARYEVRDVQARLS
FT                   IAGLVADRFEEPGLRSDANCVEEMFAEHAGQESKRIAIESVDGVGVYRYTTWPKPEGSA
FT                   SGW"
FT   mobile_element  complement(89815..91176)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        complement(92305..93351)
FT                   /codon_start=1
FT                   /gene_family="HOG000175373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753328"
FT                   /orf_name="AFUA_4G00340"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84384.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054292"
FT                   /db_xref="HOGENOM:HBG324390"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000051F257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W957"
FT                   /transl_table=1
FT                   /translation="METKGNPKDSMKSTWRTASRDTWSLGHWLIHILNAYPLELDKEVP
FT                   VHSKDEPIPFMPQWSLNLWVIFYSSLPLLFHQAYAWYTERNLGPLATFNLYMFAFNAIV
FT                   IYQVHILRRLGHIYGFLDGDKHERDGIPDVGVGKVVASVYKTTGSRLALSVYFSYQTSQ
FT                   LPAQMNWYWLPVEVGLYGIVLDFWFYWYHRLMHDVSFLWKYHRTHHLTKHPNPLLTAYA
FT                   DHEQEFGDMVGVPMMTYFTLRLLGLPMGFYEWWICHEYVVFAEVFGHSGLRLHLTVPSP
FT                   LSWLMQWLDAEIVIEDHDLHHRKGWRKSHNYGKQTRLWDRIFGTCHERIESAPENVDYV
FT                   NTARMPLF"
FT   CDS_pept        join(complement(94930..95754),complement(94739..94897))
FT                   /codon_start=1
FT                   /gene_family="HOG000200344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273685"
FT                   /orf_name="AFUA_4G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84383.1"
FT                   /db_xref="HOGENOM:HBG054281"
FT                   /db_xref="UniParc:UPI000051FC23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W958"
FT                   /transl_table=1
FT                   /translation="MLSEQTCSHSSIRSDSSPHAAKVGYEQRSLKQRTSAARLPGSPAP
FT                   SGSIDPTIFPAPLVLPGDDLALDPEYPPQSVLDWLDEEDRNEVTSDRKTVYVVAPPEYD
FT                   EDAYFAQAWTSPRVAKSQHHLIAPNPEDIVGYLAAFYHGMPVKLLRVSDFRFLPWDGQK
FT                   PTTSPRFIGLAVSDECIGIRTRACPDKLYPRQLNLDDLLDVAISILPQDAYALCLLVNH
FT                   DLYEDADDTFVCGRAYGGSRVAVVSSARYCPTLDEVQSVDREHSWPASHCDDYYQKAED
FT                   RQRIVILGYCTINRRGSRIVFPPKCRCITTVTIITLAFSTMPHCKP"
FT   CDS_pept        join(96220..96643,96694..97313)
FT                   /codon_start=1
FT                   /gene_family="HOG000216783" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210058"
FT                   /orf_name="AFUA_4G00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84382.1"
FT                   /db_xref="HOGENOM:HBG054270"
FT                   /db_xref="UniParc:UPI000051FC29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W959"
FT                   /transl_table=1
FT                   /translation="MVQQREEPPQQLSPRLQARLDEQFEIRDRFIRQEFARVHERIDDL
FT                   IKDNEARDKGIKREFRNVYERMDQMSQKMDQMSQKIDKLETSFTVFETTFANFKVAHLN
FT                   QRIQAIPVYDSFHQPVPVPKCFPKTALRLYRLQDRKNWNHLKTLLKHYNLERAAIQLVD
FT                   RGELYDSSDSDSDSDTSSRFHSIDRELDRAIESNPFAAMCSLGRHLGVDTDALHDRIMQ
FT                   LEFQQKKGTVAKRPAEDAGSVRKMIRELVTGALQPGSFTRAEPLLDDDSEGKYTKLEWE
FT                   VDSEKFKRETAHLRLRDTEVSPRPASAKDSPGNRQQRDLEVRSRQSKGSRSPTEKMTTS
FT                   SNQSQGH"
FT   CDS_pept        join(98501..99910,99955..100039,100090..100205)
FT                   /codon_start=1
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753329"
FT                   /orf_name="AFUA_4G00370"
FT                   /product="General amidase, putative "
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL84381.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG054259"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000051E698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W960"
FT                   /transl_table=1
FT                   /translation="MTIVDWQEKAQLKQSEAASKIPPEWRLSLDILTAISNESNVLDIP
FT                   TKCGILSARELDITEHYDATDLLQRLASKELSAVEVTTAFCKRAAIAQQLTFCLTETFF
FT                   DQALARARQLDDHLTATGQTVGPLHGLPISLKDCFNVAGVPTSLGFVSYLDRPAPTTNS
FT                   SLVDILLAAGAVLYVKTNVPQTMMTADSHNNVFGRVLNPYRRNLTAGGSSGGEGALIAL
FT                   RGSVLGIGTDIAGSIRIPALCCGTTGFKPSVRRVPYGGQTAAGRAGMVGITAVAGPLCR
FT                   SLRDAELLLRTVFDSKPEDLDDGVVGFPWCDAPAKDVLTVGVMAEDPNYPIHPPMQRTL
FT                   ALAAKKLAAAGHRIVDLTGRLPSISDACELSFRYFNMDPDQTALKKISDSGEPPIPSLR
FT                   ATYNVNEPGPEPTLQELYDMNVTRDEVMEKVRKTFLENQLDVIIGPAFQSCAVPHDEYG
FT                   KPPYTVFWNLLEYPSCVLPFGKAEEAADAEFVRDVQYIPAYKPKEVEGAPCHVQIIGRK
FT                   LKDEALMQHAKVIESILLK"
FT   CDS_pept        join(100950..101245,101311..101428)
FT                   /codon_start=1
FT                   /gene_family="HOG000048688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273686"
FT                   /orf_name="AFUA_4G00380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84380.1"
FT                   /db_xref="HOGENOM:HBG054248"
FT                   /db_xref="UniParc:UPI000051ED63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W961"
FT                   /transl_table=1
FT                   /translation="MLIDSSQPQRPPRQSRPRNVPTTRAHPVRTFSALCSYNNKHAPSN
FT                   TKAETQTFAVFVTDHQYDSSHGAPYGTCKAYTCTAPTDSQMTDVNEDCWTFFWNDNGES
FT                   SGVGTGCIKSPDDGTCGCENSDGTFVYGGTNCS"
FT   CDS_pept        join(complement(103103..104359),complement(101658..103052))
FT                   /codon_start=1
FT                   /gene_family="HOG000200333" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905467"
FT                   /orf_name="AFUA_4G00390"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84379.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG054237"
FT                   /db_xref="HOGENOM:HBG324352"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051FC26"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W962"
FT                   /transl_table=1
FT                   /translation="MDWIILLYGLYVAAFGVTVVDGIGETAGDTTTLSQWRLQSSLAVS
FT                   NVSAWSLPGNDDSSWYQVGARATVMAGLLENGVYDDTTLFYSNNMETKTGDAAKFDAPW
FT                   LYRHELLIKNKIRQGEHYLLHTHGITSKADIYVNGVLVAPSSVQQGSYGGHTYDITKYL
FT                   RVDANALLIQAYPTNYLRDFAQGFVDWNPYPADNGTGLWRDVMISKTGPVSISSPRVLT
FT                   DFRKPDGKPVTVNVLVDVTNHEDETVTGTVQGSIQSDTESLVLSQRFSLQPHETKTIPM
FT                   TVRIEKPKVWWPAQWGSQPLYTVNVNATVGKDQVSDVALPRRFGIRHVDSHVNSHNDTA
FT                   FTVNGSPFLVLGGGYSPDLFLRFDATRVRNIFQYMLDMGLNTVRLEGKQEHPELYDLAD
FT                   EMGLMVIAGWECCDKWEGWDYNDEASGEKWTEKDYPIANASMLHEAAMMQTHPSMLAFL
FT                   IGSDFWPNDRATKIYLDALHRMDWPVPIIASASKRGYPKVLGPSGMKMDGPYDWVPPNY
FT                   FYGDQLGAAFGFGSEEGAGVGTPELTSLRKFLSPKDLDSLWKNPDQNQYHMSRYDSSFY
FT                   NRALYNKALFARYGAPGSLEDYLLKVQMMDYEATRAEFEAFSVRQNASRPATGVIYWML
FT                   NSAWPNLHWQLFDYYLSPAGAYFGTKIGGRMEHVAYDYEERAVYLINRSLEKKGPRIVS
FT                   VDLVDRHGKSLFNQEVTIDTTPTASKRVIPVKAVTQIKDVAFLRLVLKNPSTGAILSRN
FT                   VYWLSAKNDVLDWENSDWYYTPVTKYVDYKALISMPTAAVTASLKRLPAKDGLSQVQVV
FT                   LKNPSATPAVFMHLSAINKDTQEEITPVFWSDNYVTVFKGESVTLTAAFPGGRSNWEVI
FT                   LSGANVKRTLLS"
FT   CDS_pept        105146..105832
FT                   /codon_start=1
FT                   /gene_family="HOG000216781" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905468"
FT                   /orf_name="AFUA_4G00400"
FT                   /product="O-methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL84378.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG054226"
FT                   /db_xref="HOGENOM:HBG497212"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051E8DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W963"
FT                   /transl_table=1
FT                   /translation="MASSSPTLKENIRKAYDNVAVKYAEWTKSSYPTRVQYLQKLLACL
FT                   PPAPVEKSVLELGCGSGQPCTAILASDPAMKVTANDISPVQLALAKEHLPSANVALIEG
FT                   DMMELSFGDHSFDAVIAMYSILHLPKEEQVTLLKRIYKWLKPGALFLGSFAAGLKEEDL
FT                   FDKHWLDGTDGEMFWSGWGEERTCEIVSLIGYELILREVVAEIEEEKGEGREIPFLWVL
FT                   GKKPDN"
FT   CDS_pept        complement(106193..107482)
FT                   /codon_start=1
FT                   /gene_family="HOG000216780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210059"
FT                   /orf_name="AFUA_4G00410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84377.1"
FT                   /db_xref="HOGENOM:HBG054215"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniParc:UPI000051E42F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W964"
FT                   /transl_table=1
FT                   /translation="MPIDGQNGGTSPESRDTGRPVEGTPAASVRPMPIWELETNIKEVI
FT                   LKTATNDEKGYAYLFADQSDEAGYFKVGKSATPLKRGKRHQSQCGHRTFTVIDGVPRGM
FT                   SVPWHGRLESLALAELANMNYSYKCICGTRHREYCTGSWTEALEILNCWSRWLQLSPYD
FT                   ENAQLLPFWRDRLRLLGGERFSHPRCPRAECRDSDIGFSSCQKCLRLRLKAWTDVTDLD
FT                   YFEYECRMRIGWGFHRQVMFLMWPLLGNSALTLIDGCEGLKRLASFLWAPMTHLHLLLL
FT                   LVLSLLLSSNASRASVLSYVISCIFAYCRIRSGLSYTPKAHTIPQPPHKKATRTVSKSP
FT                   ALRIPPEAASEKEMPDTEEPPSEKRPVSRHRAHDISNTPRGQSAPGSPEMSDISEYNRP
FT                   NPFLTPDRATRTVGKNSPKAGAKRRKSDVR"
FT   CDS_pept        110164..111201
FT                   /codon_start=1
FT                   /gene_family="HOG000216779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905469"
FT                   /orf_name="AFUA_4G00420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84376.1"
FT                   /db_xref="HOGENOM:HBG054204"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F9B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W965"
FT                   /transl_table=1
FT                   /translation="MEQMHMSKIHQESKQVHIHCAVNDQRNIRNALHLAMISPREEEHV
FT                   ELARLLVEKGQVDPMGSVRQTGVVHSYAGPVEAFRYLIHQDEFLVDPEERNRSGRTILH
FT                   HQIFHRLYYGESFERIQVLFAAGHHLSGGHIDGDPIYDGYSALHCAAHVWATAKLREGE
FT                   HTARQSELVLRRLLTTGEGIHRISSRGYTALTTIGEMIHFCNRSPALNQEIIAAWLNLL
FT                   SEAGHDVEAYCLTECTLERKRQETSRSAFPRFLIVFEKIEGVQRLNSMRISISSLEQVI
FT                   EVEDEDEEAPKIESTRALSSHVVPSFRERRTDAMFPNRSVSLGLRKQIFAFVMFILFIL
FT                   LLRQT"
FT   CDS_pept        join(complement(113371..113570),complement(112459..113179),
FT                   complement(111425..112411))
FT                   /codon_start=1
FT                   /gene_family="HOG000159116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273687"
FT                   /orf_name="AFUA_4G00430"
FT                   /product="Isoamyl alcohol oxidase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL84375.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG054193"
FT                   /db_xref="HOGENOM:HBG324318"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000052079C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W966"
FT                   /transl_table=1
FT                   /translation="MTHYVSLIHQTLCDSAVEYERTDGDADQPASDAFQLNDRSDRLLC
FT                   LVLYFLVDLLNVSEYEGQAVRISNSSCRCRPHEPCWPSPQEWNALNSSVDGNLFAVRPV
FT                   AAPCHEGDSEACDLVTKQWYNSTWRAAQPGAVQWENWDSWLEHNQTCSIINPQGPCGQG
FT                   RVSLYSVVAEKASHIQEAVRFAKRHNLRLAIKNSGHDFLGRSTAPQSLQILTNGMKDIH
FT                   FSDNFRPSGAPSNISEGSAITIGAGVSLQELYPAAGKKGKTVVAGLSHTVGAAGGYIQG
FT                   GGHSFLGPWKGMSTDNVLEYTVVAATGHLVIANNYRNTDLFWALRGGGGGTFGVVVAVT
FT                   LRTFDEVPVVFGNLNVSTMAGDPNFWQVMTDFHAALPAINDHAGGYYWMTPNMPVDKTL
FT                   NVSSLSIILMAANQSSTAMMDRLFAPFRSKLNETSGVFTEYESLAFPDIHTLLSDLLLP
FT                   AREDQTGHNTILGSRLFSHDLLVSSDGPKKLVSALQKIKFDPGQGITGHIVAGGLVTKN
FT                   GRTIDSALNPAWRKAATHIDFGRAWPPSATLAQRDAIIRRLTDVEMPILKAVEGKKMGS
FT                   YMNEANAYEPDFQTEFWGSNYPRLYRIKQKWDPSGLFIARKGVGSEDWDDAGLCRVHRK
FT                   "
FT   CDS_pept        complement(114408..115232)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058738"
FT                   /orf_name="AFUA_4G00440"
FT                   /product="Short chain dehydrogenase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84374.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054182"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F74E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W967"
FT                   /transl_table=1
FT                   /translation="MPINHLTSATRHLPNMVRVLITGSADGLGLEAARQLANRGHTVYL
FT                   HARNEKRAADAKAACPGAAGVLIADLSNLAETRRLADEANAIGQFDAVILNAGMLYGPF
FT                   RKTPDTGIPAMVFVNVVAPYILTCLLRRPKRLVFISSQLHRQGDASVEDIFWFKRGEGR
FT                   FQDFPAYCDSKLHVLLLANAVARRYKDTSVVSVHPGWIATKLGGEGAPDKLEDGVDTYV
FT                   MLAEGDYDQNLTGKYFEPKRVLGRPLPASEDINLQEKVVKACEEVTGLKLPA"
FT   CDS_pept        join(116378..116511,117018..117675)
FT                   /codon_start=1
FT                   /gene_family="HOG000048689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273688"
FT                   /orf_name="AFUA_4G00450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84373.1"
FT                   /db_xref="HOGENOM:HBG054171"
FT                   /db_xref="UniParc:UPI000051F4D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W968"
FT                   /transl_table=1
FT                   /translation="MASFNPNIPVRGNPFLDIPSDIDAHPFRLVWEDICSVSYLARLLP
FT                   KGVILDLVECLIQRDLEYKTADIRQGRAQLRAALAASTTKKAVLIVHSQGGIVASSIID
FT                   WLYGELSQSQIQKLEIYTFGNAARQFRNPPLHELHHNDPAGTTPRRQIQGERAIRNIEH
FT                   YANTKDFVANIGALQFTASAGAYSNASVFSGTVFIREGSGHLFNMHYLHPMFGEHSAFM
FT                   ESTVDVRPRNGPGKTVSMRMRELSRLYNYKNGRSPEDEDAM"
FT   CDS_pept        join(complement(119040..119894),complement(118224..118955))
FT                   /codon_start=1
FT                   /gene_family="HOG000216778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273689"
FT                   /orf_name="AFUA_4G00460"
FT                   /product="Chlorohydrolase family protein, putative "
FT                   /EC_number="3.8.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="EAL84372.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054160"
FT                   /db_xref="HOGENOM:HBG324149"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000051EB2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W969"
FT                   /transl_table=1
FT                   /translation="MSTEMLLTKMSTKILLCLQLFLYAGICLAKASILFQDAAAVISFD
FT                   KTSETLRVIRNASVLVTGDTIAAIMPASEHLQRPANTTVIPSDGKIITPGFVDTHRHAW
FT                   QTAFKTLGSNTSLAEYFARYSEFSPAKKIFTPEDVYIGQLTGLYESLNSGVTSILDHAH
FT                   HTWSSETALAGLRASVDSGARTWWCYAFHNLSDATWASNYTREDQIADFLRIAEHGPWR
FT                   KSDTVSLGIAYDNFALEDAAEIEQITSLALYEASSIEIRRADFISGRKTFLHSQYTTLA
FT                   VLGVYNFLNTSIPIVFSHASYLTVKDAELLRSTNQYISITGESERHYGHDHPSSPYIMD
FT                   QSSLGIDTHFTYSADIVGQARMWLQEVRLRLYAQVLDCWDIPPNNPMSVEQAFLLATRA
FT                   GGLALRRPDIGVLVEGAKADLVVFDGTSPNMLGWVDPVAAVILHSNPGDVEHVLVNGEF
FT                   RKRDFKLVVPGNLAEIQQRFLASARRIQEVWKQMPLPVLEGSFPNTPGVNYSKAVTADV
FT                   VRGWQNGYLSS"
FT   CDS_pept        join(121082..121236,121288..121396)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273690"
FT                   /orf_name="AFUA_4G00470"
FT                   /product="MFS multidrug transporter, putative "
FT                   /protein_id="EAL84371.1"
FT                   /db_xref="HOGENOM:HBG054149"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W970"
FT                   /transl_table=1
FT                   /translation="MIIARFFNGLSGSAFLSVAGGTVGDLFHRQELAALMRVYTASPFI
FT                   GPEIGPLVGGFINTYTTRYPAHNSGRLSPVTDFVGAGHFTFS"
FT   CDS_pept        join(121634..121922,122045..122097)
FT                   /codon_start=1
FT                   /gene_family="HOG000048690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273691"
FT                   /orf_name="AFUA_4G00480"
FT                   /product="MFS multidrug transporter, putative "
FT                   /protein_id="EAL84370.1"
FT                   /db_xref="HOGENOM:HBG054138"
FT                   /db_xref="UniParc:UPI000051F74D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W971"
FT                   /transl_table=1
FT                   /translation="MQLLAFEPMCMNLCVFSAILLGILYLFFGAFELVFSHVYGFNLWQ
FT                   IGSSFLGILVGMMSAILTDPLWRRNYARLERKHQDTVGEKNEFRPEWRLPPGPLGGAHY
FT                   WKRGVRSRV"
FT   CDS_pept        join(complement(127632..127848),complement(126741..127500),
FT                   complement(126278..126694),complement(125315..126230))
FT                   /codon_start=1
FT                   /gene_family="HOG000200311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753330"
FT                   /orf_name="AFUA_4G00490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84369.1"
FT                   /db_xref="HOGENOM:HBG054127"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000051FC28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W972"
FT                   /transl_table=1
FT                   /translation="MRFSWQRSAGISALLVGCSLAQGWNVNVSMCNWDQVRGILRPSCP
FT                   SAAKAYMSQLVRFATLFTLTEGHCGGSGNSDGLLYYLNLNTSFDTAISNLTALFGNISK
FT                   AGGIANNIAPTYRDGAMFTNDNELYLYGYFDSLFTNSRLTICSGLLRLTDSQDPPAGNT
FT                   VLGYERYQYGPDRESWQPGFIIDNLDTGVTRYVTNGAGVSAPNENLGFYFSGMRGKDWG
FT                   PIYADDKSANVTSDRMIKVDMSSMRHNKWSNLSLPAHVPARANGELVWVPVAESGVLVA
FT                   IGGVINPATIFSSDGLTSAQQNASKRVSPGLMETVSVYDVSGDKWYLQNTTGDIPPQLT
FT                   QFCSIHASAQDGSSHNIYIYGGYDGLSMENTPSDDVYVLSLPSFSWIKLYSGNTTHGRS
FT                   GHRCVKPYPDQMLVLGGVHLDPTHCLDGGVIQVFNLNTGRFQNTYNPNVWNEYKVPDLI
FT                   TTVIGGDSEGGATKASPISWTNASLADVFKTKYTNTISTWYPYNSTSSISPTIAPAADK
FT                   GSSFPKWASAIIGVILGFLFISAAAIFWFLRRRHKLRESQSTGDRSTRSWILRWLHTSG
FT                   SATGVPKSGDTTAPTGYSVFTNESTITPATAVSPQSVEAGSDPVYEMLGQFFNLLFLYP
FT                   ANHCEGHATTLPVELPTPYNNNSLPSPVSPPGVSGTDYVSPITVSTPSTEDEASPVRPP
FT                   HYRHMSSLSSVPTIANVMRKESRHRQTYRSDTSEGSVELECPRGVELSGSTPQEGRLAT
FT                   TREVDELEGLGIKALP"
FT   CDS_pept        join(129266..129397,129444..131133,131190..132478)
FT                   /codon_start=1
FT                   /gene_family="HOG000216777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905470"
FT                   /orf_name="AFUA_4G00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84368.2"
FT                   /db_xref="HOGENOM:HBG054116"
FT                   /db_xref="UniParc:UPI0000F51C16"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W973"
FT                   /transl_table=1
FT                   /translation="MQFSRAICLVCIAAYSPVLSAVLAEDVTVTETVLETVTVSEPWEA
FT                   ATSLPTSATAYSAVAETSTSPAELRLDTPTVLLPTSSSAYWLIPGPSPILGAETSTSTT
FT                   ITPPAYTLRKRANPPKSPAIIARAPATITVTSTSTVTTCPVCTNTPTTTSTNTPTITPP
FT                   ETTPTTSTITSTPVTTPTVGPGSTVTTTVTVTTTAPGPTETDTVTTTVGLPGTTETDTL
FT                   TSTVTIPGTTGTDTVTTTIDLPGATVTATQSSTSTITITATTTQSGTTCAATPGDGITQ
FT                   TTTVTVSSEGATTMTLTQTVTLPATTVSNAATLTEATSVAMSGFTLTVPGSTVTETTTS
FT                   TKITTQTVTVSGSTVTGITTVTRTSTSTVTSPGSTVTGTTTLTKISTSTLTSLGVTVTD
FT                   TMPVTEGSIQTISQILTMTAIKTEVLPGTTVVDSKTITLPGTTIVNSKAVTLTVPGTTV
FT                   TTMRTITKSGTTMTISEVVTLPGSTVTTIETVPTTLSGSIIVTTTTKPGQTITMSGSVT
FT                   TLPGSTIIQSSTLPSVTTTDLQVIPTTLPGAMILTTVMRPASTMIVSGTITTLPGSTIV
FT                   QSATLPGLRLVETVSVTVIQSTTIFDTVTLTGFDKTITTTEPAASTAQSGNTVTVPTTT
FT                   TTLFICPTLSINPTYTPVAPLPRNYTWGCPPGYLCKTKHTGADAGCNIEASMPAESYVC
FT                   SPDECIKSPPFIHDQYWGTPVESNEIRSSYNISKDYFNLDPEIFGLNYSIFRIPDLKPG
FT                   DDHYYIRSSRRTWSKLLARQSIGVSTVPGACYDECNDAALEVESTGKTPDICNAGSAFN
FT                   VSLGQCEKCCNTHKTATSASFEQKVLPNFQQFLNFCEGLEDSATTAAADTVGSTTKGSQ
FT                   TSTTPGTTSTQEGGTMSQADPLTASSTSNFTGKATKSRDKSSTAASATSIEQTIIPSPT
FT                   QQTTAPHPMTESKPVTASEISTDTISSSSSCSATGTSSRETAQSSSASENTGNSAATST
FT                   SHRPTSTHSGASPSAPALLFTGAASLQTVPSHWGILAFIFGVVGFHI"
FT   CDS_pept        join(complement(134458..135102),complement(133477..134406))
FT                   /codon_start=1
FT                   /gene_family="HOG000048673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210060"
FT                   /orf_name="AFUA_4G00510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84367.1"
FT                   /db_xref="HOGENOM:HBG054105"
FT                   /db_xref="HOGENOM:HBG324265"
FT                   /db_xref="UniParc:UPI000051E8D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W974"
FT                   /transl_table=1
FT                   /translation="MSASAKGRGEKSFRSSLSALESAAKDVLSFTKNITTVDDLQRQKS
FT                   DLQCQLDDAGVKIRELQESLNYEKRRNDDNFLKVEQLASGWAKKKTSLEARVREVADSS
FT                   QSATKKKMEDLEQRTKGAEEDMLQCQRRLDEQIMKNRKLQTMLEESDFRLKTLNHDIAV
FT                   GEVDLDEYGNQSIICELIFLLSGSLRKGFQSMEKRLKALSAKFFKSSTSTEPSRARENT
FT                   EHIQTSNYSPRSQSIIPFPFANITCPREVLAQSIIANRLSTDILTPVCLPSPMGRMGIG
FT                   EALERSSGIRPRQKAILRSLLVTAFESEEVRLRNELLITAVSDISHELQSLLQSREMQT
FT                   FKQELQEFFVFAANVWKPVQRSQRWIRATSDLRSCPPHHWRDSERRTTSDFPLSSGSPS
FT                   LVLFPHIFDVDEEEPLYHGLVWCVKSNFKDTAEKPSCIPPRLQGAEEHAWNETSTGTGP
FT                   VIQVDSTQMKGSSEQLDAGRNYLERTGEGSISSNGEGATLKTHKCRANGRETRRSVALK
FT                   SVPTGGL"
FT   CDS_pept        join(137768..138415,138468..138890)
FT                   /codon_start=1
FT                   /gene_family="HOG000048691" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273692"
FT                   /orf_name="AFUA_4G00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84366.1"
FT                   /db_xref="HOGENOM:HBG054093"
FT                   /db_xref="UniParc:UPI000051ED62"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W975"
FT                   /transl_table=1
FT                   /translation="MASLGSLTRSISTLVLQFNEYSSSVSSQPSEAAFLATVMPEYSQQ
FT                   HRIPLRVLVSPTNFHNLKRMYSQIPNVEVQAFRIQPRHLNISMMLLLMSVSQNDSMPLY
FT                   MAQVTRVLREMAMESGGCFDYLDFRERLSALRLDRVQTPFLHQRLDLLDSYLDLTGQAT
FT                   SDYFVDGGVTILDLSCPFVDQNTACILFRIAIDLFLSAHPSRGKMIVADEAHKYMTESP
FT                   SAKELVQTFLSIIRQQRHCGVRTVICTQEPTVSPKLIELSSIIVIHRFTSPEWYKVIQK
FT                   HVPMDTREVGSSEDGVPSGLCQIASLRTGEAIIFAPSAHLIGEKDMVLDTRHRTFRMLI
FT                   RKRVTWDGGRTVICIR"
FT   CDS_pept        join(complement(148505..148802),complement(139243..148454))
FT                   /codon_start=1
FT                   /gene_family="HOG000217133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273693"
FT                   /orf_name="AFUA_4G00530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84365.1"
FT                   /db_xref="HOGENOM:HBG054082"
FT                   /db_xref="HOGENOM:HBG324255"
FT                   /db_xref="InterPro:IPR022099"
FT                   /db_xref="InterPro:IPR022105"
FT                   /db_xref="UniParc:UPI000051EB28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W976"
FT                   /transl_table=1
FT                   /translation="MPFMSSQKMCLEANVYLVHHVFLPPKLPQEDDYDPEYELVLLEKC
FT                   IEALEQFKGYVSGPEADSIAAAALMITRLAQIFGPHGDVDEKKFRNALAQLYTEGGILP
FT                   VYVKCQNAAVLMTRDDDAIRIETFELSARNEAVMTTIGRLKRQFPGPTLSMDLETFNES
FT                   GLQTTIAQTFAKLSHQPVAGTHAKVKKAGQMHDEDRDTTHPRMVTEFVTAFLRPLCTSV
FT                   VCSQMEKNTREEVMWLDSRSPWRRSSLWLLIRVALQLVLHRRAVREETADDLYKQFMVY
FT                   FMSRIVSASPSTICSEHLHTMISKISRRLVKLGTPDNRGWIAHVREALKSAIKILEKRW
FT                   HKIIARNGCHGHTQHVATLDFGSDIYYTLPELDNYLAEIDQRRIVQAVNDFLPQSILVE
FT                   CPSTDLPLHLDFTDPEYKAYNLAAFEHWVACSLETWLETHISDEGTCNRVGTLLKNYYE
FT                   IAITPYASNPEALSVMLLTVLELWIACDKSATRIHQILWDYDACIPVELFESLLLPFRS
FT                   QMARLDRAESYLRLRKQRTIHFGPGVFQDYGTPACFAVRYFDQSETHQRLLSEIEESAW
FT                   QEREDKKAELRRKRQQCADLYALCDTMDCTYEEVIVDRRFNFRETRHSGSCQRCAYQRQ
FT                   ADSMKVSVHEWPLPSNRLQAKSTVFELNVPRPFGCWRDITMFFLVDVLHIQYISRDEPR
FT                   AEHTLQNYGGLSPFYTAVQGVGRVGLLSQNKPHERTHRLKKKIINVTEDDVCVNNGLLL
FT                   RYFDFSMRTFVGGFKMSDEIANLCMYKLPKRSTDLQQFLFRPLGNPDGPSPNTVIASQD
FT                   CCPVGMSLEEYRSLCTMPLGVEIQWQNILRQLAMPSIDLKKAETCIFILQIINQAGPST
FT                   ASRVTRTAHDILNDTAFTTALLGRVYDIAARLEENWEMAQGLSALSALVLRILALSPSA
FT                   DVREICLTTLQHLRKVAFAWVKIVTEKASSTTDDRRRSDLLMRSGQLALICATTFDAED
FT                   IVLVRMLENPSDTAVLLQCCMLINDTRRFLCEGSGSSPLIPILFRRWQVLCYRCLPVLR
FT                   QNILQRADSSLDIAIGQIWVTYRAGSSWKASPEAPICWLVTSLPSQSEHGVDLPVHYNL
FT                   LTGDLLVNGLPLARLPSEYERHDTYRTLFGQSSLEVMPSVIPGMDFTCRKKYMGHTVSF
FT                   SRRKVTGCEDFDLCIQATEAGCTWEFIPPRLLMGSFPDAFLTGCVHWYNVHNDYVEFRP
FT                   IDKPWISSTSNWRLRKTSAHDPWRLAKDTLFLVSVKSRTAEVIAAILQPIEKPSQLHCT
FT                   FDSTTSSLGIELPRLRLRFTLQRRSSAIRSREYQGMFIDPDQSLDALVGLRNRLILRHE
FT                   SGGDRVVLIPEGRVTWFKDHGHIAVEIGWQARSTLHPYTVDDQLGRLTDNGSLHSRSLL
FT                   CYLHALTSYCLPDPLTGRTGTEQALTILRSASMRSFDRLHPKASIILAKIAELTPERHY
FT                   YPSNERVMQTVRWDKHLGFLAQHDSFYREVTAIFDHDNRMKMFHPNEQVNQPPLPHIVP
FT                   DLLRRNEIRSSSFRVAGFGAEAHTVEYDRPYKGLDQNRHSARFYRAYRLCKILYEGIPS
FT                   ALETSHVDLLSELWQFLSQTHVVHAASSPVDSSRIQYDAGWILEPMTFVASHWCSLHQL
FT                   LCSRDTGMSKFQVMVWLATLAFSESSNMVVLEVLASLYVIPEMANPTPASRGQFQLWHG
FT                   YEVNEAMLGSRIHQSAALSHTPESNLHPRHNENMRVFRSRKKRIAKMNRTLALQTFIRG
FT                   LKARWPIRSPATPPEEAGPRFGDYYATPEAMTQAGQLFQIWFDNLEFREYLSDLSSLFV
FT                   SQTVHHVQMPPVCLPGEVKQTTTRRGYICIDDLLGFEPMLDMERPRLSSLLSSHPECED
FT                   PAPRLMALVDSLERQSKSQYERRYVEHLRGSIGSLQQKKRRDYITMNSSQLEAALLDYL
FT                   HHCETYCERLYDAMRMRLTHFDGTLDSTQNSLPLETLAGIGNWPRISPYLLVEQLTHQR
FT                   WYLLPERWKASIVEYGCAITALQRARRLTTLVRSPDDLIRELQNPGHTNWDPYQYPESL
FT                   LLEIENSMLIREVQEQIARRMRDISPGTNAVMQLNMGEGKSSVIVPMVVAHLADGSRLV
FT                   RVVVAKPQSRQMLQMLVSKLGGLLGRPVYLLPVSRSLRLTVADTDAIFHLCQKCMEEGG
FT                   VLLVQPEHLLSLKLMCLESFVTGRGAVGGSLLQTLEFFTQYAQDVVDESDENFSAKFEL
FT                   IYTMGTQRQLELTPQRWVIVQELLNIMRMIAPSVKKDYPRSLEVEECSVGGFPRIRLLQ
FT                   KDAELELLQRVATHICEHGIDSLPISRQSKTARQAVRAYILKQELSSEEISSVEDTGPA
FT                   GFWTETTKNPLLLLRGLFAGGILSFCFGQKRWRVNYGPDHSRNPPTRLSVPYRAKDCPA
FT                   PRSEFSHPDVVNLLTCLNYYYAGLSDEELFLALDHLVKSDQAEIEYQAWVVDCPSLPDT
FT                   YRQLGGVNLEDRQHCVKQIFPWFRSAKGAIDYFLAHVVFPRELREFPDKLSASGWDIGE
FT                   LRTQPTVGFSGTNDSRQTLPLSVEQLDLPEQNHTNALVLDYLLRPENSVALSPARPQAS
FT                   TLDAKGLLDMVMGLEPPVQVILDVGAQILELSSLEVAEYWLNLIPDNTQTQAVIFVNEN
FT                   DEICVLDRNRRVELLQVSPFGKQLGACLVFLDEAHTRGIDLKLPATYRAAVTLGAGITK
FT                   DKLVQGKTAGNRGMNRNAKLTAHSACMRMRKLGKGQSVVFCIPDEIRFKILALPHKCSR
FT                   SDIDVADVLCWAVSETWVDIRRSMPLWAAQGKRYIQQCRLWEAASQDGKVQLSFSRASE
FT                   FLEPESQSLDDRYRPRRGEATVLHHQSDESTPMCLISERCRDFDGLSFGTAQLQEEQER
FT                   ELAPEIEQERQIERPPPAEPKQHCLHADLLTFVSTGILKEHSSAVRPAFEALRNTSAAR
FT                   YLDVSQFPPGLRVTTDFATTIQFREGSSSLSDAYQRPVQWVLTHSIYDSTSGKRNASHV
FT                   IIISPYEAMHLLPEVRRSTGATIHLYAPRQHLSFVPLDRLDLYNIPSRADPIDIPDDLK
FT                   IQLNLFAGQLYIASYDEYLRLCDTLGVASAATPDNLSVAADGFILRGNVTGKSTFSQSP
FT                   LKFLQVLLSQIRKDGQDISKTHIGKLLDGRLLEARNFDSAIEELTLARLSIRSHPE"
FT   CDS_pept        150004..152097
FT                   /codon_start=1
FT                   /gene_family="HOG000180546" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20753331"
FT                   /orf_name="AFUA_4G00540"
FT                   /product="Dynamin GTPase, putative "
FT                   /EC_number="3.6.5.5"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="EAL84364.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG054071"
FT                   /db_xref="HOGENOM:HBG324248"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000051FE63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W977"
FT                   /transl_table=1
FT                   /translation="MLGCIVESCHTWACILVWGTSGLLASAAVCTHLSVRTSYKESLPC
FT                   HEKEPKSVVWSSQLLFLPVSRRFIIMVLRKLSSPSLEALCSKEQIELLDSIDHLRLQGI
FT                   NHYISLPQIIVCGDQSSGKSSVLEAISGVSFPIRSSLCTRFPTELVLRKSSQVGVCVSI
FT                   VPHRSRSESEREALAQFHEELDSFEGLPQLIENAKSAMGIYTNAKSFSNDLLRVEVSGP
FT                   DRPHLTIVDLPGLIHSETKQQSAADVELVHDVVKSYMEEPRSIILAVVSAKNDVPNQIV
FT                   LKLARAADPHGTRTLGVITKPDTLVRGSDSEAQFVSLAKNQEVEFRLGWHALKNMDTDK
FT                   GAWTLAERDKEEHAFFASGVWEALPRSHVGIDQLRKRLSKLLLAQIATELPSLMQEIKA
FT                   KLEDCSQKLEKLGEPRTTEEEQRSYLFHCSQSFQNLVKSAVEGTYSDPFFENAKSETGY
FT                   KRRLRAVVQNLNEQFTSRMKRRGHYYEIDDEDDENGESLGGQVFISREHYIRHVENLLR
FT                   RTRGKELPGTFNSTIVNDLFLEQSKPWEKLTSEHVREVWEAAKAFVKIAVTEVTDMSTS
FT                   SAILMEVFDPSLDNILKSLEHKTGEMFRAYREGHPITYNHSFTDSLQQTRQDILMPRLS
FT                   YAIRRFFQVPQLTSSQCLDDTFDLLHLRDSLMESLKADTARFAALQALDCMRAYYEVRR
FT                   LAW"
FT   CDS_pept        join(complement(155368..155878),complement(155121..155216),
FT                   complement(154878..155034),complement(154566..154827),
FT                   complement(154282..154521),complement(153978..154166))
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058739"
FT                   /orf_name="AFUA_4G00550"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84363.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054061"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000052009B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W978"
FT                   /transl_table=1
FT                   /translation="MQHGQSPNQEHEQEMTQEDHITPVQNPRNDPIKEKAAQFLATVNE
FT                   DRTFTVEEEKAVLRRIDRRILPLLLGAYFFQQLDKSSLSYVSIFGIVEDANLHGQQYSW
FT                   LGSILYLAQLVMQPIAALLLVKLPTGKLIGSAVLLWGSSLAIMAACTNFPSLLGLRFTL
FT                   GAFEAMIACSPTDSAISIATAYSHTRYRPSSLVERQKLMTKCLSDREKVIAVERLRANQ
FT                   MGIISREWRWDHVRETFYDLKTWCWFFLIVSISIPSGGISTFGNLIIKSFGYNSFETIL
FT                   FNIPFGVIQILAIIGGGWLATRFQRKGLVIVGFALVAAVGTLLMIVVPREQKGVLLFGY
FT                   YLVSCLAAITPLIYAWEAQNTAGDTKRKCTSAVVLVGMCAGNVCLLLISLHRLLSFIGH
FT                   WSPTIFHIASTALSAWVDFQSDNAKRRRDLGKSAHIADESMLSKKHLEGKALELEEIAP
FT                   APPAPTEDKGFSDSTDLKNEDFIYVY"
FT   CDS_pept        156024..157454
FT                   /codon_start=1
FT                   /gene_family="HOG000250297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273694"
FT                   /orf_name="AFUA_4G00560"
FT                   /product="NAD binding Rossmann fold oxidoreductase,
FT                   putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84362.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054050"
FT                   /db_xref="HOGENOM:HBG345174"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FC25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W979"
FT                   /transl_table=1
FT                   /translation="MSVGRAVRGVDLGIYHPDVIYLFFPRLSEPSYELIRTNKQIEADK
FT                   KEDMKKYALIGTGGRAMFFYTAIVRDFPTTAQLVAFCDTNTTRMAYANSRLEALGHAPV
FT                   PTYVASDFDKMIADTKPDEIIVTTIDRTHHQYIIRALELGCNVITEKPMTIDAPRCRAI
FT                   IDAVERTQRQVRVTFNYRYAPHNSKIAALLASDAIGDVHSVHFEWMLNTSHGADYFRRW
FT                   HRDKRNSGGLLVHKSTHHFDLVNFWLRTRPQSVVAMGDLRFYGKENAERRGETQFYARA
FT                   RGSAVARSDPFALDLEANAQLKALYADAEHEDGYHRDQSVFGDGISIEDTMGVMVRYES
FT                   GAVLTYSLTAYAPWEGFRVMFNGSKGRLEVEVVEQSYVNSGGEQAMEGALESMTILLRP
FT                   MFGKPVEIEVPAGQGGHGGGDPQLLKDLFGGEAIEDPLNRAATHVDGAWSIATGIAANE
FT                   SMRRGQVVRVDELIKLPV"
FT   CDS_pept        join(158058..158305,158536..158865,158910..159822)
FT                   /codon_start=1
FT                   /gene_family="HOG000191601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210061"
FT                   /orf_name="AFUA_4G00570"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84361.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054039"
FT                   /db_xref="HOGENOM:HBG324656"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E8DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W980"
FT                   /transl_table=1
FT                   /translation="MAFFPPPSLSDTMSQIVESKELCVAPSPIDEGFFQQQLDLRGLKL
FT                   TPDGFVHWKPGNKRHPRNWSKLRKAHDVSVILLLEMFTYLIGQGIGSIVFPPYSEAFGR
FT                   KKLYIVSTAMYSLSCIIIAIVPSVAGVVVGRLLSGFLSAIPTNVVAGSIEDMFNAKDRI
FT                   WFLSLWMMLAPWGLALGPIYSTYITYALNWRWVFYVAAIVTGFIACLLLGIRESRPPLL
FT                   LDQEVRRLCQALGKETQMVVQSLNPDRIPDLRTFFTMALFRPIYLFFTEPIIFLVSIIS
FT                   AIPFTLIYMFTEALPPIYQSFGMTPTHSCLPFLGLGLGCMLGMLTRIHDYKLIVSHHRQ
FT                   RLPLRPEDKLLGFMIGSPVFALGLWLFAWTIPPAITSVHWMVSTVALVAIGYAATEFGS
FT                   VLTGYLADSYLSYAASGFAAQTILRTSMSAAFPLFAPAMFGSLGANVAVSVLAAIATVF
FT                   CLVPPLFARFGERIRAKSRFARYSLDVYNRITVDEEGF"
FT   CDS_pept        join(complement(160830..161200),complement(160482..160803),
FT                   complement(159962..160387))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273695"
FT                   /orf_name="AFUA_4G00580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84360.1"
FT                   /db_xref="HOGENOM:HBG054028"
FT                   /db_xref="UniParc:UPI000051F749"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W981"
FT                   /transl_table=1
FT                   /translation="MLTSAILVPWLLTAVPASSASSLLRYDATLDKGRIECVYPISGQY
FT                   ALLHRVLYYSLLLFSIVSGKTPWLVAGALGAAMTYAGSAAVHATILAGISRDSLLDLDC
FT                   LGIFAIVSVGSLVVTVFFHGGLLMVVGTICAIVAMLRDYPSEDQCTSIPSDATNSTEPI
FT                   LLTSAAQSGLVPFNCTYACFSTRQAFRDPGDIRVVPAGTVSTQRFRLLEVSIWLSRFLG
FT                   AVVSLYRLLRRHAKQMRSMAQKKLAHEQKRGRPGLMTDLLLIACVVVIVLNEVFIHLSD
FT                   GIPTSEPPNAVGQWGPWVAVIMALAGSAIVEYHRPAWEEWQRVLREEGVLVEAEKNPSL
FT                   VPSLWMRLSNMGGKSPATESGPSRSSLAKGIA"
FT   CDS_pept        join(163198..163537,163591..163821,163874..164070,
FT                   164116..164203,164263..164516)
FT                   /codon_start=1
FT                   /gene_family="HOG000216775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273696"
FT                   /orf_name="AFUA_4G00590"
FT                   /product="Monooxygenase, putative "
FT                   /EC_number="1.14.13.-"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84359.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054017"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="UniParc:UPI000051F259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W982"
FT                   /transl_table=1
FT                   /translation="MALHSSLPYLDSILPSDLRAKLNSTTTNPWAEPDPTIAAAIPFVN
FT                   GATGELMAKIPMPSPKRVIRGKLRDLLRTGVEVRFGRRLTDIRVEDDGVIAVFDGEEVR
FT                   GNVLVGADGAWCEGDSSTRTLPRCRSRTSWSWWVPRHPFSRECAKEERKNAFPSFTREQ
FT                   ALFIHGKSHPIVQLAPHPHQKTSIFSNVANVVDPVRPETWVFHYCLSIWTADDAPETAE
FT                   ERRALFKHYMSQYCEPYRSAGEWLSQATPIRAEKFHYWKNITRWRNFGGKVTLAGDAAH
FT                   PMVPFTAQGLNTALEDVKRFLDAIVKVVYHGADMQTEMDAYDDSAYTRGKRDINLSVEQ
FT                   MHAYHHWEEIMTSPLMKGGYGALINSSPH"
FT   CDS_pept        join(complement(165039..165685),complement(164542..164983))
FT                   /codon_start=1
FT                   /gene_family="HOG000200300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273697"
FT                   /orf_name="AFUA_4G00600"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84358.1"
FT                   /db_xref="HOGENOM:HBG054006"
FT                   /db_xref="HOGENOM:HBG324891"
FT                   /db_xref="UniParc:UPI000051F9B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W983"
FT                   /transl_table=1
FT                   /translation="MVALYDAFGFPIVRDQLIANTVLVALATLAVLLRFISRHIRKSKI
FT                   WWDDGCCVGSMLHTYGMLAMHYHYARVGMRKHVTEIPPENLVAMLKMLIVYQVVYYNAM
FT                   VLAKLSYLFFYLRIFVTKGFRIAAWVCMGCACAYWTGSMLQIFFICQPFQKNWNPTLPG
FT                   HCASQNVAFSTIGAFNLITDVMIMVLPLHFIWKLQMSTATKLALYGIFGLGLFISAITI
FT                   IRIRVLTTVDFFDLPYSMIWAAFWSVTEPALANLNACVPMLRPVFKAAFPTLFASRKMY
FT                   STQPGSGASGIKNKAFKRMNEVESDLQLTNLTQLEPVRTSREGRISEHGDDGSHDDRSQ
FT                   DGRSQDESTHVPRSVIVNRPWT"
FT   CDS_pept        join(166314..166520,166581..168179)
FT                   /codon_start=1
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058740"
FT                   /orf_name="AFUA_4G00610"
FT                   /product="Aryl-alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84357.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053995"
FT                   /db_xref="HOGENOM:HBG734713"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000051E430"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W984"
FT                   /transl_table=1
FT                   /translation="MTEYDYIIVGAGIGGLVLANRLSADASVNVLLIEAGANRMGDPRI
FT                   DTPGFLGMLYGNPDFDWDYMSVPQPHVNNRQIAQPRGRVVGGSSALNFSVVLYPPASDF
FT                   EAWKALGNQGWGAEDMAPYLRKFHTFSPPSKSTADLLGVDSYMKASSQGCDGPVPVSLP
FT                   DVYGPFNEAWDKTFEKLGWRTDADPIAGRKLGAFTPPLTVDAKTGKRGYAAAYYSPEVA
FT                   ARPNLRLLAETMVERVLLTRQDGDVLATGVLVKDKDGAREIHAKKEVIICAGSLNTPQI
FT                   LELSGIGNAGLLQKHDIPVVIDNPGVGENLQDHCISCISFEIADGQVSGDILRDPNVVQ
FT                   ALVKLYEETRGGPLAGMPISVAYLPFVDGRGVVPRPEVEELLAKYLDSAALPPNLQAQY
FT                   AHLRKAILDNDTPSSEYLFLPAQLHMKPGATSLPDVLAKPLPENYISIMILHNHPFSRG
FT                   SVHISSPKAEDKPIYDPNFLSHPLDLEILARHTQFLETIAATEPFKSLLKERRIPENAR
FT                   DLGDLERAKELVKDRLFTCFHPAGTCAMLPREMGGVVDDQLRVYGTRNLRVVDASVFPL
FT                   EPAGNIQATVYAVAERAADLIIGSN"
FT   CDS_pept        join(168362..169144,169194..169772)
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058741"
FT                   /orf_name="AFUA_4G00620"
FT                   /product="Cell wall glycosyl hydrolase Dfg5, putative "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="EAL84356.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG055154"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI000051ED61"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W985"
FT                   /transl_table=1
FT                   /translation="MHCMQLLWLLTLSPAYSIPLDPNDPTSIKQAAHHVAANMLSHYTG
FT                   MKPGDNPGNLPPPYYWWEAGAMFNALIDYWYLTGDSTWNAITTQALTWQAGHTGTFMPT
FT                   NQTKTEGNDDQAFWAFAAMSAAERNFPDPDPDHGPGWLAMAQAVFNTQAARWDEDTCGG
FT                   GLRWQIFSFNNGWNYKNTISNGCFFHLAARLARYTGNRTYAEWAERVWDWTVDVGFITD
FT                   DWLFYDGADVLLNCSDLNRIEWTYNSGVYLLGAANMYNCYKTEGDSRWEARTKHILQAT
FT                   DAFFAEDPAMVMYERACELVDTCQVDQRAFKGFLARWMAAATQVAPFTYDWVMPRLRAS
FT                   AAAAARTCTGGPDGAACGLKWTTGVWDGSEDVGLQMSALEVIQNLLVDRVDPPVTDATG
FT                   GTSVGDPSGGMEQPDPRPPVLTMTITGADRAGAGLLTAMLGVLMIGTTGWLLYE"
FT   CDS_pept        complement(169810..171069)
FT                   /codon_start=1
FT                   /gene_family="HOG000200289" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16273698"
FT                   /orf_name="AFUA_4G00630"
FT                   /product="Aminotransferase, putative "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="EAL84355.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG055143"
FT                   /db_xref="HOGENOM:HBG324870"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F745"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W986"
FT                   /transl_table=1
FT                   /translation="MALSTRANGVLQANSNSLIWEVLSDMYDPETNPDGYYSVGIAENV
FT                   LMHEFLLDHMHQSLRLTSKSLTYNDGASGSKRLKAAMARFLNRRLHPATPLEPHHLILT
FT                   NGVSAAVEHLSWALADKGEGILLGRPYYGTFVADISMRFGTEVVTVPFGGADPLGEACV
FT                   EAYRQALTSFEQRTGKKCRALLLCHPHNPLGRCYSRNVLVALMRLCQEQGMHFISDEIY
FT                   ALSVWGGEEFVSALSIDTSGIIDADRVHVLWGMSKDFGANGLRLGALISQGNKDVRAAV
FT                   DSVALYSYVSGPADHLAANVLEDDAYTDEYIRLNCEKLKQAYEYTVGLLTQNEIPYMAG
FT                   ANAGFFVWVDLGTPYLKHHPEAKHEDVGEIVMQRLLKNKVFLASGALFGSETPGWFRIV
FT                   FAHPQAYLDEALRRIVAALQ"
FT   CDS_pept        join(complement(172923..173113),complement(172720..172847),
FT                   complement(172447..172655),complement(172038..172385))
FT                   /codon_start=1
FT                   /gene_family="HOG000216774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753332"
FT                   /orf_name="AFUA_4G00640"
FT                   /product="Macrophomate synthase, putative "
FT                   /EC_number="4.1.2.-"
FT                   /function="carbon-carbon lyase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="EAL84354.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016830"
FT                   /db_xref="HOGENOM:HBG055132"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI000051FE66"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W987"
FT                   /transl_table=1
FT                   /translation="MEDYRASSLFQPSNLAKALEDTMNPSSGGPTHLLGTIVSIPHTIS
FT                   ARTLAVLGYDFVMIDAQHTPIDAENLVRLIQTVSLSSQGRTIPICRVPSAQSHLLTYAL
FT                   DAGAGGIIFPHIDTPEQAAEAVSKCRYAYSGGDRSLAPAVLVPGVTDVAPPGSFHEGVA
FT                   DKNIAVIVQIESPLALDNADAIAAVPGVNGLMLGAGDLRVALRCPPRGAGDPEDQKILD
FT                   AIDQLVKVSRRHQKPLAVVTCKVSGTSRTWLKDFQLLMLTSDYFSVVKGHKEALARMTE
FT                   TLAEVQELKN"
FT   CDS_pept        join(complement(177707..177786),complement(175503..176122),
FT                   complement(174498..175048))
FT                   /codon_start=1
FT                   /gene_family="HOG000174648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058742"
FT                   /orf_name="AFUA_4G00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84353.1"
FT                   /db_xref="HOGENOM:HBG055121"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000052009A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W988"
FT                   /transl_table=1
FT                   /translation="MIIKWVLRHIGACLAKDDNTPKEGYLYYNDALRHHERRRAFNISE
FT                   LKRLAALAVQQKEDDVASFEKLAEGGFNRSFKITMRDGFQFVARIPYPVTEPKSLLVAS
FT                   EVATIDFLRSHGIPVPKIYSYSAVADNPAGTEYIFMELVQGQNLGDIWFTLSEQERITL
FT                   VTKLVQLESRLFGLQFPASGSLYYYDDLPAHDNPVIVPSPSSTRCFCLGPGTSLGLWNG
FT                   KRLHLPVERGPCPYFTEDFNELEEIHQVQHAELFRKRQLHYLYVKLTAEKNPEHYDALT
FT                   YHFSTLRRQVFHRASDPWKGDNMTLKADLVTLSRNWGELTGDARIPCPIFFSRDESSEC
FT                   LRLARQQSDADKQFQACQEAIGVANEGWVPVEYYDEAKGRERKLQADALDAAETEEERV
FT                   RINENWIFDDFCEEDYT"
FT   CDS_pept        join(complement(181108..184079),complement(180770..181061),
FT                   complement(180320..180721))
FT                   /codon_start=1
FT                   /gene_family="HOG000200267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058743"
FT                   /orf_name="AFUA_4G00660"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84352.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG055110"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000051F744"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W989"
FT                   /transl_table=1
FT                   /translation="MQSSYLPYWGFSDSEKFAQESIGQHPNVSRDNVLTVFAQLAALRM
FT                   HARRALISLFDKTTQHVVAEATPDLSLRAADGRDQADALWLGVRRLPRKKVTMCYHAVK
FT                   SFIEEGRGIFVANDLTSDDRFKNHPSVTGHPHNRFYVSVPITSPDDYVIGSLAVLDDRP
FT                   RDGVTEDQERLLKELSATVMDHLLCQRAMREEYREERMVRALGLFVKGKSDLNEWFDSG
FT                   DARDKKYGGQMGLLNKRLEKRQVARSTREDSQGARDNKDGKDDKDDDAGQYQDNELSEA
FT                   RSKHRRGMHGSPVQRFKQGGEHEADEAGNDDKPDEKPRKKRPTLSPTTSQLQDSLAPTN
FT                   VRSVVNRAASMIYQALDVEGAMFIDASVYARRQTVGFTKSKLDNPEAYHGQQSPDIAGA
FT                   EEPAPSISNPESRSDTDASDDDSQSRSLVLGHYTSTTSEAGVNLDDSHYVSLSGNFINH
FT                   LIDQYPRGKIFHIEEDGSSSLSYEGLADERSYSRTGNRGATSTEPEKKDIQQETMDIKE
FT                   MMKVLPDARCIAVYPVWDFQRGRWFTVCVVWANDPGRVLFEPKDLTYLAAFSNTVMAEV
FT                   SRLDLEAADRAKSDFISSISHELRSPLHGLLGTMELLQGMVNSYAQKSLIETVYSCGRT
FT                   LLDTLNHLLDYAKINTLTRPRPSEKAIAQGSDMSQPQSAVPGSLQIENLSVLVQEVVEG
FT                   LLAGAEYQRRGASGDSDALAKKEDLSLKNHLITIVDIEWQDSWRFSVYAGAWRRVVMNL
FT                   FGNALKYTQAGYIRLRMRRDTLLVDGKRTPAIRMTFSDSGRGMSKDFLTNHLYSAFLQE
FT                   DTTSPGLGVGLHLVHQIIKSLKGQIKFASEVGKGTDVDVVLPIELPEVPSPSSPRSFAS
FT                   LKERLSGMTVSLFTRSSKLGDLGFDPRVFDRIRSSLGRMVSGWFGLRVLTPDELDSTKP
FT                   DFAIVTEHEYRNYYVKGTNEPKPDSGEIQPALPLIVLSARTSSWKTLGESVEDSVIFLT
FT                   QPVSPKTLATAFEHCMGQPERSRSSSPRKLPSPVRSVEHAPPNTDRLFEGMVNGEKDQA
FT                   LEPVLGRTVIDEAGQHNVDGDGRKGAKNILLVEDNQVNLKLIEMCVKTTGFSYGTAKNG
FT                   LEALEKFKTGTYDAVVMGELTSVILHSAHLTSADISMPVMDGLTATRQMRAFERKNKRP
FT                   ATTIIILTAVLSASMQHEAMMSGVNLFLTKPTPLKQLKEILRNLSDGKDVSHIQL"
FT   CDS_pept        join(185434..185693,185740..186241)
FT                   /codon_start=1
FT                   /gene_family="HOG000200256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273699"
FT                   /orf_name="AFUA_4G00670"
FT                   /product="Nucleoside-diphosphate-sugar epimerases, putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84351.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F4DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W990"
FT                   /transl_table=1
FT                   /translation="MHLILTGATGLVGSGVLDAMLAMKEVTKISILSRRPVQMAEDAHD
FT                   PRVQVILHQGFEAYDPKVLSQLQGATGCVWALGISQTKVNKEDYIKITKTYALEAAKAF
FT                   RTLPPPNQPFHFVYVSGTGATTQPGFFTSLFARVKGETELELAELRRATPLFRASSVRP
FT                   AFIDHAHHEAIKKYVPPRPTYETLFRPLAPVFRAAMPGLCSPTEQLGRFLTEMAMGRHE
FT                   DRLVGGKDVQMVGEMPILENMAFRRLAGLRL"
FT   CDS_pept        join(complement(187974..188018),complement(187860..187929),
FT                   complement(187182..187830),complement(186911..187126),
FT                   complement(186546..186858))
FT                   /codon_start=1
FT                   /gene_family="HOG000200245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19058744"
FT                   /orf_name="AFUA_4G00680"
FT                   /product="Aquaglyceroporin, putative "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84350.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG055088"
FT                   /db_xref="HOGENOM:HBG324830"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniParc:UPI0000520097"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W991"
FT                   /transl_table=1
FT                   /translation="MSWSAKIIPNCMRSTMSNPTTANPTKQYSSRPTTVGQSSSNRPPP
FT                   YHGGVYLHPDYMHYNPNYGQPQNAPVWSLSQPLPHVMRSGMKRGDDQDAKATDKRPNAH
FT                   QEEVPAADEPPTEHPAHNADFDAEKNQPEARVSQPDERGFFNKWGEIRHRFREPLAEWL
FT                   GTTVAMTLGLCAGLQTYTSQNQAGSFSSLAPAWGFAFMIAIYMAGGVSGGHLNPAITIS
FT                   MAVWRGFPARKCMVYVAAQIVGSIPAGGIAYALLRPGRRCLLRRRTLRTLLRRFSMSLS
FT                   GRRFWWARLWRWGMIRMRRRGGGMQAFILGILISVLVLALGYNSGGCFNGARDFGARLV
FT                   ALMAGWGGEVFREKHVWWIWGPWAADITGGLFGTFIYDLAIFTEAEGPINYPRRRRKRA
FT                   LLIKEKNQMVKLRCKRRKIRDVERAVREVEQ"
FT   CDS_pept        190535..191179
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273700"
FT                   /orf_name="AFUA_4G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84349.1"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="UniParc:UPI00005202D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W992"
FT                   /transl_table=1
FT                   /translation="MACSSSCLEPNFTTLSGRYCADAPRVTLVVAPAARKEPPFDTRPM
FT                   LQRLKTLHIISNDVRDVYSHWQFPPFFHLPSLRNVNMGTVKEYKGWTRLNHPAVSSTSG
FT                   KSPVASLVLESHCNGRDGVAEFITSCANLKEFRYQHDDDEDWAQTCKNFQPQKIYKALL
FT                   TQKHSLEVLHLSHNVQVSRFPSDDKDENGPVPLDLITGGAQKPTGYSYPHR"
FT   CDS_pept        191893..193041
FT                   /codon_start=1
FT                   /gene_family="HOG000294668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273701"
FT                   /orf_name="AFUA_4G00700"
FT                   /product="Zinc-binding oxidoreductase CipB "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84348.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055067"
FT                   /db_xref="HOGENOM:HBG326376"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F258"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W993"
FT                   /transl_table=1
FT                   /translation="MALHSVVPYSLISRNSIISIYTLKTASSVSQSTGLFPKLVKMAPT
FT                   NAAAWLSEEKKHPFEIKESPLGKPEANEILIRNHALAINPIDGLIQTKAFFPLHYPIIL
FT                   GQDVAGEVISIGDKVTRFKPGDRVLGHAVGLMAGRNEACGFQTYTILQDNLACEIPENI
FT                   SYEQAVVVPLCLSTAASGMFQEDFLHLNLPTEPRTASTGQTLLVWGGASSVGSNAIQLA
FT                   VAAGYEVITTASPKNFDYVRRLGASLPFDHGSPTVTEDIAEATKNKVLAGAIDCIGTTT
FT                   TATCVDIVRRSQGKKFVATVKGGFAPPTDGIQVKHIFGTTLKDNFVGKAVYKEFLPRAL
FT                   QSGAFLPSPEPLVVGTGLEKVQEAVDLYWKGGISAKKLVVLL"
FT   CDS_pept        194314..195051
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058745"
FT                   /orf_name="AFUA_4G00710"
FT                   /product="C6 transcription factor, putative "
FT                   /protein_id="EAL84347.1"
FT                   /db_xref="HOGENOM:HBG055056"
FT                   /db_xref="UniParc:UPI000051FC22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W994"
FT                   /transl_table=1
FT                   /translation="MLDILSLRTEAEHGLADSILTATHQYALLQRASILDNRLAQWEDR
FT                   VAPENKPITIAHMPPGSDPYIEVGHWPGPLHMYTDLRAAALLNISRVARCYLLDIILRL
FT                   KDMQADTGNDDKERATAVQLIQDFTSSIPYHLVEDLHSFSMSVQRGNPIEPPGRAVGGL
FT                   LLMYPLYIASQLSIVSVQFQDYFKRCLVWIGQNTGVGYASLLAKVRYTVTGHSLCYANG
FT                   QSKAHFNIQDLTAGCIIVYGGLL"
FT   CDS_pept        join(complement(195837..196070),complement(195620..195722),
FT                   complement(195197..195576))
FT                   /codon_start=1
FT                   /gene_family="HOG000177463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273702"
FT                   /orf_name="AFUA_4G00720"
FT                   /product="Protein phosphatase 2C, putative "
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="EAL84346.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG055044"
FT                   /db_xref="HOGENOM:HBG331326"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000051F748"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W995"
FT                   /transl_table=1
FT                   /translation="MRVSGSRKVAQHAKRHISELLFEGDALQAGRFEDAIRQAIQKEEE
FT                   TLLEECQEGEDKFAISGSTVSVVIVNLNNGVMVHRLTQDHKPENPKEKERIEDAGGVVN
FT                   YASETARIGALNMSRALGDLQYKNPLNNDTMGPSTAGQEIAAMTPSIEQGSFVSSEPSI
FT                   IRVDLRQDRRYILALTTDGVTNVLKDSVIINEIKTRHEGGLGVQQVADELVRGVTQGER
FT                   RDNATCIAVFLDGCLS"
FT   CDS_pept        join(197084..197425,197473..197832)
FT                   /codon_start=1
FT                   /gene_family="HOG000166324" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210062"
FT                   /orf_name="AFUA_4G00730"
FT                   /product="HHE domain protein"
FT                   /protein_id="EAL84345.1"
FT                   /db_xref="HOGENOM:HBG055033"
FT                   /db_xref="HOGENOM:HBG324792"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniParc:UPI000051F4D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W996"
FT                   /transl_table=1
FT                   /translation="MAVPLRLLRPIPLSVPIFRFQFLPIAARSVSTSPIQMIGRITDTV
FT                   KQDHREIEACYQRIINAKDRDEQTRYQNLFTWELARHSIGEELVVYPAFEKHLPDGISI
FT                   AEKDRREHQTVKEKLKKFQNLDPSNADFIPTIKSLMADLAEHIKEEETNDLVKLDQALS
FT                   HDDSVSLSKSFDRTKIFVPTRSHPSAPNKPPYETAVGLLTAPIDQLADLFRKWPHEGQQ
FT                   SPMGHERPMGH"
FT   CDS_pept        join(198243..198712,198777..198881,199202..199429,
FT                   199601..199838)
FT                   /codon_start=1
FT                   /gene_family="HOG000215690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905471"
FT                   /orf_name="AFUA_4G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84344.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055022"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E693"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W997"
FT                   /transl_table=1
FT                   /translation="MSRTVCITAVDGHTGFLIAELLLTNETFKSHIKSVAGLTLHPHAA
FT                   KCKELAKLGVKIVPHEPGRLKHTVQTLQQIGAEAMCLIPPAHKEKFDITMEMIEAAKKA
FT                   NVANVCFVSSAGCDLAERDKQPHLRSFIDLEAAFMASKGDSSTQTGHSPVVVRAGFYAE
FT                   NLLLYSEQAQTEGILPIPIGQNHKFAPIAAEAKKVLHAQSESDASELQYLLEYYSLVRE
FT                   GKTNYISTTAFHDVTGSHPQEPVEFFKVYAESFRPKHVNKKRKMSNHLAHPVLPIFIQK
FT                   HQIQRPPHSRLPKNPFNRLLLVRRIHPRSTKPATIPNVAARTTIPETAYGSLYHIRLSI
FT                   TVLRAR"
FT   CDS_pept        join(complement(202401..202864),complement(202083..202303),
FT                   complement(201853..202028))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273703"
FT                   /orf_name="AFUA_4G00750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84343.1"
FT                   /db_xref="HOGENOM:HBG055011"
FT                   /db_xref="UniParc:UPI000051F9B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W998"
FT                   /transl_table=1
FT                   /translation="MRFLNLLLALSPLAQVSSAIPQEWGNSTGPLGGNLITDPARLSEL
FT                   HEVHNEVIRMLNTGETLPVERSRSLTVHGQHDKRVYQAFGLLGVFVASMFGLKTVEKIT
FT                   DQLLELFTSDDTIWTRKENCRAYFSTQGGGNEEFRTYARDHGNPTSEVHKNVGWIDPEH
FT                   TAPPIHFFEGDQGDSAIGVYSVQYTATDRVAWSGIPDTEKCPFEGLCNPQYIFYHNGYQ
FT                   IVLNTWQSQGRISACQYSQGEDCLGLCSSGVKNQFSRGGVRWGGDCAIPCIDDAGDGYD
FT                   VVPNK"
FT   CDS_pept        join(complement(204481..204973),complement(204327..204439),
FT                   complement(203502..204227))
FT                   /codon_start=1
FT                   /gene_family="HOG000200234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058746"
FT                   /orf_name="AFUA_4G00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84342.1"
FT                   /db_xref="HOGENOM:HBG055000"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000051EB2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W999"
FT                   /transl_table=1
FT                   /translation="MAVLCTASQTELHSSAGSFNALLKSDRARMNDLRDINESIQVPDP
FT                   RIFKDPILPTDVISLPNMAQCAAHLELLQAINHIRREVLNSKDLDAILDIKPEKRTVRQ
FT                   RYSQKRIEVKDPRFAQKRQAKWPFYVKLGVARFFLWLKKMEQTLTSNKNEVLELPTCPP
FT                   LDVLIAWHSALLNPAWLRKYCKNGGIKHMRRVVFPWRQISFTSLTGQEADLLAYLLSPK
FT                   PGPYASLLLAYRDSSPNHRPYLNKLDSLYLEKKEELPHSAFITSCYAAAHPGPYGAYLF
FT                   DAIERQRVFVDKMVGYLWIRSPGVHGTLSRAITRYEYFLQLFKLRPGTTLVPTLDIDLV
FT                   WHTHQCSASMYKASMKKLAGRFINHDDTIPGGVLRTQSDETSLLFRDYFGMDYHICLCW
FT                   ECEALQSAVDECGDGEVDFEKLANKVVNDLAAHRLLELKRRKQV"
FT   CDS_pept        join(205320..206449,206493..208002)
FT                   /codon_start=1
FT                   /gene_family="HOG000200223" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905472"
FT                   /orf_name="AFUA_4G00770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84341.1"
FT                   /db_xref="HOGENOM:HBG054989"
FT                   /db_xref="UniParc:UPI000051F9B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A0"
FT                   /transl_table=1
FT                   /translation="MSRLSRLFDKSKQTLPVTSASPDGPAWTEVGNAADHLPAELESLY
FT                   WTGVNKELDCIVSTLRRWQQPHFQHIQPDADNTLVNGFDTFVADVVPQSAQAPPQLPSQ
FT                   ASTELNVKGRLVRSAQVRAMELAAAKTRTKVNVDVHKRLLQRPVETDAAKRRARLLLQA
FT                   AGFLDIEKTIEHSPAANTPSPLTPQLRMTKKGFKGCPAISTLPCSRCKRVIRGSMYQAT
FT                   GGSTQTICEDCYWEHHYGDPAYIKQYKHSIASQVDELMSKHTSCRSCRKNSDKIRRPSG
FT                   LPGKTGVHKLADAKYLGVQEAQNKSGLSGRPTPLAKVIHNDYNSRSGTSFAASRSDKLH
FT                   LVGEEWLYKDFVQENPWKNIRVAVRVGPLVFENGSKESRNGAGISIRDPIFGQGHQRVN
FT                   GTCLAVCGENERQLWRYVRPLPWKRKRFQAVLKQVVGTPFTGWPLSPAEDEIITLLVKA
FT                   SNDDIEGACQELHDKVKAFLSPWVSVYFESIVGSLLDTKTRLAWDGLTNNCQQFCNSLI
FT                   DWELFGPLVASSSVTISTNDPPQPLYRMSFVCRPRAAQDPFNHPNSITNVPYGLTEEYT
FT                   RRFHFGCYTGPDFIDSLHEYWYDWAGFHKPLYPHQSLFPWDCTEALRRYPVKCGTCTLS
FT                   KHVWAFPFDSWSIIALHLSRDKCAYPASELSPNSPSDASWITNRLTLLTALDTLSAGAT
FT                   AMSQSLPFQSATQWLHLQLDPSTDRIKLGGINRAQPYSHALERRTHDDFFVAKWVSDDR
FT                   LPIQTYEDMREKRYSPRTAQERELVFWGAEGSDPPGEYATWAVEYTRIPNANFPVSVSF
FT                   TTGCGACGTQATAAACGANCGASCGSCGGGGGGGGGCGSGDSGGGSGSGGGGCGGGSGG
FT                   GGGGSGGG"
FT   mobile_element  210393..210989
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  210396..210986
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   mobile_element  211067..211903
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(complement(213079..213314),complement(212588..212957))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905473"
FT                   /orf_name="AFUA_4G00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84339.1"
FT                   /db_xref="HOGENOM:HBG054967"
FT                   /db_xref="UniParc:UPI000051EFEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A2"
FT                   /transl_table=1
FT                   /translation="MASGKNLPEENTSKGDEKTDDNGRPGLSWHALWLLKHEPHGASID
FT                   MRRLKRDIDWRRHNAGIAGETGGAFYVPEQGKTGLIPVILAAGITVGDSWMAIPMPVPI
FT                   QHTRPRSRHESKTKAMEATLLIRTTGEGVSQVDRGRVRRGLCIPMGRGGRPERGKGERG
FT                   PSFGFPQFLRRRAGLTFYAAVCTESDWGRLDCFAEKWP"
FT   CDS_pept        join(213386..213677,213726..214894)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16273704"
FT                   /orf_name="AFUA_4G00800"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84338.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054956"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E8DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A3"
FT                   /transl_table=1
FT                   /translation="MPYWQELFSTGYRDPTGHPNITSSQSAAIVSILSAGTFFGALGAA
FT                   PMGDRIGRRWGLIASAQVFNLGVILQTAATGIPLFLAGRFFAGLGVGLISALIPLYQSE
FT                   TAPKWIRGTIVGAYQLSITIGLLLASIVNNSTQNRMDTGCYRIPIAVQFAWSIILVGGM
FT                   LILPDTPRYLIKRGNIDGAARALGRLRRLPADDPAVREELAEIQANHEYELSLGKSTYL
FT                   DCFKGNLLKRLLTGCGLQALQQLTGINFIFYYGTQFFKNSGFKNSFTISLITNCVNVGS
FT                   TLPGLYAIEKWGRRPVLFWGAVGMCVSQFVVAIIGTTTTGQDAHGVIIVHNEPAQKAAI
FT                   AFICFYIFFFASTWGPSAWVVTGEIFPLKIRAKSLSMTTATNWLLNWAIAYSTPYLVDY
FT                   GPGNANLQSKIFFVWGGCCFLCISFVYFLIYETKGLTLEQVDELYGEVSSARLSKHWTP
FT                   TITFREMQQEKARDVHLETAEAAVPKTA"
FT   CDS_pept        join(215210..215217,217000..217144)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273705"
FT                   /orf_name="AFUA_4G00810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84337.1"
FT                   /db_xref="HOGENOM:HBG054945"
FT                   /db_xref="UniParc:UPI0000520799"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A4"
FT                   /transl_table=1
FT                   /translation="MIGHLLDYDSLPSTESMFSTGSIAATSTCILQLSHTQFRHENRGR
FT                   ANACI"
FT   mobile_element  complement(219506..221392)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        join(complement(225137..225155),complement(224743..225021),
FT                   complement(224560..224695),complement(223888..224518),
FT                   complement(223151..223822))
FT                   /codon_start=1
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905727"
FT                   /orf_name="AFUA_4G00830"
FT                   /product="MFS peptide transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84335.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054922"
FT                   /db_xref="HOGENOM:HBG323814"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00005202DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A6"
FT                   /transl_table=1
FT                   /translation="MTRPAEAPPGDSITGNTITSDSINAKGDLEKHDYEITATSTEVDD
FT                   YPAPTEEEKASLRKVPASLPLVSFSLCIVEFAERASYYGAKNIFSNFIQFPLPKGGNGA
FT                   GAPPRGTQETAGALGMGLQASSGLVLLFAFLAYVLPILGGWWADVYVGRYKAICVGVAI
FT                   CGVAHIIQIIGAIPSVLQKGPAHAAPPFIIGLLLLALGAGIFKPNIAPTILDQNRQKKQ
FT                   YTKVLKTGEKVIVDPELTTTRTMLVFYAFVNIGAFYMLPTAYAEKYVGFWLSWVLAGAI
FT                   YFLLPVVLALVYKKTYKQPPSGSSDLTKAVKIISTALRRNKYRVWKKNFFDAAKPRALA
FT                   AEGIEVDWDEKLVDDNRTVATEVFFYFPIWLLNDGGIGSVSTNQGASMTTNGAPNDLLN
FT                   NFNALTIIVTIPFLSHVVYPTLARYKISFGPASRITFGFILATISGVIAAIVQWRVYKT
FT                   SPCGYQASTCDDVSPLSIWWQIPNTVLGALSECFCNVTAYELAYSRAPPSMRGLVMAIF
FT                   LFMNALSSALGEILIPATKDPWLIWIWAAPAVALAVQTVVFWWRFRHLNDEKFMTDEKD
FT                   YH"
FT   CDS_pept        join(complement(226968..227013),complement(226211..226914))
FT                   /codon_start=1
FT                   /gene_family="HOG000216771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059002"
FT                   /orf_name="AFUA_4G00840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84334.1"
FT                   /db_xref="HOGENOM:HBG054911"
FT                   /db_xref="UniParc:UPI0000520096"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A7"
FT                   /transl_table=1
FT                   /translation="MCQAWTLPGGYRAAALVRDGSKLRKILSVLGVSSEIVESQLIITE
FT                   DSSRDVKTVVRLLRSDPDLIFSGVTSLPKFSINPLRPIGMQDATIIGDSAIALIDALRE
FT                   LRSTGGLSNAPLYIPISSVGHSSQRDQPLLSIPLYLWLLPIAQEDTAVLEKVVRKAATE
FT                   ANSPLGGYVMLRPPLLTHGKMKGRESVRVGWIWEDEAFKNQDEEEEEEGIKIKWTISRL
FT                   DLAKWMFEELVQGDAHKWKGKCVYLTY"
FT   CDS_pept        join(complement(228162..228584),complement(228109..228114))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274665"
FT                   /orf_name="AFUA_4G00850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84333.1"
FT                   /db_xref="HOGENOM:HBG054900"
FT                   /db_xref="UniParc:UPI000051F4D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A8"
FT                   /transl_table=1
FT                   /translation="MSPSAVDAIDVANGNYRPGLGFGSVRSLGALNWKDSEDERALQGA
FT                   EVITAALKFKGNPQALHIMPGQSLQYKCIIPVNVIRGSRKSSWMNIREKPSPTGPSFNV
FT                   FRPRTLEDRHQQFRRALRVADLKPFVFYLRHLWKCEPG"
FT   CDS_pept        join(239341..239470,239528..239623,239672..240186)
FT                   /codon_start=1
FT                   /gene_family="HOG000200190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753589"
FT                   /orf_name="AFUA_4G00860"
FT                   /product="Cell surface protein, putative "
FT                   /protein_id="EAL84332.1"
FT                   /db_xref="HOGENOM:HBG054889"
FT                   /db_xref="HOGENOM:HBG324710"
FT                   /db_xref="UniParc:UPI000051EB29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A9"
FT                   /transl_table=1
FT                   /translation="MSNMIHKVKEALTGHHGDSHTTSHGHHDSRAADKVDPRVDSDRDN
FT                   RARHEAMGGTAGPHTSDTANKLDPRVDSDRDNRGNTTSGTYGSSNTYESTSNTYGSSNT
FT                   YENRSNTAGPHGSNIANKLDPRVGSDADNRGLGTGTGTTSGTGAFGSGTGTGTGTTGYG
FT                   TTSSNVGPHDSNIGNKLDPRVDSDQDNRARRQAMAGSSYTGAGTGTGTGATAGPHSSNI
FT                   ANKLDPRVDSDLDNSATMGTQRGF"
FT   CDS_pept        complement(240646..241200)
FT                   /codon_start=1
FT                   /gene_family="HOG000200179" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905728"
FT                   /orf_name="AFUA_4G00870"
FT                   /product="Antigenic cell wall galactomannoprotein, putative"
FT                   /protein_id="EAL84331.1"
FT                   /db_xref="HOGENOM:HBG054878"
FT                   /db_xref="HOGENOM:HBG331717"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI000051E696"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B0"
FT                   /transl_table=1
FT                   /translation="MRFLFPLLAATAFTSAIPTATITKRDATAVVEAVNSIASQMVVLN
FT                   NTVTSYDGGIQGTLTALKIEVESVKLSCDLRDAISTTQASANFTNAESLTVATAFINLQ
FT                   PQIFSTLNNIVAKKPKFDTGLLGIGSLAFLVKGDLQQQKDLSGQLGDAVAAKLAPLYAQ
FT                   LAPMINKQIADAFDKAIAAYS"
FT   CDS_pept        join(complement(242311..242678),complement(241992..242175))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274666"
FT                   /orf_name="AFUA_4G00880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84330.1"
FT                   /db_xref="HOGENOM:HBG054867"
FT                   /db_xref="UniParc:UPI000051E8D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B1"
FT                   /transl_table=1
FT                   /translation="MHVSCKSGSSNPWISIRSWDPRFDTYELASPFVFAHTNQDRPVLE
FT                   KGGLLAAIEEGGPVLNWPLADNEIMEAKPMLSTNPRKSTAESLRSGSGPATATGSKVGK
FT                   NSTHLPSFLRPKNDDFFRGPPTILRLISYLLKPIVIVANDDIGEAAGGQAEAEVDQQAM
FT                   GVVSPLSSLGRVRTKVLRYF"
FT   CDS_pept        complement(243969..245627)
FT                   /codon_start=1
FT                   /gene_family="HOG000200155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905729"
FT                   /orf_name="AFUA_4G00890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84329.1"
FT                   /db_xref="HOGENOM:HBG054856"
FT                   /db_xref="UniParc:UPI000051F4D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B2"
FT                   /transl_table=1
FT                   /translation="MNKRKVELMSDTVDSLEISVLHELHGEGEAVGPEGQFPETQEARR
FT                   KRKKNKKKKRLSEVTQTGENAQISLTPIMDLQQPSQSRSITDEEFLPDMFHRLTTITPL
FT                   NGPHANPNRRIPPAPVSFKHNDYLCNLSISEADVIAMQLFQGTYRLDIRELPHQECRMT
FT                   LIWDYDHLWGCFDIGVWKGLMLIDPGPRDNTKTMYSFAWRGVCENEPEVAYDNEGITVG
FT                   EITLGGKGPVSGCFKGMAVANFPNDKCDFKAVREVGPPMVPWPVETFVADWNYLQHDRA
FT                   KEPESQRLVLLALSPEPESQVVNDETMQMDGEEDQEEEGQCQDEVTTDVHPSSPARQPA
FT                   ETPHTSPPPDEPTQQSQRAPSTISRFHATPLAMQRSWARHDQDKFLDVVCGSYEISSPT
FT                   MKHNWSRKASKLRMRLLVDRGESCVWGMFAMGVYRGIMLFQESPIRFQKDRRLKFCWRG
FT                   RETDGRDCAEKLGYLHFVEDMSIQGCFYDMYGDVPFAGRRRIRPAVESRFDEAFFKQQW
FT                   WEHEPVPPTLLRQVQGHSQGQMETQLETQTQPETR"
FT   CDS_pept        join(247227..247254,247398..249385)
FT                   /codon_start=1
FT                   /gene_family="HOG000216766" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753590"
FT                   /orf_name="AFUA_4G00900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84328.2"
FT                   /db_xref="HOGENOM:HBG054845"
FT                   /db_xref="UniParc:UPI0000F51BD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B3"
FT                   /transl_table=1
FT                   /translation="MDLRREIPSLYGNFGVCYLHFSVFRFLFYILYLGLVDADRQASVR
FT                   CWPLIWRELAPHTLVLWLHDCSTEDDWPPWKFRSLLEQMVERGCRYIWVGLNKQDSPDV
FT                   SEESVQEARRKYEEEFAKYKDDLSWKVLTHKLSAKTGVGVSEVLKDIYQAVKRANLEPP
FT                   KEDKQDKTGTVISDSSDEKLTTEQLQRRIEKEVTGDTIDPDAFWTSFLEGDLPAWTHYT
FT                   YLKALYFVILESAKKKTFTEIANDFNIHLIRLRNISPQLFNDSETPSAYVHAPFNICLA
FT                   TFWTLQLQHGIREYRMHSMSSHLPSREEFPQVLRRSPSLMSTYLWKSYYSFNPVSRPRD
FT                   YWSIPNLRKLPTQTDYLRDPATVPRKDEGPDKLIRYAFAVMQYVRNAGAARGQVVTQAL
FT                   VALQQATMRARTADSTVETYSETQAYFWIQIVHAALRSLDDKKGSVDTSEMSFEAFQQT
FT                   FHLKPTDWQEYYSKKLWNSVAARSQFVMPDLKPLPNVIASLPSKVIRKAPEGIPKLPSA
FT                   EELTFRARMACEELTPTLQSSGPPVLSHTHLLFYLHKRFTQSAEGGTRKKLERRARELF
FT                   SEIAGPIVAGATYRNFWIQQVGVAVLNSDIGKGRSTFPEFITSNLHLVFEELHGIYYGP
FT                   GVWTSADAAEKILGPDRRRMETIVNMADVNMSANTK"
FT   CDS_pept        join(complement(250805..251109),complement(250645..250752),
FT                   complement(250432..250588),complement(250173..250358))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274667"
FT                   /orf_name="AFUA_4G00910"
FT                   /product="Short chain oxidoreductase (CsgA), putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84327.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054834"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51BFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B4"
FT                   /transl_table=1
FT                   /translation="MSTYLITGASRGLGLALAHHLANLPGSSVGTIFATSRSEHPNLQE
FT                   LSQQFDRVKWVQCDVTDSASVHDAVTAVQGQLQGQGLDVLINNAGVMPHTMGRIANMDD
FT                   LTETFHTNVTGTHNVTRAFLPLLREGRRKLVVNISTTLGSMTLAPVYKGSPTPAYKITK
FT                   AALNMLTVQYAQDYASEGFTFLAVSPGWLQTDMGGSRADLPPATGAQGVLDIVQKTTPS
FT                   QNGKALNIHVPGWEENEGLNQYDGKEVPW"
FT   CDS_pept        join(complement(252219..252821),complement(251346..252170))
FT                   /codon_start=1
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274668"
FT                   /orf_name="AFUA_4G00920"
FT                   /product="MFS pantothenate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84326.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054822"
FT                   /db_xref="HOGENOM:HBG324666"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000052009F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B5"
FT                   /transl_table=1
FT                   /translation="MTILSSSSCIRSSMMRLVPAFHDAESKLRFKIDFFILTFCCITYF
FT                   FNYLDRANLSNAYVSGMKEELAFHGNQLNVINTIFTVGYILGQVPSNLALTYFRPRIFF
FT                   PAMIFLWGGLTMITAAVHSPQGIMAIRFFLGLAESSTFVGTHYILGSWYTEEELGKRSG
FT                   IFTASGLAGTMFGGFIQTGIHSSLDGVRGLSGWRWLFIIDGLITLPIAIYGLFLFPDTP
FT                   ATTRAPYLTESERALAISRLPVTNAERAPLNRAFIKRLFTTWYWWAFVILWVIAGETES
FT                   FSSNSLLALYMKSHPTIKYSVAQLNNYPTGVPAVGIVSTLFWATLTDILHGKRYLVAYF
FT                   IGITGVVTAALILTRFDSTPTVFGAYYWAGAVYACQATFFAWCNDAMRSQDARHRSVVL
FT                   ASMNMGNNAVNAWWSIIFYSANLAPQFTRGMWAMIGCSIALVIWASWIVFMMVREKSRP
FT                   DDGDVRDCSTEQPKAEI"
FT   CDS_pept        join(253340..253968,254020..254590)
FT                   /codon_start=1
FT                   /gene_family="HOG000200166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059003"
FT                   /orf_name="AFUA_4G00930"
FT                   /product="CorA family metal ion transporter, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84325.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG054811"
FT                   /db_xref="HOGENOM:HBG324657"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000051FC21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B6"
FT                   /transl_table=1
FT                   /translation="MELFSGLRRLLSRKTLTGSRGLLTATENVFDGQRQEAEKLYRRNF
FT                   LENYSDTETAHFSFFTTKLDSVIHASSINSLASIYGPLHTLLDSGEHDGIWWLDVTDPS
FT                   DGDIELLSRLFDIHPLTTEDIKIRETREKIELFGPYYFLSLRPPQQAEDVPGSRTSGCN
FT                   VYAIIFREGVLSFTFGNNPHTSHVRSRIKDHQSHLFLTSDWISYALIDDIVDGFAPLIN
FT                   RVEASVETMEDSVSITRPDDIGLALKQIYTSRRQVLQIRQLLNDKTDVIRCFARHCEAL
FT                   GSTREVVSYLSDIQDHVLTMVSNLAHSEQRLSRSQDKYLGQLSFDSTRMRNQIVATLSR
FT                   LTVIASCIVPMQIITGLFGMNVMVPGKNSQGLGWWFGILGVILALIVLSLEIARRSRFL
FT                   "
FT   CDS_pept        <254891..255721
FT                   /codon_start=1
FT                   /gene_family="HOG000216765" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20753591"
FT                   /orf_name="AFUA_4G00940"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27174.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG331322"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51BFF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA88"
FT                   /transl_table=1
FT                   /translation="TQHHDTYPFIAQATHHNHKVLITGASRGIGLATAHSFARAGAPSI
FT                   AIAARGPLDTVETALLSTAKEAGHPPPTILKLTLDVADDASVAAAAEEVAAKFGHLDIL
FT                   INNAGTSEPWVPIAESDPADWWGCWEVNVKGVYLVMRAFIPLLRKGTQKTIVNVSSVGA
FT                   LWVAPGASAYQTGKFAVLRLTEFVMAEYGSEGMLAYAIHPGGVPTELAMGIKALQGLLT
FT                   DTAELAGNAMSWLTQERREWLGGRYVSVTWDMEELLQKREEIVREDKLKMRLAV"
FT   CDS_pept        join(complement(257832..258106),complement(257392..257777),
FT                   complement(256075..257333))
FT                   /codon_start=1
FT                   /gene_family="HOG000048693" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18210306"
FT                   /gene_name="srb4"
FT                   /gene_synonym="med17"
FT                   /orf_name="AFUA_4G00950"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 17"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84324.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG054800"
FT                   /db_xref="HOGENOM:HBG324646"
FT                   /db_xref="InterPro:IPR019313"
FT                   /db_xref="UniParc:UPI00005202E3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9B7"
FT                   /transl_table=1
FT                   /translation="MADDRFTLPLRPLIEKRDRPDPLPLEIAQINAQWGSFRDVSEESL
FT                   RAKIEEEKSKEYTIEEEEGEGAGAELDTTERLDQLYKRRAEIIQFAMQAHMEAMFALDF
FT                   VSMLLSKHTPRQAETSMSAYLKQVAPLGSLHSEIINPPPKSEAVVRDTKTVSRGWRLQS
FT                   FNAAADKLLKSASRLENEVASETRYWHEVLAVKDKGWKLCRLPRQGQTLGVQYGFLEAT
FT                   PIFRDRGLAALRRSEDGTLILDKGLVPTKAKTVRVRVKDCGIITGCSKPYRSAAQDPDS
FT                   IEGRILQARDTLYEEELFHELFREARIMGSQGVTTRQNLVQFPVSEEQEILLDLVDPDQ
FT                   EVYVDDEATKSEEHNVLADALAHLIRILLCYAHRQNLRRRTQPPPALSPKRRHIPEYQL
FT                   LRPIMAYLQHSFHVRWLETFMKDVYGVLQSAGLSCSFTATPYSSVNLSNIDRSVPKVEG
FT                   LIRQFLLPLESTFSADLLTPQSSFKVKSRTNLSVPPFGTQFEILLNLPHYPDVHPPHRI
FT                   GLHDQAANIITHFIMLDIVAAIELQTSPALSISKTEAKSVSWEATYPHHGELLSVSIDG
FT                   KQKKMKVILSRDELTIQTYDVLGLERYSRAAPETTPGLQTHTWKAGPTTAPSLMEYVAA
FT                   VSQR"
FT   CDS_pept        join(259114..259854,259911..260372,260420..261643)
FT                   /codon_start=1
FT                   /gene_family="HOG000200154" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905730"
FT                   /gene_name="pfkA"
FT                   /orf_name="AFUA_4G00960"
FT                   /product="6-phosphofructokinase "
FT                   /EC_number="2.7.1.11"
FT                   /function="6-phosphofructokinase activity"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="6-phosphofructokinase complex "
FT                   /protein_id="EAL84323.1"
FT                   /db_xref="GO:0003872"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005945"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG054790"
FT                   /db_xref="HOGENOM:HBG324640"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniParc:UPI000051FC20"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9B8"
FT                   /transl_table=1
FT                   /translation="MSSTQAPVEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSDCE
FT                   AYAVFEGYEGLVHGGHMIRQLHWEDVRGWLSKGGTLIGSARSMAFRERAGRLKAAKNMV
FT                   LRGIDALVVCGGDGSLTGADVFRSEWPGLLEELVKNGELTEEQIEPYKVLNIVGLVGSI
FT                   DNDMSGTDATIGCYSSLTRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTG
FT                   ADWLFIPEMPPRDGWEDDMCSIITKNRKERGKRRTIVIVAEGAQDRSLNKISSSTVKDI
FT                   LTQRLGLDTRVTVLGHTQRGGPACAYDRWLSTLQGVEAVRAVLDMKPDSPSPVITIREN
FT                   KIMRTPLVDAVQETKHVAKLIHDKDFEAAMRLRDAEFKEYHFAYRNTATPDHPKMILPQ
FT                   DKRMRIAIIHVGAPAGGMNQATRAAVGYCLTRGHTPLAIHNGFPGLCRHHDDQPVGSVR
FT                   EVKWLESDAWVNEGGSDIGTNRSLPSEDFETTAMCFEKYKFDALFVVGGFEAFTAVSQL
FT                   RQARDKYPAFKIPMVVLPATISNNVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRV
FT                   FVIETQGGKSGYIATTAGLAVGATAVYIPEEGIDIKMLSNDIDFLRENFARDKGANRAG
FT                   KLILRNECASSTYTTQVIADIFKEEAKGRFESRSAVPGHFQQGGKPSPMDRIRALRMAV
FT                   KCMLHLENYAGKSRDEIAADPMSAAVIGIKGSQVLFSAMGGEDGLEATETDWARRRPKT
FT                   EFWLELQNYVNVLSGRASAGKPLWSCYESKHFPSCCRLYNTDLSIDIDPSALTSS"
FT   CDS_pept        join(complement(263531..263555),complement(263341..263423),
FT                   complement(262295..263294),complement(262075..262214),
FT                   complement(261911..262015))
FT                   /codon_start=1
FT                   /gene_family="HOG000200133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274669"
FT                   /gene_name="isn1"
FT                   /orf_name="AFUA_4G00970"
FT                   /product="IMP-specific 5'-nucleotidase 1 "
FT                   /EC_number="3.1.3.-"
FT                   /function="magnesium ion binding"
FT                   /function="phosphatase activity"
FT                   /biological_process="nucleotide metabolic process "
FT                   /protein_id="EAL84322.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009117"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG054779"
FT                   /db_xref="HOGENOM:HBG324632"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051E431"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9B9"
FT                   /transl_table=1
FT                   /translation="MTTRYRVEFASSRPTGKFFTARLNGQTNIFQIEWIKGLLAVPFVL
FT                   HSQPTAVYQEHSENLVAVAADTHQRYAEIFRDVEKLIDDHSRPLAPPPPPVLASHLTLS
FT                   VDHERNAAPGKSKLKLLVPTAGSFFSRLPLEDAFKYQDAKRMISRRRFVAPSFNDIRLT
FT                   LNTAQLLGLVRGPGLDLVTFDGDVTLYDDGACLTPDNPAIPRIIRLLHQGVRIGIVTAA
FT                   GYTEGAKYYERLKGLLDAVHDSSSLTPAQKDGLVVMGGESNFLFRFDSASPHRLSYVPR
FT                   PEWLLDEMKSWNQEDITQLLDIAESSLRACAANLNLPVAVLRKDRAVGVYPYDRSKIHR
FT                   EQLEETVLVVQNTVERSVVGSRLPFCAFNGGNDVFVDIGDKSWGVRACQRYFGGIEPSR
FT                   TLHVGDQFLSAGANDFKARLASTTAWIASLTETVQLLDELEEMQKAEKNRS"
FT   CDS_pept        264171..264989
FT                   /codon_start=1
FT                   /gene_family="HOG000216764" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274670"
FT                   /orf_name="AFUA_4G00980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84321.1"
FT                   /db_xref="HOGENOM:HBG054768"
FT                   /db_xref="UniParc:UPI000052079B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C0"
FT                   /transl_table=1
FT                   /translation="MPTPQNQNTQSVITWLKVSRNMNMNTNMNCLRDSNSPPLSDPPPP
FT                   YTPAASPQMPESQPEADTKHPLPPSEHRGSSSTIPPIRGIQIPSKHDYFTSGFAYPPFL
FT                   ATYDVFPHHWTQFTNDLNEEVKLSPRQWATTVAKGVGVLALGGMMAGVLGAIPAVLVAR
FT                   KARQNHEEMNLITAASERPDDTDADSGSEGASRLSRKLKTWNNTFFRPRGIMVRIDLPW
FT                   EELDEMQGMEVLPAGRYAKRNEQAVRQDASRKARIVIIPVVTDSASRSVN"
FT   CDS_pept        join(complement(266646..266923),complement(266407..266596),
FT                   complement(266227..266355),complement(265097..266173))
FT                   /codon_start=1
FT                   /gene_family="HOG000200122" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19059004"
FT                   /orf_name="AFUA_4G00990"
FT                   /product="MFS quinate transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84320.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054757"
FT                   /db_xref="HOGENOM:HBG324618"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520099"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C1"
FT                   /transl_table=1
FT                   /translation="MAGGPKKPVNIFRLKNLNEPKEVFNWRLWFSVLSFGLMGAARGVD
FT                   EGLISGAFNSKDFQRTIHYSEYSQVEQTNIKANVSAMVQIGSVGGALFAFLVCDRIGRI
FT                   WATRQLCLLWILGIGIFLGANGSLAAIYAGRFIAGLGVGQTVVVGPVYLAEIAPASIRG
FT                   LCTCVFTGFVYLGIVLAYFTNYGCQVNLGDNTHKRWEVPTSLHIIFAGLIFLLSFLQYE
FT                   SPRFLIKKGKYEHAIRNLARVRHLPEDHEYVVQEITAIEQSHQAELEATMGAGWLGIVK
FT                   ETFFIPKNLYRIYLTVMSQILSQWSGAGSITLYAPDLFKLLGITGSNESLLVTGVFGIV
FT                   KLVAAITCALFLVDVIGRKRSLLIGITLQAIAMIYVAAFLTDVPEMGIVDDFVLPESKL
FT                   GVSRGAIAMIYISGFGWALGWNSMQYLLTAELFPLRIRALATSIAMTLHFANQYGNSRA
FT                   VPNMLLPTQHGGITPKGTFWCFAAVTILGGVWVFLSVPETAGRSLESMDRLFELPWYKI
FT                   GLYGNKDAEERDQVVSEKMQMEEEMHGTAAHQETVEKSRV"
FT   CDS_pept        join(complement(269782..270004),complement(268433..269724))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753592"
FT                   /orf_name="AFUA_4G01000"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84319.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054746"
FT                   /db_xref="HOGENOM:HBG324610"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C2"
FT                   /transl_table=1
FT                   /translation="MEEEKGISELKTTLAHETAHEAASRGHVATDQYGRALVEFDRAAE
FT                   SRLRLKIDLYIVPTVSLLYLFCFIDRANIGNAKLAGFEKDLGLKGYDYNALLSIFYISY
FT                   IVFEIPCNIACKWIGPGWFLPAITLGFGICSLGTAFVHNIHAASGVRFLLGIFEAGMMP
FT                   GIAYYLSRWYRRSELAFRLSLYIVMAPLAGAFGGLLASGILSLDHFGGLRTWRMIFAIE
FT                   GIITIGLALISFFTLTDRPATARWLTQEEKDLAIARVKSERVGTTEVLDKIDKAKTLRG
FT                   IFNPVTLATSFIFLLNNITVQGLAFFAPTIVRTIYPHNSVVSQQLHTVPPYVVGAFFTV
FT                   LFPFLSWRFDRRMVFFVIGPPLMMAGYIMFLASTDAMIRYGATFLIASGAFAFGALCNA
FT                   NASNNVVSDTARSSAIGTTVMMGNIGGLISTWSFLPFDAPNYHIGNGLNLATSSMTMLL
FT                   GALLWGWMRWDNKRREKVDVDQALAGLSLLQIQDLDWRNPAFRWRD"
FT   CDS_pept        join(272645..273498,273800..274370,274434..274985)
FT                   /codon_start=1
FT                   /gene_family="HOG000216763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753593"
FT                   /orf_name="AFUA_4G01010"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84318.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054735"
FT                   /db_xref="HOGENOM:HBG324602"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E42E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C3"
FT                   /transl_table=1
FT                   /translation="MADTLKTGEPSGWRIPKACQECRKRKIKCNGVNPCKTCRVRNTLC
FT                   VYRDVIRQRKKKRHGPVDEGLASCESTRTELGTQQPSSPPPQPLGRRNKSASYTFHNSV
FT                   SATHMTSPSCKVQLYYGPTSHFTLMHEIYRGLVSNQTTHPEEPQGEVEEAGAGLDMFSV
FT                   RGIFFGTPAETHDPNKGIGTTVAPVMFMPYELARVFLQRFLSTLYHLVPFWSKELYERQ
FT                   LETLYLPSSGTGSDTCTNSILLMALAMGSLGTQRYRWGDILFERVKASCPSWDDVVNLE
FT                   TVQLWICFHLGRPSSLSSRDVGIAPPKDPFILILIHLTNVMARSANEIYGRPHDSLLQM
FT                   WKLARSITEDLRCYDEKMKLALGFGLDKSPQPGDVGVQQAILTTCKPLTCRLMDGRLRK
FT                   IVYYHTILLTFRPFLIFRGRWLRDTKKSPSATGPNTTKRPTEMPAWLNEACDHAVHAAC
FT                   RTVHHLCEAAIVNEFVRELRYHGFFLTSACFALIYDFMYNEKVATTHLPWVHVGLQCLG
FT                   AMRPGDPITSSISAIQTVLKKLCPSYEWVPPGPVQGQTYAPNLTSSASATPYSNGVAPS
FT                   QVNPMRETFPGGTFLGGYLPTMPNIQVNPLQSDIPEASASVVSSEDLPDFNLSDMGWDF
FT                   DFSTMDLEAFFSIQPTMNPSQPL"
FT   CDS_pept        join(275753..275904,276630..277556,277603..278286,
FT                   278332..279360,279410..280043)
FT                   /codon_start=1
FT                   /gene_family="HOG000178140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059005"
FT                   /orf_name="AFUA_4G01020"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84317.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG054724"
FT                   /db_xref="HOGENOM:HBG326511"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000051E69A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C4"
FT                   /transl_table=1
FT                   /translation="MPTFSSSPGIPSGCTTFRMRHPLAKKYPRTCPRLMKEENAGTKPD
FT                   TLLLTEFRSSHSQDGVNEPLEAASARGTIRRRDKSNSAASLIAYAQLAAYRLGCSQSFV
FT                   VRFERGQANIIAEASPSLLLEGGGGVGVDEGHRQAKVLSLRLADGRVVNTPNVIADSTR
FT                   CVIRDLTQDNPSDNQEIQFFAAVPIYDVNKDTMGAVCVVDKTPHLGFGDSEVTSMQEIA
FT                   DLVACNIKDKSAEEDHLQAERLIKGLTTFVSCQVVPDLEQGYHFKRRPSYLPGIDDLSL
FT                   SEKCSVGSPQYTHPQTPGTPPNQLFSRIHERRNSVTVIEGSTVSHSMSFLFSRASALLQ
FT                   KCMELDGVLFLDATRSNARSSCSPSMSDLEVLSKDGDSCINSPGLSAGAWRERVCEPLG
FT                   WASSGSANRCTSQYSISEGLLHDLFAAYPKGAIFNASTLVDCTSQRCGHDTDARGLRHH
FT                   TIILRLVQDLPEARSLLFLPMWNWKSSRWLAGALLWTCDIQRSFEQTDLFYVKAYGDAI
FT                   VSEAAQIDWQATEKSKSDLLSSVSHELRSPLHGMLASVELLRTTDLQPAQLDMLTMIET
FT                   CGLTLMDTLNYLLDFTKINNLTSADAKNDTETSLVDLACEFNLDTLVEDVADTLYAGHR
FT                   SPINASQVAGRYLPSGSMGIISAKGTESATESNDLSVIVGVEPGNWKVRSNPGGWRRIV
FT                   MNLLGNSFKFTKSGFIEVTLARKMEGTGGTKRVYAHLTITDTGCGIAPEYLEHKLFQPF
FT                   TQEDILTEGVGLGLSIVDRLVTNAGGQIDVKSTVGIGTQFEVYIPVEFVDTLDEGAPEQ
FT                   QQPQSVSVSRVCLVGLNVFSSMKTSSQRLSVNTKRRLSVRSALSNAILSQPGWTVSFAD
FT                   TLSQAKGDIGIIEESSLAEKADLEQITTDLTRLIILGQYGSGPSVDPATKKLDVVYVPQ
FT                   PLTPRKLIGALHTLSNLPEAREQIGSSDSMPHRQRSLSEAFVLAKQTESPPVVEGLELG
FT                   EFRGSTPKASTTTDRHVLIVDDNDINLKILATFMRRIGCSYETATNGLVALEKYQQAQR
FT                   QFNYVLMGRLPLLGVMVQLTAIDLSMPVMDGIISTSKIREYEEENSLPRAAIMAVTGVA
FT                   SATMQQQAFAAGIDDFLVKPLSLRDLKRVMMNIA"
FT   CDS_pept        join(complement(280397..280502),complement(280173..280339))
FT                   /codon_start=1
FT                   /gene_family="HOG000200111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274671"
FT                   /orf_name="AFUA_4G01030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84316.1"
FT                   /db_xref="HOGENOM:HBG054712"
FT                   /db_xref="UniParc:UPI00005202E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C5"
FT                   /transl_table=1
FT                   /translation="MKPTLFVLALAGVALGAKTCTPSFDYCAKKLIADKGFTEADLEVV
FT                   LKAEDLETTDLKNVLFHCKNPGDVGHAKVCPNGCTDPATEGSHGC"
FT   CDS_pept        complement(280824..281585)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19059006"
FT                   /orf_name="AFUA_4G01040"
FT                   /product="Short chain dehydrogenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84315.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054701"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051E8D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C6"
FT                   /transl_table=1
FT                   /translation="MSYANKTALIIGGSHGIGLATAQLLHSHGAKVLVTGRSPDPIRSA
FT                   QAQLGPAAKVLPCDITSVASIDALVKTASSFFGNGRTIDLLFINAGYAALEPFADVSEA
FT                   SFRRTVDTNVFGAYFAAQKLAPMVAPGGAIVFATSVANQMGIPGMSVYSASKAAVHSLV
FT                   QTLAAELVGVQVRVNAVSPGFVRTPTMGVVGASREELVEFERQGVKSTPMGRTAEPEKV
FT                   ARAVAFLGFEATFTTGEQVVIDGGLATLRLH"
FT   CDS_pept        join(282938..283129,283176..283220,283264..284722,
FT                   284767..285364,285412..285686,285735..285813,
FT                   285895..286600,286658..287254,287303..287401)
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905731"
FT                   /orf_name="AFUA_4G01050"
FT                   /product="ABC multidrug transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84314.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG054690"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000F51BDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C7"
FT                   /transl_table=1
FT                   /translation="MDTPSSGTIDLEHGEAGLRKRLTLTFRSVSVHVTAPDAALGDTLL
FT                   SVADPRQFLGFLKGSRPKRTILKDVSGQVKPGEMLLVLGRPGSGCTSLLRVLSNDRESF
FT                   DEVIGETRYGSMDHVAARRFRQQIMFNNEDDVHFPTLTVNRTMKFALRNKVPRERPDGQ
FT                   GSKEFVQEQRDNILSALGIRHTTKTLVGNEFIRGVSGGERKRVSLAEVIAGQSPIQVWD
FT                   NPTRGLDSKTAVEFARLLRREADMNQKTMVATMYQAGNGIYNEFDQVLVLADGRVTYYG
FT                   PRQLAKSYFEDMGFVCPKGANVADFLTSVTVLTERIVRPGMEDKVPSTAEEFEARYRQS
FT                   DIHQKAMEGFDPPEKLTHEVDELTAAVASEKRKRHLPRSPSVYTTSLWEQIQACTIRQF
FT                   QIMAGDRLSLIIKVVSAILQALVCGSLFYNLKDDSSSIFLRPGALFFPVLYFLLESMSE
FT                   TTASFMGRPILSRQKRFGFYRPTAFCIANAITDIPVVLVQVSCFCIILYFMAALQMDAG
FT                   RFFTYWIIVIANTLCFMQMFRAVGALCKRFGNASKITGLLSTIFFVYGGYLIPYEKMHV
FT                   WFRWIFYLNPGAYAFEALMANEFVGKSLQCVQPDYIPYGSGYPGSESPYRGCSIPGSEG
FT                   DVILGAAYIRAQYNYSWHHIWRSFGVIIGFWVFFIVLTALGLELLNSQGGSSVLLYKRG
FT                   SQKTRSEDTTTPVQEAARASHAKQSTFTWHDLDYHVPYQGQKKQLLDKVFGFVKPGNLV
FT                   ALMGCSGAGKTTLLDVLAQRKDSGEIYGSILIDGRPQGISFQRTTGYCEQMDVHEPTAT
FT                   VREALVFSALLRQPAHVPREEKLAYVDHIIDLLELRDISDALIGVPGAGLSIEQRKRVT
FT                   LGVELVAKPTLLFLDEPTSGLDGQSAYNIIRFLRKLVDGGQAVLCTIHQPSAVLFEAFD
FT                   SLLLLARGGKMAYFGETGKDSQTVLDYFARHGAPCPPDENPAEHIVEVIQGNTDKPIDW
FT                   VQVWNESEEKQRALAQLQTLNARGKADADYVEDTADYATSKWFQFTMVTKRLMVQLWRS
FT                   PDYVWNKVILHVFAALFSGFTFWKIGDGAFDLQLRLFAIFNFIFVAPGCINQMQPFFLH
FT                   NRDIFEAREKKSKIYHWLAFIGAQTVSEIPYLILCATLYFACWYFTAGFPTTASISGHM
FT                   YLQMIFYEFLYTSIGQGIAAYAPNEYFAAVMNPVLIGAGLVSFCGVVVPFSQMQPFWRD
FT                   WLYYLDPFTYLVGGLLGEVLWDVEVRCDPSELVRFRAPLGQTCGEYMAAFLAEKPGYLV
FT                   DGNATACEFCQYSTGADYARTFNLKERYYSWRDTGITALFCVSSYAMVFLMMKLRSKKT
FT                   KSARSE"
FT   CDS_pept        complement(287471..288277)
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274672"
FT                   /orf_name="AFUA_4G01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84313.2"
FT                   /db_xref="HOGENOM:HBG054679"
FT                   /db_xref="HOGENOM:HBG329730"
FT                   /db_xref="UniParc:UPI0000F51C0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C8"
FT                   /transl_table=1
FT                   /translation="MPTFTTTSSNPGLDHRLSSPILEHYVYPTFIAVAWCNAIDLIVLC
FT                   FNTFKRYSGPYFWSLLVSSFCIIPFGLGYVLKIYSITFTNYFLEIAILDAGWSGMVTGQ
FT                   SLVLWSRLNLVLDNRRVLKALLYLIIVDGAVLHTACTALEFATNALPSNGVAIAFDVME
FT                   RVQLVGFCLQELLLSGLYIYKAVPLLKMDADRRSRGVLVQLIVINAVIMALDVSVVIVQ
FT                   YLGLFTLQVTSKALVYSIKLKLEYVILGRLVDVSRVRSPAAARMRL"
FT   CDS_pept        join(289860..290031,290082..290791)
FT                   /codon_start=1
FT                   /gene_family="HOG000216762" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905732"
FT                   /orf_name="AFUA_4G01070"
FT                   /product="Acid phosphatase, putative "
FT                   /EC_number="3.1.3.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84312.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054668"
FT                   /db_xref="HOGENOM:HBG395855"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="UniParc:UPI000051EFF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C9"
FT                   /transl_table=1
FT                   /translation="MRLLPLVLLPLTAQAINIVSSNDDGWAEINIRQFYKALTAAGHSV
FT                   VVSAPAENQSGKGSSDKTPTTRTKPCEFNSCPSGSPATGFNASDPRLNYVNSYPVTSMK
FT                   YGISTAAPPFFNDAPPALAVSGPNVGSNLGLAVYFSGTVGAAHYAAEAGIPAIAFSGSS
FT                   GSPTAWNAAVPAYSRVYAQLATKITNQIVASGTPYLPDQVWLNVNFPEVSSECAAADDF
FT                   KFVLSRIFTGIFSADDVETCGSSRLPTESTVVGTDGCYVSISVGWSDKTDAAADVQAIV
FT                   LDKLGDLLVCLP"
FT   CDS_pept        join(complement(294905..295041),complement(293839..294771),
FT                   complement(293131..293782))
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753594"
FT                   /orf_name="AFUA_4G01080"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84311.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054657"
FT                   /db_xref="HOGENOM:HBG329313"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F747"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D0"
FT                   /transl_table=1
FT                   /translation="MGAGSRHPAQDCWKSHVKALIGIPLASSCLKIENVGSAQNMKLSH
FT                   RLSLTYATVLTICNFGPLPCCSTMNHSQTPSFTAGPEGYCALNVAPVISKLPSIQDPPE
FT                   FEVYWERNDPENPRLWSIWYKGITVAAMSLGATVVSLSSTLYTSGVPGLQEEFGISKLV
FT                   ALVGVTTYLLGMALGSVLFAPLSELVGRRPVYIVSMTIFLLLLLPSALARNIETVLVSR
FT                   FFGGFFGSALMSNSPASVNDIVSDKHRPLAFGFWSIGPTNGPVYGPIIGGFVFENLGWR
FT                   WTNWIVLIIGGGVLVLMASIKETYAPVILRRRAARKRKETQNSRWWTRYNGEQDFKSSL
FT                   RANLSRPFRMLLTEPICIFWDVYVALVYGVLYLCFVAYPIAFQQERGWSPGIGGLSFIG
FT                   IGVGVLIAIACEPIFRKIINLHRKSEDGIVEPEAMVSIVGFGATLLTVGQLWFSWTCTP
FT                   SVHWIVPILAGVPFGAGNACVFIYASNYLARSYGIYAASALAGNMLLRSIVGACLPLAG
FT                   PSMYGNLGLNWASTLLGLLEAACISIPVVFYFYGHKIREASPLLKKLEDHTLSPHH"
FT   CDS_pept        295285..296130
FT                   /codon_start=1
FT                   /gene_family="HOG000079046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210307"
FT                   /orf_name="AFUA_4G01090"
FT                   /product="Zn2+ dependent hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84310.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054646"
FT                   /db_xref="HOGENOM:HBG333307"
FT                   /db_xref="UniParc:UPI000051F4D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D1"
FT                   /transl_table=1
FT                   /translation="MSPPSLTVTHITTANAVLNIDGINFLTDPFFGSIKGTEYDTTPAW
FT                   EKMDLKAFGFDSIPPPPHLVNKQGPALQLHDLPPIDAVLLSHEDHLDNLDPEGRKLLDG
FT                   RRVFTTMDGASNLRPRPGVVGLRPWQTVTATIGGKVFRITGTPCKHFPVGEVTGFILET
FT                   DSFGVDATGKPNAIYFSGDTVYIDELREIGKKWHISAAILNLGNATFDFPTGPIQITMD
FT                   GKQAVQLTRDIGADVMIPIHFESWAHFTEDREDLVKVFTEERFMDKVVWTVPGVPKVVY
FT                   "
FT   CDS_pept        join(297057..297196,297283..297730,297804..298370)
FT                   /codon_start=1
FT                   /gene_family="HOG000169885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274673"
FT                   /orf_name="AFUA_4G01105"
FT                   /product="C6 and C2H2 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84309.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054635"
FT                   /db_xref="HOGENOM:HBG324543"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51C48"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D2"
FT                   /transl_table=1
FT                   /translation="MPPQPLSGSSLPPFQCDHPGCGAKYRRKEHLNRHAASHSRGDCFS
FT                   CPDLLRRHIRIYHPNRAPPASRAQKACAACHARKERCYGGFPCSACQKRGIACSPGKGK
FT                   TPEEQIVDNNVQISQQPHPPRWIALDYVDIYFDNFHPKWPFLHRGTFDVTKEPCVLIQS
FT                   VVMIGLWIEGSKKSREAATDLHRSLSTAIRTQMDRWRVFNQNQSTSWPMATYQSVLLQC
FT                   IFALFLAWERKAIDLNLRYQIQDDEHDLLVTLVESCRLGGIFSYPNMLAQHSSGVPLTL
FT                   VWLSLEEIKRFGLALYKVCRLSTRLDPSRADGSSAQSELLTLADLSFGMPDSDEAWNSI
FT                   SGVGCEVRQEEAFQTKLRDGQDPTGWISQSASVLSNARVAFDWI"
FT   CDS_pept        join(299151..299289,299339..299404,299471..300055,
FT                   300127..300347)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210308"
FT                   /orf_name="AFUA_4G01110"
FT                   /product="1,3-beta glucanase, putative "
FT                   /protein_id="EAL84308.2"
FT                   /db_xref="HOGENOM:HBG054624"
FT                   /db_xref="UniParc:UPI0000F51BB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D3"
FT                   /transl_table=1
FT                   /translation="MYGTASEHNVLYQYQLPGAQKIVMGMIQTETPYFQPLPAAPEPFK
FT                   PAGCAMAWAVRIINSSTVYILGSGLYSWLAFYTQDCLETGNCQEQGFYVEQSTNTWVYN
FT                   LVTKGVTESISPAGETPLYARDVRNGYTSSLLAWLHTGTGAIGKRKFPGFYLWDGEMDR
FT                   DVLSGVSSTCKASLTRLVECHDQVYMLRALQWRGSMHNDTLTDLMCDKTCGQSLQLWFE
FT                   SVLAGCAREQDHVVLAEPGGIIWAGWNETCVKDPNTGKYCGDAINEFTVVRSISDMPHS
FT                   EPCSYCYVTRYKMMQATPYSIYDKTYQSDLEFIHSKCGLSGPTSILPPLQEFPDP"
FT   CDS_pept        join(complement(301213..301331),complement(300996..301129),
FT                   complement(300596..300972))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059007"
FT                   /orf_name="AFUA_4G01115"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27173.1"
FT                   /db_xref="UniParc:UPI0000F51C08"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA90"
FT                   /transl_table=1
FT                   /translation="MTIIKHRHDLDIEAVRKEFPGRGKRVQPPEQWLRCSGVQGIVHTM
FT                   LAPHIDQRSLDSKTMVAVKKRTAQHAKLAAFMNAGPDEIDQILNFPSDPCPAGLWPLHN
FT                   GSFAESGRPLRPSLNADSEIVVSGLCHEADVAAFAALAKTLGISIRWWAQPGEWETTGI
FT                   LSLASAPSDLPCSRKRVLYAAGASSTSPDLLNGVSPTGLSDANTNG"
FT   CDS_pept        complement(302121..302735)
FT                   /codon_start=1
FT                   /gene_family="HOG000216752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210309"
FT                   /orf_name="AFUA_4G01120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27172.1"
FT                   /db_xref="HOGENOM:HBG324516"
FT                   /db_xref="UniParc:UPI0000F51BB1"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA89"
FT                   /transl_table=1
FT                   /translation="MRASFLLPVAIYVLTAYADDKTTTVGYFIPSWSVTLLSYGVWTST
FT                   GASVAGINAAATTYHLGCLKDAPKTDCNIKNSWTIIQGPETVSATGVYTASTSGKETSY
FT                   DITVTESYECKIRSRTESASCTMSVGMTGSVGGAAITSSTSTSATYSPATSSYYELVVT
FT                   AGVDKFTVPEATKTPGVAAAGPAGALITAGPVVAAAVAALL"
FT   CDS_pept        join(305348..305704,305775..305904,305965..306179)
FT                   /codon_start=1
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274674"
FT                   /orf_name="AFUA_4G01130"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84306.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054601"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000051EB27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D5"
FT                   /transl_table=1
FT                   /translation="MYTKYYEFSSPSLVETYFSYPEDRSTTHGVLILTDVIGHRFINSQ
FT                   LIADQFAANGYIVAMPDLFHGDSVKLNRPETFNLMSWLEGHPIERVDPVVDSVLKYMRT
FT                   RLGCEKIGAVGYCFGAKYVVRFLRPEEGKVDVGYIAHPGFVELDELSAITGPLSIAAAE
FT                   TDDVFPTSKRHQSEGILRDSGLPYQINLYGRVEHGFAIRADLTDKAKKFAKEQAFLQAV
FT                   QWFDEFVKGQN"
FT   CDS_pept        308273..309943
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274675"
FT                   /orf_name="AFUA_4G01140"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84305.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054590"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EFF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D6"
FT                   /transl_table=1
FT                   /translation="MSDLPPERSHTRRNTNDLGLVPTETKETLHEAGLSPNTPEIGINY
FT                   PEVGRPADPVFPEEYNLETQTGLVPARTLESVRTTTWTGRQISPADLEKGGEPVDFVTF
FT                   TINDPDNPHNWSHVYRWYVTIVVSMLVVCVAYGSAFVTGGLGLIEDKYHVSLEVATLTV
FT                   SIMVCGFAVGPLLWSPLSEIIGRRPVYVISLGLYTIFQIPCALSPNIGGLLACRFLSGV
FT                   FSSSGLSLAGGTIADVWNIEERGMAIAFFAAAPYCGPVVGPIVCGWINVGSHRLDLFFW
FT                   TNMAFAGVVMIVVGLVPETYAPVILKRRAKKLRQETGNPNIITEQEKVKLSFREIVRTN
FT                   LVRPITMILTEPVLDLMCMYIVLIYAMLYGFFFAFPVIFGELYGYNDGQIGLMFIPILI
FT                   GAGFALLVTPLMEKQFRRICQSRAPTPEDRLIAALLGAPFIPIAMFILGATSFKHIIWV
FT                   GPASSGIAFGFGMVLCYYAVNNYIIDSYHKYAASALAAKVFLRSGGGAAFPLFTTQMYH
FT                   RLGLQWASWLLAFLGVGMVFIPYGFYVYGARIRAKFEKH"
FT   CDS_pept        310511..311845
FT                   /codon_start=1
FT                   /gene_family="HOG000168020" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274676"
FT                   /orf_name="AFUA_4G01150"
FT                   /product="N,N-dimethylglycine oxidase "
FT                   /EC_number="1.5.99.1"
FT                   /function="sarcosine dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84304.1"
FT                   /db_xref="GO:0008480"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054579"
FT                   /db_xref="HOGENOM:HBG324494"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000051F9B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D7"
FT                   /transl_table=1
FT                   /translation="MHSTVDIPSLNASPAPNRIIIIGGGIVGASLAFHLSTRSTHHHIV
FT                   LIDKDLQAQLGSTGHAPGFVGQLNESAVLTRLAQDTVSEYLSIPGGFNTVGGLELTSTP
FT                   SGLETLRRRRDLAKEAGLPAGLVEPEEAASLAPNFVDGSSIAGGLFFPSDGTADAKGIT
FT                   TYYLERARDRGVDFLETAVTGFGTKKGGDENTARIATIRTKDGEIDSENSIVILATGIW
FT                   TSSLLSTGNPSPITQLPIPVVPVAHPYTFTRPRPPRAGKPSPFVRWLDHHVYARDHGDL
FT                   DGMGCYNHAPVLLNPDQSAIGAWLSDFEQVLADASSVPKNGAEFQVSRHSEASVEEPEV
FT                   AEKGPFNGIFAVTPDNLPLVGRVPDVDNLWLCAAIWVTTAAGAAKLLVRKILGDDAAAH
FT                   GDTMLLDALSPKRFWGLEPDLLIRRALRQYNDIYNRGLREDGDGQ"
FT   CDS_pept        complement(312142..315330)
FT                   /codon_start=1
FT                   /gene_family="HOG000216751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274677"
FT                   /orf_name="AFUA_4G01160"
FT                   /product="Von Willebrand domain protein "
FT                   /protein_id="EAL84303.1"
FT                   /db_xref="HOGENOM:HBG054568"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="UniParc:UPI0000520539"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D8"
FT                   /transl_table=1
FT                   /translation="MDVLDRLQSGLFFRPDVADITSTVIQPYILSNQVQPTSHYQKNAS
FT                   SSIPAATLTSIHSSTPEVSLPLLSVSADVDIHGRLCTTKVTQQFSNASSSTTQNARYVF
FT                   PIYDGSVVTSFRCWIGNDRLLEGVVKAKEAARAEFKHAVSQRKVAVLVEELVPEIFETS
FT                   VGNIPAQTTVKIEITYTNLLKVDNSTGGLVLTIPTSIAPRYGAVPKGYSGNESLLTEGL
FT                   RINVQASMPTAIRKMESRSHPISVEMGAVSHKRFTDFAASASSDTLDYSKGRATLSDRK
FT                   AVLGQDFVLHILCSSREFSRSQAIAASQPGQPRLSTIAVTLHPSDLFGQNVHMEDFVGE
FT                   IIFMADRSGSMSSKIPSLINVMNIFLRSLPEACSFNIASFGSQVTWLWPSSMRYSQTNL
FT                   NVAAKHVESFQANYGGTEIYDALHSVLDHYNERNDVPTNVILLTDGEVWDVDNVIQLVH
FT                   RTASNGNSNIRFFSLGIGDQVSHRLVEGIGQQGGGYAEVVPESSMGSWQERVIQMLKAA
FT                   LTPSRLQCNVDLGEELARKTSERQIAGYTVQYPQWVQAPHQIPVLSTFSHLSLYYIVES
FT                   GLDSLPKTINITTTNERGEKLSAQLPIQTVAEQPAIHHLAAKALMNDFETGQSWLHSLN
FT                   PILKSTNPTGFEKVLEQEAQHVGQTWSIPSKWTSYVAIDRTTAQQHAISVHKADAIEFS
FT                   QLTRPRHTSIFPDPRISNKGDPFARGCLLSYPRREFLASTSRLSGEDTQPLSPSAPPAA
FT                   GPYALDTFFEPTYAASPSSFLAGFDYHHNQPSQYQGQPPASPVTSQTAEVWPRSRNASV
FT                   ASSLLTQSRGRVDKTAAAYNDPGEGKDIDMHDACPVSRVDSDEAIAAAPRESSERGRAT
FT                   RYVRPRSSSPDDEAEVHYHLSKAHSLNNTTRSGSRQTRFCRPQTPDSDACDAEHPRPSD
FT                   FPSLDTILCMQRADGRFYVISGSLRIALKQKYEHEALHKFLISRFCRKSSIRVGPLCQL
FT                   AYCVCLIVHITHEYASSKALWELQVAKARQWIKRTIKRWMKESGDSEETPETSLEESAD
FT                   SMLEEMEKLVLQQG"
FT   CDS_pept        join(315609..316060,316915..317107)
FT                   /codon_start=1
FT                   /gene_family="HOG000048694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753595"
FT                   /orf_name="AFUA_4G01170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84302.1"
FT                   /db_xref="HOGENOM:HBG054557"
FT                   /db_xref="UniParc:UPI000051ED60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D9"
FT                   /transl_table=1
FT                   /translation="MAFQISIGDVLMLSKLAWDITQAFTSGRKSAPAEFQEVQNQLSSL
FT                   THALESLKSLSGESPGLDDGASASSITPILQNCRFTLEHLDALVKKYMIIENDGTGGPE
FT                   KKRWRDEIRKNWKKVRWTREGGDLTRLQHNLGVHINSLNLTIAVLNSYSTGPIEAVQLV
FT                   HYRNLTGDGAWVFNESADAILAARLDPIPIDSTEHEASEFTVTGELPQLHN"
FT   CDS_pept        complement(318407..318892)
FT                   /codon_start=1
FT                   /gene_family="HOG000216749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059008"
FT                   /orf_name="AFUA_4G01180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84301.1"
FT                   /db_xref="HOGENOM:HBG054546"
FT                   /db_xref="UniParc:UPI0000520098"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E0"
FT                   /transl_table=1
FT                   /translation="MKFTFSFIALGFASFAQSTSVSGSSSLLPGNTNTASAAWLTHFDQ
FT                   FRQQHEPLNPAQSAVIDTATDLAKQGQDFDPKAMDDLKNDAISAFGFKDAKSLLATMGN
FT                   KSLQTRDDAKEDIECGCSTQSDWCDSGYHCAGGGCTQTGSGCGTLYKYACDGLCRLS"
FT   CDS_pept        join(complement(321119..321419),complement(320986..321071),
FT                   complement(320570..320933),complement(320408..320520))
FT                   /codon_start=1
FT                   /gene_family="HOG000216748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753596"
FT                   /orf_name="AFUA_4G01200"
FT                   /product="Extracellular guanyl-specific ribonuclease,
FT                   putative"
FT                   /EC_number="3.1.27.-"
FT                   /function="RNA binding"
FT                   /function="endoribonuclease activity"
FT                   /protein_id="EAL84300.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004521"
FT                   /db_xref="HOGENOM:HBG054536"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniParc:UPI000051F9B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E1"
FT                   /transl_table=1
FT                   /translation="MLFDMKSVVLYGLMALVHASPLSDLSKRAKLGDFQCPDDTLSEHD
FT                   IREALHECRRLDDGSIGKYPAFFGNKSNNQKVFGNIPDGTDLREFPIIVGGVYSGGEPG
FT                   PCRVVTDYKDNRGDFRGVMQHTGATPGRDKDDKNKHDKDEGDMKSNNEERSVQETETEV
FT                   EEPTGHIVSDLTTRSKKRRLGSATCTDGVTLSHDDVVNAFRECKKWDDHGRGGYPHKFG
FT                   NKSGNSQVFEGITKDLREYPIIQSGTWTGGEPGKYRVVTDYKDNFEGVMIEHAGVSFSR
FT                   CTINKD"
FT   CDS_pept        join(322040..322436,322483..322961)
FT                   /codon_start=1
FT                   /gene_family="HOG000216747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210310"
FT                   /orf_name="AFUA_4G01210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84299.2"
FT                   /db_xref="HOGENOM:HBG054525"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI0000F51C49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E2"
FT                   /transl_table=1
FT                   /translation="MGKDNFIRQVENSAEFKLLDKVVKDQVTVQDAVQEVIDMTMTALS
FT                   VHGPSKQGGIGVPDYNISLAVMELAQRREPAEHTKLAKFVSHLQKQIAIDPSTNEPLTV
FT                   QRDILWTDMPSFGYTELETWSEFGGDYKDPCDITLASEQRDRWTKLNAFLAQLTQAADI
FT                   HYPPPGEEVRFFPLDKSLRAIWVMAMAFENERPPSSLGDTAAMEAACLWFIYAAKRLWA
FT                   NVVNNRTYPAVAGAGPGKRYEAAGWTGYTRERWGIWEDALKEARAACKIERMRVLINNA
FT                   LASMRDAVNQ"
FT   CDS_pept        join(complement(325710..325877),complement(325407..325654),
FT                   complement(325259..325358))
FT                   /codon_start=1
FT                   /gene_family="HOG000199989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274678"
FT                   /orf_name="AFUA_4G01220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84298.2"
FT                   /db_xref="HOGENOM:HBG054514"
FT                   /db_xref="UniParc:UPI0000F51C4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E3"
FT                   /transl_table=1
FT                   /translation="MSPTSVSDSHPAVLSLRTAALVTSAAGFISLAWSITHHKDISDDG
FT                   AGGINSIVLGTIAYAFLWSLVALTIRLTPRRIHPGIYLAFDLIAFLANVIAGSIGLAVL
FT                   APAMEGGYNCYSAGCDGDAVLRVEIFAYVIVFVNVVVHVMLVVWASWACHVERARRMEK
FT                   NGFEEVEL"
FT   CDS_pept        join(complement(327752..327892),complement(327636..327706),
FT                   complement(327472..327585),complement(326956..327416),
FT                   complement(326133..326914))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210311"
FT                   /orf_name="AFUA_4G01230"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84297.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054503"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51BF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E4"
FT                   /transl_table=1
FT                   /translation="MTTGTKAPEMASLQMEAGHHASTDAKHSGTVYDDHDMQRMGKVQE
FT                   LKRNLRPLAALSFASVLQATWEFILISNTQGLENGGLAGMVWSYLWTFVGFGFIIASLS
FT                   EMASMAPTSGGQYHWVSEFASPRYQKFLSYLTGWMSVLAWQAGSASGSFLTGTIIQGLI
FT                   SVRYPDYQPERWQGTLFVFAMIVVIYVFNVYAADMMPLFNNLLMILHILSWTVVVIVLW
FT                   AMAPHQSAKAVFTEWTNGGGWSSIGLSALIGQISAIYASLSSDATAHMSEEVKDAGRYV
FT                   PIAIAWGYFSNGVMAIVVVISFLFAIPSVEDALDDATGFPFIYVFKNATSVAGVNGLTA
FT                   IILIPVIFSNILFNASTSRQTFAFARDKGLPFARWIAKVDPRRKIPVNAIALSCIISCL
FT                   LSLINIGSLTAFNAIISLNVAALMYTYIISISCIIYRKIWHPDTLPPRRWDLGRWGLTV
FT                   NIVGLLYCMFALFWALWPSETPVTVDNFNWSVVIFGVVFVLSLVMYAVKGRREYHGPVV
FT                   IVRRD"
FT   CDS_pept        join(328471..328683,328749..328850,328896..329114,
FT                   329158..329300,329344..329767)
FT                   /codon_start=1
FT                   /gene_family="HOG000199978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274679"
FT                   /orf_name="AFUA_4G01242"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84295.2"
FT                   /db_xref="HOGENOM:HBG054482"
FT                   /db_xref="UniParc:UPI0000F51BDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E6"
FT                   /transl_table=1
FT                   /translation="MSTPVMMTATALPSGVSRPPTVDRKDNHGGLVVVITGFCLVLVLS
FT                   SLAARTFSLCKRRVIQKDDYGFMAVVVVALSQTSLVLAQAHYGWGATEEVLSATEERML
FT                   KMGYASDILFIVTLGLSKITTTVFYMTLFKQKLHAVIRGLLVGGGIWVILSVILVAVRC
FT                   SQRPWLDIDAQCSGLFQRWQAITAIDVIIEVLLILYSARAIYSIKISTLQKIVVFGTLS
FT                   CRTILIPLSATHLYYIKVQLDSDNPTLYGAFASITAELYLAMSVVCLVASFMKPVLAVY
FT                   VDEYGIAYTDEISPPNSKLRSHTSSESRSRRLRRSETEYDRSWERMPDRTIPAASGGRI
FT                   MKTVQISVSDGPMELERREPEVVIGV"
FT   CDS_pept        330558..332120
FT                   /codon_start=1
FT                   /gene_family="HOG000165936" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19059009"
FT                   /orf_name="AFUA_4G01260"
FT                   /product="Mitochondrial chaperone ATPase (Bcs1), putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="EAL84294.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG054474"
FT                   /db_xref="HOGENOM:HBG324443"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniParc:UPI000051FE62"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E7"
FT                   /transl_table=1
FT                   /translation="MSTAASTMNGTVEKVFYLSSLAVGSWVAKRLLDEYADLPLHLLCS
FT                   SIEVHSYDEAYNYLLYWLMKQKLDANKNRLLALTSLTSGQGGFFGEDTNKDNDAAEEDE
FT                   LEVHADAEYKASLANTRPLLWTPSAGTHWFRYRGRFLALTREVEENRQTVYTRTEKLRV
FT                   SCLGWDPAILKELMQDARVAFSQKEKGRTVIYRAMKSIYDGELAWKRLTSRPARPLSTV
FT                   ILDEAVKHAFLEDIQHYLHPSTMRWYSDRGIPYRRGYLFYGPPGTGKSSLAFAAAGFLG
FT                   LNVYMVNLNSQQLTEDALTQLFLTLPRRCLVLLEDIDANEVTGRRKPAARRRKGKNGIS
FT                   LSALLNIIDGVAAQEGRVLIMTTNHHEHLDPALIRPGRVDYKLEFQLASRDLCATMFRN
FT                   IFQVYTPSEVGSAQVAASSTQGGLSEKDGSTAIDLQDVAKVFAGKIPPGTFSPAEVQGY
FT                   LLRYRDSPEDAVAGVESWVETSQAEKAANDQVLEDKAAQSSESESEDDSEDDNEEQPDE
FT                   DAS"
FT   CDS_pept        join(complement(334517..334801),complement(333665..334412),
FT                   complement(333436..333605))
FT                   /codon_start=1
FT                   /gene_family="HOG000216745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753597"
FT                   /orf_name="AFUA_4G01270"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84293.1"
FT                   /db_xref="HOGENOM:HBG054465"
FT                   /db_xref="UniParc:UPI00005202DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E8"
FT                   /transl_table=1
FT                   /translation="MRPLLHYLAAYALLYLQGAGALPQRVSPSEVSSALTATSTGTSIR
FT                   ENRTCDFGTINEFFDYANKNGLNITVEVQNCQNLCLLTYGVGNPDLSGIGTGLTILIGP
FT                   VYRIFYLTLAPASAFIQDFKDVQTNFFSSNAFFVCSSALATIANLSLNPPTFEIAEMQA
FT                   LAFLQVNSILVTFFCLVIAQPRSRWGARVLLYFVVFVLVIVALGQSHLGSDSRADWRLA
FT                   SDGCAHSSNDYSVIKPVPYPSWAVAIFAVAGTVGFWLESLKKRFQADKLHKSLFRILMV
FT                   LWVLLIGLLTAGMVLGLTMMWRQRRHLRSLARDEFEDDQWGFGQIAALTIWVPVLVELL
FT                   YILNDLAQRKSKGWSDINQTISVFFSPKAVQQEMTPPSSCLEAEIKGQDKSGRVAEVAS
FT                   S"
FT   CDS_pept        join(336211..336820,336882..337972)
FT                   /codon_start=1
FT                   /gene_family="HOG000216743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274680"
FT                   /orf_name="AFUA_4G01280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84292.1"
FT                   /db_xref="HOGENOM:HBG054460"
FT                   /db_xref="InterPro:IPR021514"
FT                   /db_xref="UniParc:UPI000051F25B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E9"
FT                   /transl_table=1
FT                   /translation="MAGVGSNLKAHQYEPSQTSEVGSETRSATTIEYRRHPIYYPSEWL
FT                   LESISSLMALGLLLGIAIIFWYMDNKPLSAWRGPISLNATISILTTACTAMLMHGVSTF
FT                   IGQSKWLHFKNRPRKLADLETFDGASRGVWGSILLLTTIKWNLATIGAFITILRLAFSP
FT                   FTQQVVLIEQHEIISPSDTAAFGYAHNYSRNVLEWLGKRWQNVPQDPGMQSAIMQALYG
FT                   VNTTEPFMCPGVCRWTGSYISLGFKATCKNVTQDTLQTATCESDEISLQRCNMTTPGGV
FT                   GLATRALFTELATEYYMNASSLLPVSSSREFLDAFPEITRFGIYRSTPDFGFKQQNVNI
FT                   TECSLFLTAYEYMGAKANGSHFSFASRQEVDFGVKNPWAFRREESLMDMKLMHLYTNES
FT                   TSGDTHIPSLEISYASLAAVENFFLSSSIVTEWVVGNFINADFGVAAALSGDVDLSNRF
FT                   DRMATAMTDYLRYGPNTQSAQGEIYQTEPFVFIRWGYFVVPIITEGLAILFAISTIYNN
FT                   RRSRRVPLWKSSTLAVLACQHEAGLGLLQTSSKDINEIQHEANKAEARL"
FT   CDS_pept        join(344122..344217,344285..344647,344730..344987)
FT                   /pseudo
FT                   /gene_family="HOG000170085" [ FAMILY / ALN / TREE ]
FT                   /protein_id="EAL84291.1"
FT   CDS_pept        join(complement(346839..347036),complement(345594..346772))
FT                   /codon_start=1
FT                   /gene_family="HOG000256309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274681"
FT                   /orf_name="AFUA_4G01300"
FT                   /product="UPF0075 family protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="amino sugar metabolic process "
FT                   /biological_process="peptidoglycan turnover"
FT                   /protein_id="EAL84290.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006040"
FT                   /db_xref="GO:0009254"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG054444"
FT                   /db_xref="HOGENOM:HBG324434"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniParc:UPI000051ED5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F0"
FT                   /transl_table=1
FT                   /translation="MVTSIEFAEPNGSAHVNSSRCCVADGTLDITVMGMNSGTAMDGID
FT                   CALVRYRQDSPEAPLHMEILKYDEIPIPQHIKKPVLTMLRETKTTPSLMSQLNVQLGNM
FT                   FGETVKLFCEKHNVPINSIDLIGSHGQTIWLLSMPEEGEIRSALCLGEGTVISGLTGIT
FT                   TVTDFRMAEQAVGRQGAPLVALIDGLLLHHPTEWRICQNIGGIANLCVIPPDSEGGVDA
FT                   MVDWDCGPGNMFIDAAMRYFTNGEMEYDRDGEWGAQGTVNQAVVDNFLNNNKYCNQLPP
FT                   KTTGRETFGDNEAQEIIDECLALGMSKYDTVATITRITAQNIIKQYRTFFPKFNVDINK
FT                   IAAVYMCGGGAHNPNIINYLQEQLPSVAILKLDETGVPSDAKEAVSFAQQALEAILGRA
FT                   ALVPINSDTLTPNTISGKIAPGLRWREVMAMAVEFGKGRTRLPTVKEMVVDRPYTYGKP
FT                   "
FT   CDS_pept        join(347605..347843,347897..348013,348069..349065)
FT                   /codon_start=1
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274682"
FT                   /orf_name="AFUA_4G01310"
FT                   /product="DUF89 domain protein"
FT                   /protein_id="EAL84289.1"
FT                   /db_xref="HOGENOM:HBG054438"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000051F74C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F1"
FT                   /transl_table=1
FT                   /translation="MPSATMNAEEVRAVWTSDKGSMAQQTAETRWAKIIQGVIDDIGET
FT                   AGAQDVGCQKRAESIAIQIALKDIKTGIEQNKPLTPLPDDGKLDIQEWNKQLAAIGECS
FT                   WTNCPWLFGECYMYRSIQRMLNSSKHWQNYDVFKRQKDSTFVKSRAAVEELASRYMQIV
FT                   ADTRLAQDESKEAAQKLLFIEMTEIALWGNATDLSLLANLTLEDLQNLQGREAIQKSQR
FT                   NIVDNDTDDVWAYLQRTAGQTRRQIDIILDNAGFEFFTDVLYAAYLLEAGIATSIRLHT
FT                   KEFPWFVSDVIPSDVASLFEHLESSECFPVRKHLDQLVPRLRKLFQSAAITTTSDPFWT
FT                   TPFSFHEMPTKAPALFKELQNSYLVIFKGDLNYRKLTRDGLWPHTTTFETALGPLGKES
FT                   GVKILALRTNKSDVCVGIPTQSKVDALNEEAPDGAWIRNGKYAIVSFSEGQ"
FT   CDS_pept        join(complement(350997..351025),complement(350877..350905),
FT                   complement(350131..350823),complement(349600..350079),
FT                   complement(349443..349538),complement(349277..349376),
FT                   complement(349183..349228))
FT                   /codon_start=1
FT                   /gene_family="HOG000216742" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753598"
FT                   /orf_name="AFUA_4G01322"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84287.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054426"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51BDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F3"
FT                   /transl_table=1
FT                   /translation="MGKLRSKDGCLTCRKRHVKCDQVRPVCSQCQKKNRPCLREDPPSR
FT                   IRIKHYQPRTAREDSKDAPGNGPEQISHVLDQATADPVIANAASHEQIIRPPYAESCND
FT                   QYPTALVTSPYSTQTQTSTILPKLANESVPMPLVTSPGSIHAGTPLTHREAYLVHHFAT
FT                   HLGYWLDCTDASRQFTRKIPILVKQSPILLHAVLSYAARHVGDAELAEQAHERCVELLI
FT                   PSLSSEKVADDDILLCAIVILRVFEQLNVMVTGSDQERHLAGCSALLRASQGREVDPST
FT                   PGLRQAAFWVYLRQCLYNACIHQQAPNVDLVNLVLLAPPQGGGDPLSDLRSETAWANTM
FT                   TWICATVVHFCFGSSYPEPATRLLRWQQLSEAVESWLSNRPDTFNPIWYSEAVPGSGNP
FT                   FPEIWFTADWHIMAFGFYHLACMLLAIYKPSPRFAVRGLHSTAHPSHDARSRYLWGMQQ
FT                   LPFDGAIIDHALSFHLYMGSLDDRSSGKGRGH"
FT   CDS_pept        join(351462..351602,351669..352618,352673..352928,
FT                   352982..353230)
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274683"
FT                   /orf_name="AFUA_4G01340"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84286.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054418"
FT                   /db_xref="HOGENOM:HBG324430"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F743"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F4"
FT                   /transl_table=1
FT                   /translation="MMHRHFWKTVPGPRLLRLITVVSAVAISYEGMSQGVMGAVNVAPE
FT                   YGHRMGFADEQGKVIKPSLQGGIAAMYYLGALFGAFWAGSFSDAYGRIKGIWLACAWCL
FT                   VGAILQASAVNLAHMLCARVVAGVGVAFIIVIAPSWTAELAPAAHRGQMIAVTFLANFG
FT                   GIALSSWIGFATSFTDYAGGAFRWRFCFACQVIPIFFLVIGTLLIPESPRWLVKVGRND
FT                   EAFEIITKLRGDGDRAHPNVQKEIREIVAVVQMEHESQSSSYLQMFLGIGSGDIHIGRR
FT                   IQLAFWLQVLMQYGTGIAAVVIYSGNIYRTAGFDDFKSNWLSAVCMTCGILGTGIAALT
FT                   LDRVGRRWTLYWGAVVLSVILFTLGGLNRGAVNNPDKAEQYGTGAAAMVFLYVVVFSSS
FT                   WLMIPFIYPTEIFPTWLRAKGNAFGVAGWAVGYGAGSLLVPVMFAGIQEKTFYVFGAAM
FT                   FAYIPIIYCFFPETAGRTLEQIDFLFASKSPFVWEEEKEFAKRMTRFHAEIQKMEIENG
FT                   GYAGEKTGEEFVEV"
FT   CDS_pept        join(complement(354849..355459),complement(354670..354795),
FT                   complement(354533..354616),complement(353618..354476))
FT                   /codon_start=1
FT                   /gene_family="HOG000187498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905733"
FT                   /orf_name="AFUA_4G01350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="signal transducer activity"
FT                   /protein_id="EAL84285.2"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG054411"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI0000F51BD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F5"
FT                   /transl_table=1
FT                   /translation="MGSELGVTPDSKPEPVYSPVSIWWATWAGVWTVLVASGIAYLIAR
FT                   RDTPILRIRGLSLSLSAIILLHLYYTPVQFGTMIGPIMPGDAQFWIMGTFLPCGIALFH
FT                   ASNSRFLYVAKLQEKYVYNDLRHNFPPIQRRSGLLGRFKRLDYNTRVLVLVGIGMIAQI
FT                   MLTVIMWLISRKWHPTWGIPGTEVTGPKMAQLSAMGRGWEWWPSIFWQLFWAWIFAPIV
FT                   LWKSRNIRDTHGWRVQTIGCAIANLPGAPLWLISLYAPAFDKVNQVWLPPQWICLSILV
FT                   MEVFTVFLPCWEVMRHQVLQKETLDAIAQWEEKNKKNSSASKSLAETATLVESIMTGGK
FT                   STNGSVQTNHSRDSILTMGALEYALERDPAPLQRFSALSDFSGENIAFLTSVAEWKQSF
FT                   PKAIRENTAPRDSNTEDLIRERFNRALRIYAEFISVTHAEFPINISSQDLKKLQDVFER
FT                   PARILYGDEREVDPATPFDSFKPPASPTDSNSSQKELQSSVGAIHDRVQYWGDVPESFG
FT                   PNVFDDAQESIKYLVLTNTWPKFVKNRTASIGSGKTMHGTNV"
FT   CDS_pept        358663..360264
FT                   /codon_start=1
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905734"
FT                   /orf_name="AFUA_4G01360"
FT                   /product="MFS transporter of unkown specificity "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84284.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054404"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FE65"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F6"
FT                   /transl_table=1
FT                   /translation="MSLTEGSTMLGSRPSSKEEVDRPNDLMPGPGGAGEPDAGGPPSTF
FT                   SSTFQEAVFIFVIGLSQLFSVGGLGNAAFSVQEIGRSLNATSNGQMSWFLSAYSLCGGV
FT                   FVLVTGRLGDHFGHKYVFLFGWMWMALWSLVSGFAKDVILFDIARGMTGIGNGALVPNS
FT                   FALLARAFPAFSVKKNIAFAFLGFCAPSGYIFGGLIGAAFAEKVTWRWGFWFWAIGCLV
FT                   IGAVTYFIVPHSVGSPIPGLSIKQFDYLGSVLGISGLILFSFAWNQASVVGWEEPYVYA
FT                   LLIVGILLIVAFAFSQSRVQAPVLPNPLWTRKGFAPVVTAMSFGWMSFGIFLYYTTIYI
FT                   LTIHKAQPLTAVAQMVPLVIGGLFATASVGIFIAKVPAQYIFGVSMFSFFIGCLLMSFA
FT                   NYSSVYWAFIFPSCLLVVGGPDLSFASSGILISNAVLPEEQGIAGSFISTVVQYSISIG
FT                   LGIAATVEAHVNNGGQDIVRGYRGALWLGIGFAAVAFFIVVFFVRDTRFDKTENEKDAA
FT                   SSTDGAFETSIDKPNA"
FT   CDS_pept        join(complement(362611..362971),complement(362239..362558),
FT                   complement(361058..362185))
FT                   /codon_start=1
FT                   /gene_family="HOG000160714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905735"
FT                   /orf_name="AFUA_4G01370"
FT                   /product="Pyoverdine/dityrosine biosynthesis family protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84283.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054400"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI000052009D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F7"
FT                   /transl_table=1
FT                   /translation="MPYAGNLPTPTENKVSQIISIISAYRHRSAAVPDRFSEFAPALEK
FT                   QLTETVSKGEPVRFILPSFPFKAPAEGDKRKTLGSLPDKAEEIALQTLDAFADSIAEIH
FT                   QPGATVVIVSDASVYGDLLKIPDADAFAYHQELKKLAASLGLTHLEFVRPGTLAGIVPE
FT                   EAKTLEEYSDHVSKTRNLLDGTLAQAVDPNEDENMRATSKHYDTALPQAEDHEAFKAAM
FT                   LKRGKAYAKLIASSAESTIRLSIHESNNVGKITMNLFPPPTSPDFITPWHGAVAVLADA
FT                   SVRIVDASTVDRDRFEVITNHEGRPWLLREKSDLFDWFGMELDFEPLFPCGMQVRPKEG
FT                   YGPYRFEDVNMKLVRRLALSTAPLLLRGFTMQVEKEVFRSKARELGEIQMWPFGDILEV
FT                   RENADFNMNNVLTREAMPFHYDGVFKTVQDEKTGEWISVPPLFQMFRNRAASQSKGGLT
FT                   LFASSRNLIPLLGPDSIPLEELRKLQWETFTAANEAFGGHKLQLPFIITHPESGVDTFR
FT                   FHEPWPESKCVPGSSEPTLVRVVGWPLAESDALCEKLTRLLYDRRVAYRHQWKAGDFIF
FT                   NDNAMTHHTRTAFEDGHREHWRVHVN"
FT   CDS_pept        join(363627..363872,363925..364330,364384..364727)
FT                   /codon_start=1
FT                   /gene_family="HOG000068104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274684"
FT                   /orf_name="AFUA_4G01380"
FT                   /product="4-nitrophenylphosphatase, putative "
FT                   /EC_number="3.1.3.-"
FT                   /function="phosphatase activity"
FT                   /protein_id="EAL84282.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG054394"
FT                   /db_xref="HOGENOM:HBG646794"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniParc:UPI000051FE64"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F8"
FT                   /transl_table=1
FT                   /translation="MASSRKLSTPSDYAELLCRYDTWLFDCDGVIWSGDHATEGASKAI
FT                   DFLRDHGKRVVFVTNNAARSRKMLKTKFDRLRIAASEDEIVSSSFAAAVYLKEVLKFPA
FT                   DRKVFVMGMEGVEAELDAVHIKRCGGTGPEDNKFLAANDYSSLAGEEAIDPSVGAVVCG
FT                   FDMHMNYGKLCKAFKYLTRDGAQGPVLAGETGGGCHFILTNDDKVVPALGELWPGAGSL
FT                   VTPLIASTKRNPIVIGKPHAPMLDTVKSLYNIDPTRTIFVGDNLYTDILFAREGRVDSL
FT                   LVLTGVTKEEDCQTEGIWPTFIAPSISNIVAAESGPSIIADGTSTIHASL"
FT   CDS_pept        join(366188..366307,366382..366488,366557..366986,
FT                   367046..367443,367497..368901)
FT                   /codon_start=1
FT                   /gene_family="HOG000178543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210312"
FT                   /orf_name="AFUA_4G01392"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27171.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51C0A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA91"
FT                   /transl_table=1
FT                   /translation="MVDATHSTAPVGSDTGVRKFTLSCSRCRASKLKCDRKEPCMECVK
FT                   RNIGHLCTKDERQPRAKRSKIENKDKTPSKRDPPPNGDGEAEAEETAQLLEHFVEGVPR
FT                   PNAYRPAVLGPTPSSVAPDFPNPYWSSNDPKRHGEKLALIREIVDAMPTVEIIDALLEV
FT                   FITRCQGPLGNVVHTPTFLKQAQQFSNCLKLASLDSRVLAVSSTVPMEKLGGYLLALVL
FT                   GLAFHPTPSLLGWTPTPLTLRVEELRASEMHSKTWRSLGLRCLQDGVSLFCGSIASLQA
FT                   AIMLLLDGQENSLALDAVLVTAISGARKLGLHRLGGIKLDASASPVASLENDPAALVEP
FT                   DHIRTEIAIRIWWALVLRDWSRGQALGYYTIHPSQFNTRMPLHINDDDLCPSAWRVTVN
FT                   GEITERPRSEFTMMSYTVHALELAGIVRESIDLRGAPTQQPDGTAESAKLRRHINNKYE
FT                   KYIATLPSYFRLGSTVGLTATGPMAAIPVQRWMLHQQLWSLLLRLHRADLSSPISRASC
FT                   QLLAQNIVSTQAQIQARCAVCGSLSTSETQLFNAAVVLLLDLLFSSKQGDGDSASAHLS
FT                   RLMTRDKIREAIELLRTKSLMEGSSLHDLHLEQVKGSAQRSVVALEALMKLEEGDFDHN
FT                   GTNSSNSAAGNRTREPLAAKDSLRLRITDILRALSGRADPEGAPVQEPQAPMDPLSPFQ
FT                   VSMPFANVPDGFHDLDVLPILSNGLSPNFWQFLDFPPPPFDSHPKEVSLATQGDPPGAF
FT                   GLGPSQFPDSYSSTPSTRMTHTSPSLQSESIGLGGGSDSATTPSSADAYVAAKFYYAMG
FT                   DGTLAPM"
FT   CDS_pept        join(complement(369512..369944),complement(369123..369442))
FT                   /codon_start=1
FT                   /gene_family="HOG000063193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274685"
FT                   /orf_name="AFUA_4G01400"
FT                   /product="ThiJ/PfpI family protein "
FT                   /protein_id="EAL84279.2"
FT                   /db_xref="HOGENOM:HBG051612"
FT                   /db_xref="HOGENOM:HBG695952"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0000F51C0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G1"
FT                   /transl_table=1
FT                   /translation="MPTQHRILALVYNEFEALDLFGPLGAIVPRSDYYTLALVSLHNLD
FT                   SPHGVETSMKNGIGVIPTLSLAEALREDQQFDTLFIPGGFGMMPLVWDPILLQRIGQLV
FT                   DRAPNVFSVCTGSILLAATGRLDGRKATTNKRLYDELTPKHPGVQWQKRARWVQDGKFL
FT                   TSSGVTAGIDAGFAFLASTYVAPEDRQAHPEAQKASLQGDETPIPGFNKEKALRHAHFI
FT                   AFGLEYRWHSDPADDPFVDLPEQTAART"
FT   CDS_pept        371597..372460
FT                   /codon_start=1
FT                   /gene_family="HOG000178532" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210313"
FT                   /orf_name="AFUA_4G01410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84278.1"
FT                   /db_xref="HOGENOM:HBG054365"
FT                   /db_xref="UniParc:UPI000051F9B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G2"
FT                   /transl_table=1
FT                   /translation="MQCARSGSSTPMGRDPDARWVQWLALTRRNNHAPLSGAMSPSSSP
FT                   SLPMASSNLNYSSRVHSRSSATSYFALMSAAKDGHQHQHQREEDRKQHYYNGSGTPTRR
FT                   HMDTSWVAWLNEHGHQRCQGGRCPSETPGQLQQPQTCLPDSIVMPSSFLDTPPFTTNTP
FT                   PSMISSSATELPSPLAPLTDAEIDAMSQQFPDFADRFPAEFSDATTAMGPFDPAELDAG
FT                   LLTWLDEQHSFAFHQGEDVAVSPSKRSLTLETYPREMSADGTRREGGIKKQKVYHETYT
FT                   EPGKSA"
FT   CDS_pept        complement(373174..374814)
FT                   /codon_start=1
FT                   /gene_family="HOG000178521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753599"
FT                   /orf_name="AFUA_4G01420"
FT                   /product="Spore wall assembly protein Dit1, putative "
FT                   /protein_id="EAL84277.1"
FT                   /db_xref="HOGENOM:HBG054359"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI00005202DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G3"
FT                   /transl_table=1
FT                   /translation="MLSNTITIVPSIETRVVEPLPQFDTSRRLSFPVSLPLDSLAGARK
FT                   KAANEALVERIAEIIASYRISGPDDRYEVVYKPKLLDTLRYFVSKQEPVNMVVPAYPFK
FT                   SPNRDEKVLGPDPDVGERMSLEHFNSMGARIQQIYPPGGYVTIVSDGCCYNDLLGVSDE
FT                   EVFRYAEGLHRIVDRLGLKHIKFSDPFDLIEGRHNVPVTEEEYASRIGELKDYLFRSYH
FT                   PDGYDFDEELSKDPNAALTYRGYIRFLMSDLALFFKERQMSKNAIKKHCSTVARSMIKR
FT                   GKAFSALVARASPLHVRLSIHASDNTGKLSVALLPHKRYSTFPVTPWHNTPYLDTTSVS
FT                   LSLSRKPTDGATPYRLCQDELGLHFLCADVPMYRVIETPDLPALAQQVQFQPLYPFGLR
FT                   IKVPRGTPIGQFRLERVAELAKVHSPIIFEGLDPMEYTAAIADDFQRVAGGTMSLSILH
FT                   EGVATTANTARHLGGSAAASYFLQISAATGDDAQPALLPFLAAAAALDDVRYRVLHHWQ
FT                   AGHAVVSDHRVALPVHLSPSSLRVLHGGV"
FT   CDS_pept        join(374980..375107,375158..375326)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274686"
FT                   /orf_name="AFUA_4G01430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84276.1"
FT                   /db_xref="HOGENOM:HBG054353"
FT                   /db_xref="UniParc:UPI000051F25A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G4"
FT                   /transl_table=1
FT                   /translation="MYVQHTGLRPSSTNHWRYSTHGIRPPRKGLAPKHRRTSLRPSRRT
FT                   GSQRWSRWRLIEARSVAPTCKRGDYIDYIATAWIGWITVTVVRGFRLPWVKTQ"
FT   CDS_pept        join(complement(376585..376615),complement(376310..376533),
FT                   complement(375829..376266))
FT                   /codon_start=1
FT                   /gene_family="HOG000125752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274687"
FT                   /orf_name="AFUA_4G01440"
FT                   /product="Glutathione S-transferase family protein "
FT                   /function="transferase activity"
FT                   /protein_id="EAL84275.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG054344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051E695"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G5"
FT                   /transl_table=1
FT                   /translation="MAPFTLYTHAGPGPNPVKVAMALEHLGLDYDCIPLAFGEGKGTVK
FT                   DPEYTSKVNPNGRVPGLIDHENNDFTVFESAAILQYLAEKTIQYDTSGKLAGSTPEERA
FT                   TVNKWLAWQVSGLGPYQGQLVWFLAFHEGAHGEKPNGSVIARYQAEVERLRSVLEKHLA
FT                   SAENGFVALGRLTIADFAILPWLKISVLAGSALKSFEEYPAINAYIKKLDALPEVQAAY
FT                   KKAVPPMQ"
FT   CDS_pept        join(complement(378920..378960),complement(378444..378870),
FT                   complement(378126..378384),complement(377634..378073))
FT                   /codon_start=1
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210314"
FT                   /orf_name="AFUA_4G01450"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="EAL84274.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG054336"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000052009C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G6"
FT                   /transl_table=1
FT                   /translation="MLATPGVISRGPEVPHTRPHLLAGSIVPEPSSPLKDSNVAAYEPL
FT                   IPPALLLHEFPVTPASRRTIESARQGAARIIQRNGDDRLLVIVGPCSIHDTDVARDYAV
FT                   RLQAAIQEHGWDKDLLIVMRAYLEKPRTTVGWKGFLYDPNIDSTNQVNMGLKVARKLLL
FT                   DITALGLPVACEVLDTISPQFLADLYSWGAVGARTTESQVHRQLVSGLSFPIGFKNGSS
FT                   GNITNACDAMKSASSPHSFLGVTEQGLAAIVHTKGNPHLHVIHRGGDSGPNFDAASVAS
FT                   TIKAYPKNLQPSIMIDASHGNSQKDYRNQPKVIDAVASQIAAGEPAITGVMIESNINEG
FT                   KQAAPQSEDEVQKLKYGVSITDGCVGFETTVKMLETLSQVRETVLYKD"
FT   CDS_pept        379597..381765
FT                   /codon_start=1
FT                   /gene_family="HOG000178509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905736"
FT                   /orf_name="AFUA_4G01460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84273.1"
FT                   /db_xref="HOGENOM:HBG054327"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="UniParc:UPI000051EFED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G7"
FT                   /transl_table=1
FT                   /translation="MTSHHPAANNPSPTSRVQSSVIQSSLTSVTTKMTVTKPTPKHTFA
FT                   ERAAANNLNDAQILNSNNPAGADIPEKSDVVVAGGGIHGLIYAIHAAKYKPGKLNISLI
FT                   EKGTKPGYKIGESTLPLFSLWCKMHGLTAEYMLRLFGLKDGLCFYFLDRENQGHYTDFC
FT                   SNGTPGLFLSGFQIERPISELLFTLLAQRSGVNVFHGRQVDFNGSTIRGGFQNNRVAIN
FT                   PGKFDGKPATTIDSSLLVDATGRFRQLASKKASLHRFEGWNYDAFWGYFTAPKDESNIP
FT                   FRYYEGDHTNHLCFPEGWAWVIRLPSWEGSPIPNLMDMISYLLDCAEAGVPGDQIPSSE
FT                   ELAKMFDLKFRWVTSIGFAVRNDVKYPEDMSAYGTREAERKFNYFVEKYDLIKKFMSNF
FT                   ELVENLYGPGTTWYIRKSLTYQSPVVSGPGWLAVGDACGFTNPLHSPGITAAMSTSTYA
FT                   AELTHTALEEAQRAADAEAAELSIRKTLAPYDDFAKRLIPALNQMNKFNYVCFREPRLG
FT                   PQVSCLWQFFAGIGIPGWQLIRQDYNLNFETYVPHSINWAWGSMVPEYDAVARKAIELI
FT                   APIPLEGSVPDATVREVIEFSNSVKRVAVDSNRFNFRWDGLLRYYDIFLNYDEKKNWKD
FT                   VFSRQCKGCGAWLVCRPDWRKCYSCGKERTEEEAAITWNPPLAVDEVKALVRASDAKPA
FT                   SRAAKEGAVQEQLKDRTVVVSHAVEITV"
FT   CDS_pept        join(complement(384201..384448),complement(383936..384150),
FT                   complement(383789..383889),complement(382033..383730))
FT                   /codon_start=1
FT                   /gene_family="HOG000178498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059010"
FT                   /orf_name="AFUA_4G01470"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84272.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054318"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051EFEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G8"
FT                   /transl_table=1
FT                   /translation="MTVQASSPNPVSELEPLGKPNPPAPAGQSQPNPPPKKGKDKKIFS
FT                   CHSCRRRKLKCDRFDPCGACQARGEGHLCTWEEGQRPERNHRESLEQLPKLILKLTAEV
FT                   QELKTSNSALVENIRNNGKELAESLDLTPLDSRPPSHLRSGSSSAGYISWDLSCRIPDH
FT                   QQWTPSQLLALLPESQLLWGLISHYISASASLTSFIDVHQLVRDVEEVQHLRQGLDLSS
FT                   SSALLGHLDIKVSMILACASLAAVDLDPGKAQELGLANTDIDALVRDLWKGSRTLISRS
FT                   DLDPLLPTSKAVLSEGRAAPSLEASNDLLQQSGARIAAATDIQVQVVSIRILLLLAARS
FT                   FAAPSEYLKLHLDVISSAIDASLDSPYDEGTHLIDREWRWQLWSFICLLDWTSPGIYHT
FT                   SSYFIRPEMHRGPPSKVPGLPDHGSYPSAIEKVHWDRLSQTRHYLEYALALAHLSRRAE
FT                   DCIVRPGPVSPAQAAELCTELDALDNKLSFYQLLGSTAPDGGTFSTGGRPVDATSITGD
FT                   LATDKASTEHRRFLARAPVIQSMHLSLELGLIRFKLFRHEVFHLMQAPSTSGTLRMICM
FT                   DACMDACILVLAQCWSIGDRDVPGVQAQAQAQSQMSLDPSEEKRPCTGSLRRVLQPASS
FT                   AALVGQVLLHAAQGVDGMGMGSGNGKQCQGNGAVGSRGLSATEFFTFVEGGGEFATTSG
FT                   TVSGQGPYTAAGGSWSGRMIREKVKVLQWHVSKVLTLLEALQGTSPLARYKMSLHQQCM
FT                   "
FT   CDS_pept        join(complement(391541..391753),complement(391222..391478),
FT                   complement(390714..391142),complement(390086..390644))
FT                   /codon_start=1
FT                   /gene_family="HOG000048695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274688"
FT                   /orf_name="AFUA_4G01480"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84271.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054307"
FT                   /db_xref="HOGENOM:HBG324375"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51BF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G9"
FT                   /transl_table=1
FT                   /translation="MRHHGLPLLPNPTQDERDPLRWPVWLKRCAIVTTSMTNFVTNMAG
FT                   AGLSVAVPELIQEYHKPESAVVQLLTYNFLFLSIGNIFWVPIAHKFGKRASLLLSMALQ
FT                   AGALVWSVAATSFSSLLAARCVQGFAGAAGESIVPEIAADIFFLHQRAAMMSIYVILIS
FT                   SGSSIGPLVSSLMVQYLPTSWRAFMWLCFALAVADIGLMLFLFPESNFRRPEWDVPAIQ
FT                   LEVTETKAAQEMVEHASPEVVYTVHRPPFVDIIVPVRLDRELNLFRAIVMPLRLLTRPA
FT                   VIWVILLYGCALSPQIILIFTMSSLLQAPPYLFSSVSVGLMHIAALIGFILACFGGGWL
FT                   SDLINSRIARRRADGKVRAEDRLLSLIPGMAIGPVGCVVLAFACQNHLHWTAIAVGFGM
FT                   VSFGTVYSPNIAITYLAHWHQKDAAQCLVLVNVVKNLVAFTFLYKAVEWAESQGYLQLY
FT                   LVMFALGFVTIGAALPLYLFHGKRRVE"
FT   CDS_pept        join(complement(393621..393900),complement(393390..393526),
FT                   complement(392967..393336),complement(392793..392899))
FT                   /codon_start=1
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274689"
FT                   /orf_name="AFUA_4G01490"
FT                   /product="Fumarylacetoacetate hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84270.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054296"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI000051EB26"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H0"
FT                   /transl_table=1
FT                   /translation="MSLPWKRLIRFRTLDGRILRGEPILPAESTIDLGFVTDADQLQAR
FT                   VIQGQDIYNTTGETKVTDEIVTVKQILSPLAPSDVPIIRCVGLNYAKHIKEAGRKPPPF
FT                   PFIFFKPNTCVHDHGEPVVIPRIAQNDQADYEGELCLVIGKDAKDVPVERALEYVAAYT
FT                   AGNDISSRKLQRDPAYAGTVPQWGFSKGFDTFAPLGPVLVAASEIPDPSQLHLRTIIDG
FT                   EVRQDETVADLLFDCRYLISYLSQGTTLQKGSVIMTGTPGGVGASLNPPKWLIPGTQMD
FT                   VHISQIGTLRNQVVYA"
FT   CDS_pept        join(394292..394474,394522..394645,394711..395087,
FT                   395147..395284,395350..396024)
FT                   /codon_start=1
FT                   /gene_family="HOG000254835" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210315"
FT                   /orf_name="AFUA_4G01500"
FT                   /product="Lignostilbene dioxygenase, putative "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL84269.2"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG054214"
FT                   /db_xref="HOGENOM:HBG559594"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniParc:UPI0000F51C0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H1"
FT                   /transl_table=1
FT                   /translation="MSEMRTHFPDRPQFSGFMKPCRVEGDISQLEVYGEIPKEIDGVFY
FT                   RVMPDPQLPPFIENDPWFNGDGNVTAFRIQDGRASFRQRYVRTEKFMRERKAQRALLGK
FT                   YRNKFTDAVEFRVRSTANTNVVFFNGQLLALKEDSPPYAMDPITLETKGLYDFEGQLPA
FT                   LTFTAHPKFDPVTGEMVCFGYEARGDGTPDVCYYRVSPTGQFKEVVWLVAPVVAMIHDF
FT                   AVTDNWVVFPIIPQVCDIERMKQGGEHWQWSPETPLYLGVIPRRGAKGEDVKWFQYKNS
FT                   FPGHTANAYEDKEGHLVIDLGLSEKNVFFWWPDAQGNAPEPSSIHSQLVRFTLNPHAED
FT                   LALPEPKILHQGNSEFYRIDDRFATHSYRHCYFDLMDPQLGTDFERIRPNLGGGYPLYN
FT                   SLAHFDNATGQTEVYFPGNTHLVQEPVFIPRKDSTTEGDGWVLALVNNYATMASELHLL
FT                   DTRDFTHAQAKILLPIRLRHGLHGSWVDGRDIGSQTEQLQ"
FT   CDS_pept        join(complement(398776..398850),complement(398582..398682),
FT                   complement(398252..398511),complement(397720..398220),
FT                   complement(397469..397661),complement(397261..397365),
FT                   complement(396691..397181),complement(396406..396615),
FT                   complement(396214..396350))
FT                   /codon_start=1
FT                   /gene_family="HOG000048696" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274690"
FT                   /orf_name="AFUA_4G01510"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84268.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054104"
FT                   /db_xref="HOGENOM:HBG324847"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F74B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H2"
FT                   /transl_table=1
FT                   /translation="METPSDQLSLQGPPGKRRRVALACDCDGIRPQCSMCKDLGFECAY
FT                   TPPVTATNVIVQKDYLKDLESRVKSLEENLTTVQSNLSGLAAQITGRSPPSEGPPEPCQ
FT                   EPLADLAESEDPIDAMGAVTFADEEDCGYFGEDDSSPVCPTRPSSNIAFLRHLSRAVSH
FT                   RKISQKEINTPLIDQTAYDGGVVSATRPPSPLSGCTPTSGQPGLVTNLALPSSEETLQL
FT                   IRRYFYETGLLFPYIHPPTFLEAYDEFKNNAKKVRRTWLGLLSIMLAMAKVTAVSGHAP
FT                   AESRIKESTVYYRQALNLCRGEMLRGTTLEVVQYLLLMGQYLQGTQKSVQAWTVHGLAV
FT                   KAALQLGLHSKDASQAFSPLERETRKRIWFGCVVLDRYVQLDLPVVDSVGEGEPFVDDK
FT                   TIRHSIQFFNSTITLYKQMGSIIDQVYGQNLGCGSGPSVGETVGRVLLIENQLFSWVMA
FT                   LPENLRLLTLQGLHEEISKSENQPGPFFSLKFRVILTLRYLHTQILLHRPILVKFLDAS
FT                   LPSGLEPGQERILNEIGHSSMNKCVESAMGIIDIIHELVFATGRQRDLLGAWWYSLYYT
FT                   FNAALVIIGATWVQRARQSAHDSPVHQSTNIQPYPSRAVATLYRLDTGNRMVDRCRYYL
FT                   EQLISVLHLQPDDLAGTAISSVTPGFDFLSFGMECGEFMLDDFFTNITHASVLER"
FT   CDS_pept        join(complement(402210..402465),complement(401321..402132))
FT                   /codon_start=1
FT                   /gene_family="HOG000173721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274691"
FT                   /orf_name="AFUA_4G01520"
FT                   /product="Gentisate 1,2-dioxygenase, putative "
FT                   /EC_number="1.13.11.-"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84267.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053994"
FT                   /db_xref="HOGENOM:HBG339770"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051F255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H3"
FT                   /transl_table=1
FT                   /translation="MAPSMIDTPPQSADSAAQLLQDLEASKTLPLWTQMTRLNPPEPNP
FT                   TAVPFVWKYDSIRPNLLRAGHLVTEKQAERRVLMLVNPARDAPYTTDTLYAGLQLVMPN
FT                   ETAPAHRHTAFAMRYIIEGNGGFTAVHGRRIRMQKGDVILTPTWNYHDHGKDGSGPMIW
FT                   LDGLDLPTFRHFPVHFVEHFSEPRYPAEDVDTSSSPIVFPWDRMKARLDETEGNWATQR
FT                   YLKDDGREGKPASGAMRSFLHIGLTEGGGKRSVSRVLGGCAERLNAGTSSPRRQDTLSA
FT                   VYHVITGKGCSEVGDQTLEWKAGDTFCVPSWHAYQHFADPGETVYLYRFDDKPMITALG
FT                   FYRSAEDDSEELISD"
FT   CDS_pept        join(402807..402857,402955..403480,403537..403693,
FT                   403762..403917,403975..404114,404171..404547)
FT                   /codon_start=1
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753600"
FT                   /orf_name="AFUA_4G01530"
FT                   /product="Salicylate hydroxylase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84265.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054944"
FT                   /db_xref="HOGENOM:HBG321923"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000051F742"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H5"
FT                   /transl_table=1
FT                   /translation="MVSREGPGAAPNHPSLTFAKTLEGALPDVPKPTGNVGLNILLVGA
FT                   GLGGLATAIALTQAGHKVTIYEQTPMLGEVGAGIQIPSNSTRILFKLGLEPYLKPYVTE
FT                   PESISFRRWQNGAVIGKTRLLPDFIDNFQAPYYVIHRADFHSALCRKANDMGIDIRLGA
FT                   RVVDYDPVLGSITLKDGTSHRGDLVVAADGIKSVARKVVLNGEDMPFIKPGFAAYRAVV
FT                   DVNQMRNDPEVSWILERPALNVWIGDSRHVMTYTIGAGNAFNMVLSHRDTSDPATWDKQ
FT                   TALQDMKAEFQGWDPVLTKIIGMVEKTIKWPLMSGSLLTRWTRGKLVILGDAAHAMLPY
FT                   MSQGAAMAVEDGVALARSLSHMQSPEQLSKALAIFEKVRIVRASQMQEASLLNGQLWHF
FT                   ADGPLQEARDAAMAREVKGLPFSHSPNQWSDPATQMWCYGYEAEREIDRAWTDIEVVSE
FT                   RAESRYCSML"
FT   CDS_pept        join(405158..405370,405430..406107,406164..406736)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274692"
FT                   /orf_name="AFUA_4G01550"
FT                   /product="Aldehyde dehydrogenase, putative "
FT                   /EC_number="1.2.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84264.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054833"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051E8DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H6"
FT                   /transl_table=1
FT                   /translation="MSTIPLIVDGRDVLSPVQGTVVNEYAQEPVLYQSATKELALQAAQ
FT                   SSAQAFASWSKTTPIERRTLLFKLAQVLRNRAKEIKRVCDEEIHCGPRWAEIITNDAIG
FT                   LIEEYGALTTSIATGSLPFIQHGHGLVLKEPLGVVLGIAPWNAPMILGLRAVVAPIAAG
FT                   NVAILKACALRQADAEREIVSGLNISQGSELSPQTHYLVASLFQEAGFPPGVLNFLLYR
FT                   PQDAPDIFDVLINHPAIKKCNFTGSTQVGRIIASQAALALKPVLLELGGKNFAVVLDDA
FT                   DLDLAAREITKGAFLNNGQICMSTDLVLVTTAVASALEDKILAILQDINTPSVLISPAA
FT                   KSKVEMLVSDAHDRGAQIHAHPMGHDASPRSFPPTVVTGLTPEMKLYEIESFAPVVGIM
FT                   AVEREEQFMAIIEAAKYGLSSSIFSRNHYRSLDLAGTIKAGAVHINSMTVHDEPTLPHG
FT                   GYGDSGWGRFGARWGLEEFIQTKIVTLHP"
FT   CDS_pept        join(415070..416049,416102..416369,416417..416755,
FT                   416805..417140)
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274693"
FT                   /orf_name="AFUA_4G01560"
FT                   /product="MFS myo-inositol transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84263.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054723"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F4D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H7"
FT                   /transl_table=1
FT                   /translation="MVEKSSDPEVPSLSHHESSISIEKQGDAATAREWAQDVNSTTTNT
FT                   KLKNPLAGLTREQLLNDVEAFAKEKDLEHILDDLRKGALVAQDPREFEQMDALTESEKE
FT                   LLRREKTHRWSQPFMMYFMTSESSRYPPTEFGFNPACQSSVLDLLSCREWIRLLSTVRR
FT                   SMYSSITHLSYAKQSRFYFAEFNVTDTWMQGLLNGAPYLCSAVIGCWTTAPLNRWFGRR
FT                   GCIFISCFISFASSFWMAAAHTWWNLLLGRFLLGFAVGAKSTTTPVYGAECSPANIRGA
FT                   LVMMWQMWTAFGIMLGYIASVAFMDVTHPTIPGFNWRLMLGSTAIPPFFVCIQVYFCPE
FT                   SPRWYMMRNRYHDAYKALCKFRPSTFQAARDLYYIHAALKVEEKLREGKHLFREMFTIP
FT                   RNRRAAQSSFFVMFMQQFCGVNAIMYYSSSMFREAGFDTRMALITSLGCGITNWIFALP
FT                   AVYTIDTFGRRNLLLTTFPLMCIFLLFTGFSFYIPDQTSRTACVATGIYLFMIVYSPGE
FT                   GPVPFTYSAEAFPLYIRDIGMSFATATTWGFNFIVSLTWPSLNKSFTPTGAFGWYAAWN
FT                   FFGWIFCYFCLPETKALSLEELDQVFSVPTTKHVNHYRAMLPWYVKKYLLRRDVPPQNQ
FT                   LYDYY"
FT   CDS_pept        join(417904..418091,418717..419116,419162..419359,
FT                   420051..420212)
FT                   /codon_start=1
FT                   /gene_family="HOG000048697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210316"
FT                   /orf_name="AFUA_4G01570"
FT                   /product="Amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84262.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054612"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00005202E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H8"
FT                   /transl_table=1
FT                   /translation="MGSMHEAGSRPAAGADMDTDRVHPEAVSDNERDFEKQDSKPEYQD
FT                   AFGDEEYAEVKYKTLSWCVFSAVLIVMIAVGVQRPWHGGLNATVDTNLYKAFLAVCNIV
FT                   FSFCRLFLHFSSFMDRTNKTAGHVAFFGFMAELRNPRDYPKSLFLLQGIDTCLYIIAAV
FT                   VIYCYAGDDVTSPALGSASTIVKKVAYGIALPTIIIGGVVNGHVACKYIYVRMWRHSDR
FT                   MHKRDLVATGSWVLIGLATWIVAWIIAEAIPVFNNLLSLVREVLVVICTMIWERVLIAP
FT                   SVTAFRQPGTPDQPTEHLFPLALFVATRDPRSIG"
FT   CDS_pept        join(complement(426335..427264),complement(426054..426287),
FT                   complement(425681..426002),complement(423876..425634),
FT                   complement(422831..423840),complement(421735..422771))
FT                   /codon_start=1
FT                   /gene_family="HOG000199956" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274694"
FT                   /orf_name="AFUA_4G01580"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL84261.1"
FT                   /db_xref="HOGENOM:HBG054502"
FT                   /db_xref="HOGENOM:HBG324435"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F4D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H9"
FT                   /transl_table=1
FT                   /translation="MADSYTLPAVPAKHSTFIDYINSRPHESIPDLVRAYNEYDAVLRK
FT                   IYAQQPSHPAIANKLINLVPLFDGSGSADLRIRARDLASEPEELKAKYLMPLKDEDRKA
FT                   HGSPAVVSSFKQFQTNFNLFSESALSDLDWSNVVAAGSAVTTSLLPVPEEYRDSKRGLR
FT                   EYYHQKFAPASDVDLFLYGLTEEQAIEKIKQIETRIKDSILAETSTIRTKNAITIVSQY
FT                   PTRHVQIVLRIYKSIAEILTGFDVDCSCAAYDGSQVYLAPRAVGAFVTQINHVDLSRRS
FT                   PSYENRLSKYARRGFEVFWPLLDRTRIDPTIFERSFTRTRGLARLLVLEKLPKPSDRDA
FT                   YIDKRRRERGRPVPMRISKQLRGNIKNDWDDEVPEWVDEEDVSDYHTFTIPYGERFHAR
FT                   KIEKLLYTKDLLLNAEWNKPKDREVNLHRHPAFFGNFEDVIEDCCGFCPVPITPDEKEL
FT                   AEEESKIYVSGRIKFLQDNPGRQEIGSFNPITETDWTDMAYVGNTAGLCQAIVDNDVEG
FT                   VKQWLSPDFDVNRRDFTGRTPLHLAVMTSTPEIVQCLVDHGARLVARLADGRTALHLAA
FT                   ARGHVEIIRILLTKSEENEDEEARKEQARKGVSSGKEAHDGEEDAELIQHPSAESEADA
FT                   QSFATDSFVKVHKDANSAQDSVPDDSSDQDPDVYDINVIAWDSHASPLHLAILNGHIAA
FT                   VEELVSSFGADVLLPVKLLHEYNNSPRAAILTLVLALQLPIEQAKAMTTKLLQLGASPA
FT                   QADLDQKTAVAHIAALPKYTELLDSYLQHDRPAVERALNYIATSGWQFSPNAETALKTA
FT                   IKSGNVIGALKLLDAGASPTIAFDEFIKSAQVHIDGIRNNSSEQVKRRFDASVTQPIIL
FT                   SVLKDQPSVAPKLLARGADPNTLTKEGHQIQHEVHARAYRHGKSLLDCVREKLNALRAY
FT                   EPETDSPEPPRPLEHEDSYYLSPFREDTYQLWTAKAALRSAHSSLESEQKRYDDDVKCA
FT                   ANRKGVDEKKAAVQLTLGEFEKLEEELLARGAKEFKQLFPDIRTPSDNDGNHYGSCATK
FT                   SESFRVTFDFRRPDLNDITREGYIQLSVLLRFLPFEAAWCGDLETIKSLTLGTWGPDKQ
FT                   RPPLEIATKDQRNFHPFNIAVLRGHLDVAKAILAIAQVQYKPQDEQANVRYRLRATTNH
FT                   DDGCSSDDEGDEDDNDNSDGLDIERQILDEKFTIDNIGEVKTQVESRTPPLSLLEDCCS
FT                   AEDFIETSLPEDRKPYNLVQYAICKDDVRLLVFLLDLGRELSAKSGSSEQTIFTVGQRD
FT                   LTVAMQLGRVRCLAELIKRTGAGIQLDKLAEQSGVEIKEKPKYYQGLSIHGKKRADWAA
FT                   AGRGILPVQPEEGKPPLLVAAREGNLETVEWFLGTAPGRYYMEFTECHQRDKRVKRLTM
FT                   GKLGVERSITNWLNRRRDLVLHCALFAKPTAESERLVKYLVQHVPHCLEVKSVDGYTPL
FT                   MIAFSLVRPTYAKILIKAGADQTVRDKKGCNILHHLFCGVSSPSVERLDDFQKMLGLVD
FT                   PSLVSSLLVERSSHGPGSLTPLAMWMMRALNTTNTYSVYGNGSNYEGDNQMETLRIILD
FT                   FAQSTGQKHLELLNGAGNSIMHDAVRCQLLKTLEILFERRPDLLHRENASGLTPAEVAE
FT                   ASWVTEVTSNPPGWERRYRFTYSSQYGESLVDRRPESFVEEGDEAPTMKRRIYDFCRSK
FT                   AETLREPDAKRRLVTLFEANEVARRLVAKDLQENQNFGGAARRRRWDKHDEREFGDEVR
FT                   EWLPEVF"
FT   tRNA            428717..428797
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        430010..430891
FT                   /codon_start=1
FT                   /gene_family="HOG000048698" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274695"
FT                   /orf_name="AFUA_4G01590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84260.1"
FT                   /db_xref="HOGENOM:HBG054425"
FT                   /db_xref="UniParc:UPI000051ED64"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I0"
FT                   /transl_table=1
FT                   /translation="MVAVMNQLTDLPNWYIDIFDDAIVAYWRQNPDLASIVTNPLLSDR
FT                   AWDWCLHELRDKAEEYQRQRHVRVLDTGSCICKSDDVPGLPNGTGALADEIRPAVKTVL
FT                   QKWSKSGWLDWRSKQRLSIIDPMLFPLVYGRSLVLTDRGRVELEDVFGAYSVATTIAPM
FT                   HVDLRTDAAAVQKRLEEAQRLHMGVSCDTETSTHYRWSANHQALPCEVEFVGDKGSTQV
FT                   RITSYINNLHPAHQDIYCAIETLVGRAIPLWNDCLVQGQSGWTDVLNQGHLGPVPLRII
FT                   TYGAEWENELPE"
FT   CDS_pept        430983..432161
FT                   /codon_start=1
FT                   /gene_family="HOG000048699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905737"
FT                   /orf_name="AFUA_4G01600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84259.1"
FT                   /db_xref="HOGENOM:HBG054358"
FT                   /db_xref="UniParc:UPI0000520533"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I1"
FT                   /transl_table=1
FT                   /translation="MRADENAERCEDYLRDLLMWRETKTRSYLLQIPTSGNARKNIFSS
FT                   QKMDRPPLFQSQTTGSNLPGSISKTSCGDYCTSAIRNQGPRFPTINGRRAVIMTRPWSI
FT                   WSASGKIGIRSRPPRITPPPHKYYTIQLQDKFREHGLQIIVKMENIELTPDSGSYKGTD
FT                   WRIEGQLNEHLVAAAVFAYDVANITEPRIAFRQNTKLDERFYRCSEDREQRRKVHPRHD
FT                   VPAQQCGKYGSTEFAAVAEILGFSTADLDPCCNHAVKTWQDKGTVRVLQGRLVTFPNLL
FT                   EHRYEPFALADPSRPGCFRFIVLYLVDPHYRVCSTRNVPPQQHHWWAESVSHNLAAAGL
FT                   PQEIVDEIMQGTGSWPMGLPEARRHRREFLKEHRWNNLVRIYCMRRPSFDCY"
FT   mobile_element  complement(434012..435187)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  complement(434983..436116)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   rRNA            complement(435398..442458)
FT                   /gene_name="28S_rRNA"
FT   mobile_element  complement(436088..436471)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  complement(436492..437094)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   rRNA            complement(442645..444442)
FT                   /gene_name="18S_rRNA"
FT   gap             446216..704815
FT                   /estimated_length="258600"
FT   tRNA            complement(705537..705624)
FT                   /gene_name="tRNA-Pro"
FT   rRNA            complement(707763..712726)
FT                   /gene_name="28S_rRNA"
FT   mobile_element  713051..714577
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  714869..715594
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  718139..721678
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   tRNA            complement(722398..722485)
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        join(727877..728047,728172..729563)
FT                   /codon_start=1
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19059011"
FT                   /orf_name="AFUA_4G02650"
FT                   /product="MFS alpha-glucoside transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84413.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG189941"
FT                   /db_xref="HOGENOM:HBG327484"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F8BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA50"
FT                   /transl_table=1
FT                   /translation="MSGTMAMTEKGRASIRACTLGDTQQSLEFTNDEHSLTFWVALRQH
FT                   WPAAAWGLFMNLDGGIVRSIVGLDVFKRTYGYQHEGVYIIAARWLSAFNYATLLGAIIG
FT                   ALLSGLAYDRFGPRVMITICSCLSIGFIFVQFFSHTPAQLFVGELVNGCIIAFYPICAS
FT                   TYVSEVTPLVLRGFVATMTNLAFSIGSLIASGILKGAAAMDTTWSYKIPIAAQWALPTV
FT                   MLLLVAFVPEPPYWLCKHGRDDAAIISLRRLTTAPAAEVYVARKLAHIRETLRLEESFQ
FT                   GDRPTYRECLRGPNLRRLVICVMAYNMQAFTGNVFFINYAVHFMEVAGLDASHAFSMNI
FT                   GLTAIGLLGTCLSWFLLSYIGRRTMYLFGCASLMVLQFAIGAIDLAPRRTSTTWAQCGL
FT                   MLVCNFVYDLTLGPFCYVLLAEVSSVKLRGLTIALATVSCYVWSIVFAVVIPYAMNEDE
FT                   GNWKGKLGFLFAGTSLLCTIYCFLCLPETRGRTFEELDILFERRVPSRNFTGYKTEVQI
FT                   HST"
FT   CDS_pept        join(complement(737167..737332),complement(735889..737114))
FT                   /codon_start=1
FT                   /gene_family="HOG000171781" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059012"
FT                   /orf_name="AFUA_4G02680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84416.2"
FT                   /db_xref="HOGENOM:HBG054326"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0000F51AB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA47"
FT                   /transl_table=1
FT                   /translation="MSLQSLPAEVTLQIFRLLDNIDDALRLGRSCRQLYRILNRPGHRH
FT                   TIMKSIIVGSKYHKHDLQLSQLTQFHAKCTEIYATQSRLPMSCRPDTGMVKSFHEPSTK
FT                   LLASPLVVAEIVTRWHAMKVLFDLYCKESVRSSYLADWETSWNCSPETAGENETAGPFA
FT                   NGICNSYAQLPPQEKQRAYERFYRALTAHWVAVELTWVIRVSKHKTEREFDRWERKVYD
FT                   RWSNNPERSLEEKLDIFEALDFVWYFLVSRIFDHSVHSGTVADWIEVAPESATPHAFSP
FT                   LDLYVSHARGLRQPSRLQLNFHEALEDDCMGMFIDDLRSIIRPPHVIELLLRLAWDPKS
FT                   QSGFDRPQYVRKLGVLDQTYQWQQTEADGFRTYHVIMYDIDLSDRDILSSLTATAFRVK
FT                   TEESWHLTTLNDTDSTINEMQLELFREQWERYKENPWDTEMRGQIFFRQETQIQLFERI
FT                   IDLEE"
FT   mobile_element  738867..739274
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        join(complement(742257..742566),complement(741382..742191),
FT                   complement(741011..741333))
FT                   /codon_start=1
FT                   /gene_family="HOG000193008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274696"
FT                   /orf_name="AFUA_4G02700"
FT                   /product="Metalloproteinase, putative "
FT                   /EC_number="3.4.-.-"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL84418.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG054329"
FT                   /db_xref="HOGENOM:HBG324410"
FT                   /db_xref="InterPro:IPR001384"
FT                   /db_xref="UniParc:UPI0000F51A58"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA45"
FT                   /transl_table=1
FT                   /translation="MSIDINLRVTQHVWQHEHPHQHHKSKPKRIMKITALASAILAVAQ
FT                   GALALPARAPALDITLSQVNNTRIKAVVKNSGTEKITFVHLNFFNDPSPVKKVSLYRNA
FT                   TEVEFTGIKQRLRSDGLSNDALTTLAPGATYEDEFDIASTANLTQGGPVTVRTQGFVPI
FT                   AMNNKIAGYIPYSSNELELEVDAEKAVAVPASIKPLDRRTKITSSCTGNRATVLNTALR
FT                   NAASIASKAADAASSGSSALFTEYFKSTSGNIRSAVAARLKAVASEASMNGGGSTTYYC
FT                   SDPYGYCDSNVLAYTLPSTNEVVNCELFYTLQEVTNDCHGQDQATTIIHEFTHAPGVYP
FT                   PGTEDLGYGYSAATALSTSNALNNADSYALFANAVYLNCQGQTGGQTTWDGYSQPGQTE
FT                   PGTQTMWDGYSQPGQTEPGTQTMWDGYSQPGQTEPGTQTTWDGYSQPGQIEPCTQTMWD
FT                   GGSEPGQTEPDAQTMWDNFYQA"
FT   CDS_pept        747494..748336
FT                   /codon_start=1
FT                   /gene_family="HOG000216931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753601"
FT                   /orf_name="AFUA_4G02710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84419.1"
FT                   /db_xref="HOGENOM:HBG054330"
FT                   /db_xref="UniParc:UPI00005206BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA44"
FT                   /transl_table=1
FT                   /translation="MGLITHNWLPFALCIGFAYSRAAITPGVTEVDLIFPRNESYSPSP
FT                   VTPIIFAIQNPSLLSSLNPEITYYIEQQNVNTNESVYNSGSIRLSRINYTTSDPYYLYW
FT                   STGKLDIEGSFVLAWELQMNNCSHSPQSDALTFGYLGSRRHQLYFSTKNGTSSPDFVAA
FT                   TEDDTCEQSQAQAVQVPDLLEVPSSRTWAAPSCAVTVGLSPTPNPCKVKIDSTTAASIS
FT                   AALTSSACANPIRTGLSCPTQSSENAASAAQLPVGGHWRLAIGMMLAYCLASCDSFSW"
FT   mobile_element  750067..750300
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(complement(752449..752715),complement(752061..752398),
FT                   complement(751306..751912))
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210317"
FT                   /orf_name="AFUA_4G02720"
FT                   /product="GPI anchored glycosyl hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84420.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000051F888"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA43"
FT                   /transl_table=1
FT                   /translation="MFIRHSDTVKSAAKMVAAPMMEFYNKNQTEGIPGKLTDTWYVAGA
FT                   MFMILIQYWYASSDDTYNTVVSHDLMFQSGENYDFLSKNYSHWLGNDDQMFWGLASITA
FT                   SETGFPEIPDKPTWTSLARAVFNMQVARWDTTNCGGGMRWQIPLYLPGYTMKNAISNGG
FT                   LFELSARLARFTMNDTYAQWAEKIWDWSANTPLLQTDHCLLIIYGDKKTNGNEQWLERV
FT                   NGLLNSFLRTFCPNDKGGNVLSEVACEPIMTCDRNQIGFKGYTAMWLAHTAILVPSTAT
FT                   RIYPVLQGSALAISKQCSKQPDNTCGIRWWQSTWDGFTPGLESQMAALGGITANLMYFK
FT                   STAPKTIDTNPDGKEHQITATHEDETTLDTPPPVDAANRAGAWILTVIFVLTAGGLVWW
FT                   LVKT"
FT   CDS_pept        join(complement(761420..761761),complement(759996..761363))
FT                   /codon_start=1
FT                   /gene_family="HOG000217305" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905738"
FT                   /orf_name="AFUA_4G02730"
FT                   /product="O-methylsterigmatocystin oxidoreductase, putative"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84421.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054331"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI00005201F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA42"
FT                   /transl_table=1
FT                   /translation="MDPFKAIDLPLPPHFVAALGRPTVLVGFACVFLFSQLLVWTAKYS
FT                   RKKSKGLADIPGPSGWPIIGIGLDLPARPRKLLNSWANQFGDTFKVRVGWYNWVFFNHP
FT                   DAVKEVFDRQAAVTSGKPPLPIAQEYCLRGDGVLPMTYNAKWKRLHAFLKQLLNAKASA
FT                   AFIPSQEFEIKQLLWDLSHEAGKNSTDFYMHIRRMTFSIVMTSAYGLRIPQWDCQEVRD
FT                   VYGNMRMLSIILSPGVFWIDVFPPLNWLPRFLFPSWPKAKFMAQKMHANKMRHWNNLKE
FT                   RIALGNAPDCFAKDLMESNYRDYGLEEETVSWLASAVPEAGAETTASALNGMIRYLAMF
FT                   PEAQARAHEEVTRILGDGRMATLADEPQMPYIKAVIKETLRLCPVATTGLRRMADGDVK
FT                   YRDYVIPKGTILLANLNALHWDPERFPDPFSFKPERYLNHPHRSAVYAAGGDIMARDHF
FT                   TFGAGRRICPGIHLAENGLFLAVSNLIWAYEFKLPLDEKGNEIPLDISDEGFMEGAIRV
FT                   PKQYTVRILERNPARSRLIRESWEQAQKDGYILRGVHVDADGGVRGSAKVKA"
FT   CDS_pept        join(762040..762396,762515..762523)
FT                   /codon_start=1
FT                   /gene_family="HOG000048686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905739"
FT                   /orf_name="AFUA_4G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84422.1"
FT                   /db_xref="HOGENOM:HBG054332"
FT                   /db_xref="UniParc:UPI000051E816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA41"
FT                   /transl_table=1
FT                   /translation="MSGMIISMPPGYRLSSRISGDIALISCLAKSLRDPHQHDENKIMS
FT                   RTPRSMQARIGMSISSQWPERSAYWRSDEGFSVHHLTLAWMITEADMHDACRQDGSEAE
FT                   KVEDVLLQRVQLPELDR"
FT   CDS_pept        join(complement(763590..764103),complement(762751..763478))
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905740"
FT                   /orf_name="AFUA_4G02750"
FT                   /product="MFS monocarboxylate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84423.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053320"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EC7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA40"
FT                   /transl_table=1
FT                   /translation="METKQSEQPPAEEFPAPAPAPAPAPPNGGLAAWSGVFASFLLFLT
FT                   TWGFSTAFGAFQSYYQSDLLHTSSPSRIAWVGTVNAFFLISTGVIAGPLFDRGYLHHLM
FT                   IAGCFLTTFGLMMLSLSTQYYQVFLSQGVCCGLGSGLIYVPALSLVSTRFTTRRGIAVG
FT                   LVTSGASVGFPWTVRSLGFIQLACSCIAVPLLMVTTKTRRSPPRKLIHWHAMKEWSFNA
FT                   YGIANFLMFMAYFIPLFYVPAFASTALRSSTDLSFYMVSILNAGSAFGRIGSSLLTYRL
FT                   GASSILLASVVASAVLLFGWIGIHSVASFVVFCVLFGIFSGVLISANPLVIAHPVVSPT
FT                   PSVIGTRMGMQWFATSLGVLIGAPIAGVIEGHGGDNGFLGLQIFSGAGMAAGAAFLLVP
FT                   LMAVWRHDNIQNKA"
FT   CDS_pept        join(764140..764270,764445..765288)
FT                   /codon_start=1
FT                   /gene_family="HOG000217304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059013"
FT                   /orf_name="AFUA_4G02760"
FT                   /product="DUF829 domain protein (PaxU), putative "
FT                   /protein_id="EAL84424.1"
FT                   /db_xref="HOGENOM:HBG054333"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI000051E817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA39"
FT                   /transl_table=1
FT                   /translation="MNVKAKKRIGQLDQYWGQKNWRLCQVEKEMKGMAYNGEGAAPFLS
FT                   VIPHFTRIATRTWLSTPDKALPGQLVIVCTWLGASAKHITKYTDLHRSIAPHARILLIE
FT                   SEVSILVSSYARQRRLIRPAVDVVLETLADRTESDAPRILLHTFSNGGTNTATQLLITL
FT                   AKTVSQPLPLVGLVLDSTPARGTYWKSYNAMVFSLPPSSRLVGSVVVHFLLILLYTWIA
FT                   CGNENPASLMRRTLLDEETVGPAPQRDAPGYVCYMYSKEDRMTDWRDVWDHAQEAEEKG
FT                   WKVDKVLFEGTGHCAHMPDNPARYAEAVEKAWNSALCKIESKL"
FT   CDS_pept        join(complement(767303..767665),complement(766653..767247),
FT                   complement(765726..766594))
FT                   /codon_start=1
FT                   /gene_family="HOG000217303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059014"
FT                   /orf_name="AFUA_4G02770"
FT                   /product="Arachidonate 5-lipoxygenase, putative "
FT                   /EC_number="1.13.11.-"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84425.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054334"
FT                   /db_xref="InterPro:IPR000907"
FT                   /db_xref="InterPro:IPR013819"
FT                   /db_xref="UniParc:UPI00005206BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA38"
FT                   /transl_table=1
FT                   /translation="MMVFSDCLIFSSLIISYALGLPVVPGQTVMEPSAALPDDGDHLYT
FT                   LPMFDIRPWERVSEVRLAREGYLYGPPLLGNTSFFPTGVLGDAMVARDKAAWFRDVEYV
FT                   TNNVYPEWDKAAIALAKAGGIQSLSSYAVIYENQWATTLPDGVASGMLTNWTQDLLFSM
FT                   ERLSINPYVVRRLHPRKDRLPFAVDDRVVQHLAAGSTLEALHCDGRLFFANHSYQAPYP
FT                   KTPGRWTAACTAYFFIHPRSGAFLPLAIKTNMGSDLTYTPMDETNDWLFAKMAFEMNDL
FT                   FHSQLYHLANTHDVAEPVHQAALRTMSARHPVRGYLDRLMYQAYAVRPIGEEFLFNEGG
FT                   FYDSSFALPNWAGKKYATDAYWEHAGHFKATNFYQDLFDRGLVDCTYGPPLTSFPFYET
FT                   VAPMVEAIEEFTRAFVEAYYPDKTLMDVDNELQDWIIEATEAAKVIDFVPAPMREPEQL
FT                   ISVLSHMAFLAGIAHHALNGATVSEASGVLPLHPSSFNRPLPEAKGSIDSLLPWLHNET
FT                   EALKQASLLVRFNRPLLDEQEGSLPYMFSGSSFLARTGAPIHDAERRFREKMWAISDEI
FT                   RMRQFDERGLSQGMPFLWRSIDPRKIPYYLCV"
FT   CDS_pept        join(768316..769112,769162..769390)
FT                   /codon_start=1
FT                   /gene_family="HOG000217302" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059015"
FT                   /orf_name="AFUA_4G02780"
FT                   /product="Toxin biosynthesis peroxidase, putative "
FT                   /EC_number="1.11.-.-"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84426.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054335"
FT                   /db_xref="InterPro:IPR000028"
FT                   /db_xref="UniParc:UPI000052043D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA37"
FT                   /transl_table=1
FT                   /translation="MRTLILVFLWLTAVSSYPRGIDWDYAIAYHQQVLQGENDRGFGLN
FT                   EPFIPTPSHILPEKKPFYIDETVHYYERHFNGSGENGEYRRSSCPAVNALANRGYINRS
FT                   GRNITYAELAHAVRKVWNFGDDNVILPPEESLVLHSTNSFPQSMLVLAPTFAMHGWPET
FT                   IDLDYFNARYCSRFLEEYELTLAQDDLVQYVINCPAAPTRNDRAVGDNINLNMTLFESL
FT                   LSFSKDGETLSLEDLAEHHHLRHNQSKAENPNFVFGNQGAICSLAQYTNMVGVLGKFGK
FT                   HGRTTLFIDDVKTFYLDEDIPRNYERREAPVCCPFPPMDSILFVAATTDLFSTTRRNPT
FT                   R"
FT   CDS_pept        join(complement(771605..771649),complement(770570..771457))
FT                   /codon_start=1
FT                   /gene_family="HOG000161070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274697"
FT                   /orf_name="AFUA_4G02790"
FT                   /product="Carbon-nitrogen family hydrolase, putative "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="EAL84427.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054337"
FT                   /db_xref="HOGENOM:HBG330305"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0000520904"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA36"
FT                   /transl_table=1
FT                   /translation="MPPFCKIAVIQLYVKPLKPEDNFARAVKFITEAAAQGCHLAVLPE
FT                   FHLTNWIPTDPRFASLCNDWETYLHRYQALAKERNICIVPGSIVRPVSASPTAAAGATV
FT                   SDKQTPSLENVTFFISNTGEILGSYVKKNLWGPTERAYLRSSGDSPHQVISTPLGPVGL
FT                   LVCWDLAFPEAWRELASQGAKIIIVPTLWTRSGASEAGHRQNPSAPSLFLDSILTARTF
FT                   ENTCAVVFANAGGPPGRNYCGLSQINIPYAGPLVRLGTSAEGMGVATLDLAVLEDAEEN
FT                   YAIRSDLTDPSWHYRHTRRVPVESPKGRL"
FT   CDS_pept        join(772607..773002,773070..773576)
FT                   /codon_start=1
FT                   /gene_family="HOG000048685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274698"
FT                   /orf_name="AFUA_4G02800"
FT                   /product="Haemolysin-III family protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84428.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054338"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI000051FB40"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA35"
FT                   /transl_table=1
FT                   /translation="MAMTTVRLAFSYLLSPSSPKVVGNPPVKVSESLKKQRVFHASQIP
FT                   AWMQWDPYILHGYRGQLDSYGQCFWSLFYLHNESVNTWSHIIPGMYFLTLLLAIDYWII
FT                   QLPLEVPVMDILAIQTYVAGTAGCLIFSAAFHATNAHSPEVAHAFLKLDYLGIVMTITT
FT                   TCISVTYFALYSYPILQVTYIFLTVLCAATIFWVALDPRMDGARAGPWRSVFAMPLLAL
FT                   QRPDSANLLCRAAVFFLLATSGLAPIFHVIWAEASYGLIRIPLDSLTVTCSSYAVGTAV
FT                   YVTRFPERFWPARFDLIVS"
FT   CDS_pept        join(complement(783093..783184),complement(782703..783030))
FT                   /codon_start=1
FT                   /gene_family="HOG000187032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274699"
FT                   /orf_name="AFUA_4G02805"
FT                   /product="Asp hemolysin-like protein "
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="EBA27178.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI0000F51A7F"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA65"
FT                   /transl_table=1
FT                   /translation="MASTTGQQFLDIEIKDDMKYDIRIENAHIESGEFYREGDQNDTLT
FT                   TDDIEDMIIRHNGGLRHVCSCGEEKGFKGLQGTIDLIDDVKDAKICTLEWNAPMEPGKR
FT                   NTFMLRDQDPRYHIDIGQWNESGILGKVPVTISDE"
FT   CDS_pept        complement(786297..787301)
FT                   /codon_start=1
FT                   /gene_family="HOG000217300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274700"
FT                   /orf_name="AFUA_4G02810"
FT                   /product="Oxidoreductase, putative "
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="EAL84429.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG054339"
FT                   /db_xref="HOGENOM:HBG299469"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520422"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA34"
FT                   /transl_table=1
FT                   /translation="MSSYDVLVTGSAGHLGTALMLSLPELGFTPFGIDILPSSTTTRVG
FT                   SITNRAFISSVLMSHPIKHILHAATLHKPHICSHQNEDFVATNILGTLVLLEESAKSPR
FT                   QIESFIFFSTTSTFGMALSPKPGSPAAWIDETVVPEPKNIYGVTKVAAEDLCALIHKQS
FT                   GMPVLVLRTSRFFPEEDDDEGRRAAMSDENLKVLELAYRRCDIEDIVRAAVCAMAKARD
FT                   IRWGKYIISAPPLFKNDARTLDQLDRNPAEVFNELCPELGAVFEKKGWKHLSRIDRVYD
FT                   SSKAMRELGWEPQYTFAKTVERLAMGKEWRSDLTAKVGRKGYHAVSTGVYTKR"
FT   CDS_pept        complement(788306..789151)
FT                   /codon_start=1
FT                   /gene_family="HOG000220040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059016"
FT                   /orf_name="AFUA_4G02820"
FT                   /product="Methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /function="methylisocitrate lyase activity"
FT                   /protein_id="EAL84430.1"
FT                   /db_xref="GO:0046421"
FT                   /db_xref="HOGENOM:HBG054340"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI000051E598"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA33"
FT                   /transl_table=1
FT                   /translation="MVALHTELPIIADADTGFGGPLDISRTVRLYEHAGIAGLHIEDQV
FT                   MAGSRSRCALICIDAQSHQVFPKRCGQLQGKDVVALEVFIEGVRSAVEARQDPDFVIIA
FT                   RTDARQAKRFGGPHAGSEAFHEGIKRLKAAVAAGADMVFMECPRTEDECRTLVKEMGDV
FT                   PVPINVLPNVSKSGFEDTSRYADRTVIMVSLPTSRYQTESAGLSHGNLPVYRIHSGDAS
FT                   YATVVWCSKSHGTDLEACEGHTIKDFFDQVGLGEAGEFDARISECSKTQTGEKGAQEGS
FT                   "
FT   CDS_pept        join(791736..791753,791798..792577,792599..793255)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20753602"
FT                   /orf_name="AFUA_4G02830"
FT                   /product="Aldehyde dehydrogenase, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84431.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051F645"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA32"
FT                   /transl_table=1
FT                   /translation="MSLDITTFHNVINNELTTTSQTRHGINPANRQPNPEVPVSTQEDL
FT                   DRAVESARQAFRKWSKTSFAERRTALNHFADKIEANKEALARLMTQEQGKPLSQSTVEV
FT                   GMAVQWARTIPTIEIPETVIEDTDEHQIIQRYTPLGVCGAIVPWNFPVLLAVGKIVPAV
FT                   YTGNTVIVKPSPFTPYCGLKLAELAAQCFPPGVVQALSGGDDLGPMITEHPGIDKISFT
FT                   GSILTGKRVMASCAKTLKRVTLELGGNDPAIVCDDVNIDAVIPKLMRIRLTFAKIGILS
FT                   FLCSSQICMMVKRLYVHEKIYDEFREKLVAFVGSLKVGEGTDPDVFFGPVQNSMQYDKA
FT                   KDLWQSLSAEGLTTALGGTIQDSGGYFVPPTIVDNPPESARVVQEEPFAPILPMLKWSD
FT                   EADVIARANGTDTGLGASVWSKDMTRARRIADQLEAGSVWINSHFDVSPKAPFGGHKTS
FT                   GIGTEWGLNGLIGYCNSQTLWVKPSL"
FT   CDS_pept        join(complement(794336..794644),complement(793618..794154))
FT                   /codon_start=1
FT                   /gene_family="HOG000171770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274701"
FT                   /orf_name="AFUA_4G02840"
FT                   /product="NmrA-like family protein, putative "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84432.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054341"
FT                   /db_xref="HOGENOM:HBG326793"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520693"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA31"
FT                   /transl_table=1
FT                   /translation="MTLKYLITGATGGLGKEVLAYFEANRPSSEYAAASSRESNRKQFE
FT                   ERGIAFRHVDYDDPRTLDAAFPGVENLFFVSTNVFDNEKRIKQHRNFVEAAKRAGVKHF
FT                   TNHSRSGLTFTSIREGVYADAFPLFINWYPDTTTVSLPADGRCAFTLRKELGEANARLM
FT                   LQGGHENEIVLLTAGETISFAETVDVINETTGRNVRFQIVSPEEYVRLSAANDQGGKPA
FT                   EFFQALVSWYDSVAQGEISHTHPLMKEVLGREPTTPREAIRGFLLENRDYTWHQNYVNK
FT                   "
FT   CDS_pept        join(795073..795205,795386..795591)
FT                   /codon_start=1
FT                   /gene_family="HOG000048684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274702"
FT                   /orf_name="AFUA_4G02850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84433.1"
FT                   /db_xref="HOGENOM:HBG054342"
FT                   /db_xref="UniParc:UPI000051FFCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA30"
FT                   /transl_table=1
FT                   /translation="MSSIPRTSRVVFVNRNTCLFNYRIAINNSLLSCPDDPDPGFSLVA
FT                   SRWQTVEPSSVHFLTHGRQGESVAITDLVESGGTVGAARRRAGPGAGAGTGPGAAERVD
FT                   RGSAGGGG"
FT   CDS_pept        complement(797962..799068)
FT                   /codon_start=1
FT                   /gene_family="HOG000171769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274703"
FT                   /orf_name="AFUA_4G02860"
FT                   /product="Glycosyl hydrolase family 88, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84434.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG009466"
FT                   /db_xref="HOGENOM:HBG301397"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000051FD81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA29"
FT                   /transl_table=1
FT                   /translation="MASQRPSQTEVHQTVKQLINNLVNIRDATGKFLLRLQDGRVIDTK
FT                   SWHGWEWTHGIGLYGIWKYYEMTGDESLLRIIEDWFAARFAEGGTTKNINTMAVFLTLA
FT                   YVYEKTGNVTYLPWLDAWAEWAMYELPRTRYGGMQHATYLTENYQQLWDDTLMMTVLPL
FT                   AKIGKLLNRPEYIAEAKRQFLVHIKYLFDTQTGLWFHGWTFEEGGHNFARARWARGNSW
FT                   VTIVIPEIIELLDLEPTDPIRIHLIDTLEAQCEALQRLQESETGFWHTLLDHPDSYVES
FT                   SATAGFAYGILKAVRKRYIGAQYRPVAEKAIAAVMSAVDEHGELQNTSFGTGMGDCLQF
FT                   YKDIPLTAMPYGQAMAIMALGEYLRTCL"
FT   CDS_pept        join(799722..800072,800145..800422,800472..800990,
FT                   801027..801268,801343..801571,801951..802206)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274704"
FT                   /orf_name="AFUA_4G02870"
FT                   /product="2-ketogluconate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84435.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005206AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA28"
FT                   /transl_table=1
FT                   /translation="MAEKTLASNPVTSSSPEAGDDQKQPKDINHVERVLSDGLKKDEAD
FT                   YSRMDKDLQEYVARGQVDVDEATSKRLKRMIDRRVLIIMILTYFLQALDKGTLSFASIM
FT                   GIRTDLHLQNGQKYSWLTTCIYIAVLIVEYPTNWIIQRVPIAKYLGINICLWGSVLALH
FT                   AASKNFTHMVVLRTLLGIFEACCQPTFVLLSSMWYKREEQAATVTYWYMMNGGQQIVGG
FT                   LLAYCFSLIGKDKAIHSWQALFITYGVISVLWGLFVIFWMPDSPMRAKCFSEEDKHLMV
FT                   ERVRANQTGMQNKKFRAYQMWEAFRDPQMYCYCAIQIFTTLPTSGLGAFANIIISGFNF
FT                   TVLQTQLLAMVLGFYIIIVLLGSAWLVKKTGQNLFVMLGFVIPAPSTDIHDPRSYIGTI
FT                   VLMTVENKNLGTKVGLLISYYITLSFWSAQTLCLSMVSRNIAGATKKSTVVAATFVSWA
FT                   VGNSIGPQVFLDRDAPRYFIAFGVHLGCYVCLTLAIIFLRFWLALQNKKKARVLEENGL
FT                   SAADNNLTHAFEDRTDQENLHFRIQPRLEITASVQIIFHEHLGASHNDHIRGNLQEGAQ
FT                   ENWHNAHVHHTQILEAEHAESAVHGRVRVTGLPILCQTELTPDSRALE"
FT   CDS_pept        join(804443..805363,805537..805689)
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274705"
FT                   /orf_name="AFUA_4G02880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84436.1"
FT                   /db_xref="HOGENOM:HBG054343"
FT                   /db_xref="HOGENOM:HBG329730"
FT                   /db_xref="UniParc:UPI000051EC80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA27"
FT                   /transl_table=1
FT                   /translation="MLNSITELPEGVAKNSEIHSLAIRILVVVFNSIALYNAVELVILI
FT                   FLTFNRYSGLYFWSLLLSGVLGVIPHAVGHLLQFFRIGPIGLAISIATIGFYFMVPGQS
FT                   FVLYSRLHLVVQNQKLLRRVLYIIIIDSIVLLIPTTVLNYLTVYVGTQPVIKGYNFVER
FT                   MQISWFTAQEMFISGIYIVETIKLLRLRPDKASSRNKIMYELIAINLVMVLLDVALLVL
FT                   EYLGLYTLQVTLKAAVYSVKLKLEFGVLRKLVSLIHAPQVSSTTDVDEYPTFVDPSRIT
FT                   GDVTHAAPVNQRTSSRRWDAISLDSLPASTFCLSQTEIPSSRLHWADTIIGMNMTLALE
FT                   LGIMYDFGQDTPVHLQP"
FT   CDS_pept        join(806022..806572,806970..807123)
FT                   /codon_start=1
FT                   /gene_family="HOG000217297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274706"
FT                   /orf_name="AFUA_4G02890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84437.1"
FT                   /db_xref="HOGENOM:HBG054345"
FT                   /db_xref="UniParc:UPI000051F897"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA26"
FT                   /transl_table=1
FT                   /translation="MQQVYTHEGPYESIPSTASPGLQFLRHFLPALDSLDPTTNPISRF
FT                   IHPDARVVVGSGPPNRGTDVIGLLNVRQRHIQRFQHEIHKAWDIARPDTGNGNGGPRTV
FT                   MFEATSGTVFRNDPDEFEVQVREFNILELQRAGSQSNGDGEGKGGFVAVEMRTFMDARP
FT                   VQDQAARLQRESAYGEAKSTGWDHSTLNCRTSLQWVQPGWQHRIELCEVQSLTLISQLG
FT                   FLSGPAVAANVY"
FT   CDS_pept        join(807605..811417,811473..811787)
FT                   /codon_start=1
FT                   /gene_family="HOG000171704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274707"
FT                   /orf_name="AFUA_4G02900"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="G-protein coupled photoreceptor activity "
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="protein-chromophore linkage "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="sensory perception"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84438.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0007600"
FT                   /db_xref="GO:0008020"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="GO:0018298"
FT                   /db_xref="HOGENOM:HBG054346"
FT                   /db_xref="HOGENOM:HBG327489"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="UniParc:UPI000051FFB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA25"
FT                   /transl_table=1
FT                   /translation="MASRANASSPTRQKNDEDLSETTSGAVGEEGAVTRAPKSGMESST
FT                   GFESEDRVYPIRSVISVDPSTVSQSQQQAESNLSSPATGAREWSIINAETWDKMRAQTK
FT                   TSAGNFSATEPPPPAPDTAGSSSEPPDQGRSHSASPTPTPDSALTKTQDPEVDSEHGLV
FT                   TARFRHVVTDGGHMVITGRANDSYQACEDEPIHIPGAVQSFGCLLVLREEIEGKLVVRV
FT                   ASENSEVILGHSPKCLFALPNFCDILDEEQKDNLLDHLDLIRDDGFDPSVDGPEVFLLS
FT                   VKLPSGKPRRFWCATHLSPADSNSIICEFELEDDRINPLSVSGLTTPVTPTDTLGVEPT
FT                   PEQLEHSTVNISQPLRLLRNARRRRGEAAAMEVFSILSQIQDQLGRTKSLDSLLNTTTG
FT                   LVKELTGFHRVLIYQFDTEWNGTVVAELVDPKASVDLYKGLCFPASDIPKQARDLYRIN
FT                   KVRLLYDRDQVTSRLVCRTLEDLQTPVDMTHSYLRAMSPIHLKYLANMGVRASMSISIS
FT                   GFNELWGLISCHTYGTHGMRVSFPVRKICRLIGDTVSRNIERLSYASRLQARKLINTVP
FT                   TDQNPSGYIIATSDDLLKLFDADYGALSIRNETKLLGKMTHSQEILALLEYLRMQRMNS
FT                   VVASHHITKDFPDLFYAPGFKHISGMLYVPLSAGGTDFMVFFRRGHLTEIKWAGNPYDK
FT                   KPQNGHLEPRKSFQTWRETVLDQSREWTESDVETAAVLCLVYGKFIKVWRQKEAAMENS
FT                   QLTRLLLANSAHEFRTPLNAVINYLEIALEGSLDPETRDNLTKSYSASKSLIYVINDLL
FT                   DLTNAEKGQKLIKDEIFDLPATFREATDMFEGEAKRKSIHYKVVAHPGLPPAVIGDQRR
FT                   VRQVFTNLISNAVRHTTAGSVTTEIWRSLEQAQPGCVVVQMTVLDTGSGMSQSTLEALF
FT                   QELEQVSTDDDNYWFDPEDQTHPLDSCSQDKRVLGLGLALVARIVRNMHGQLSVRSEKG
FT                   KGSYFEISLNFPVPDDVASGESEEPSVPDIVEPAVPIQQEVEFMLVDSKSTRGGEQRRR
FT                   STGSDHSKGSYNSSRSGRSNRSEADRLISAMQDSPLLQRTTSEGSEERDPRPVERTQGS
FT                   AHNRHAMSTQSLPNLKDESIPEQWPVTQAPAFPSTSRTMMPPVSPPLPGHEPVTDSGVP
FT                   MTAIRIPLEDVERPPSPPAKAFLSQPGTSAELPSAAEPSSAPAPNAEPTTLRVLVAEDD
FT                   PVNSKIVEKRLSKLGHAVILTGNGEECAAAFRRDSTKVDVVLMDIQMPIVDGTESTRMI
FT                   RQFEQEFQPPLSEKASRNGHVPVFAVSASLLEKDAQLYIEAGFDGWIMKPINFNRLGVL
FT                   LDSLENHDIRNATIYRPGYWELGGWFKHHGEL"
FT   CDS_pept        join(812606..812629,812703..812938,812995..813943)
FT                   /codon_start=1
FT                   /gene_family="HOG000171693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274708"
FT                   /orf_name="AFUA_4G02920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84440.1"
FT                   /db_xref="HOGENOM:HBG054348"
FT                   /db_xref="HOGENOM:HBG327491"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="UniParc:UPI0000520905"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA23"
FT                   /transl_table=1
FT                   /translation="MVSLWPWKGEDNSPAFFEKALSALSTKITQTTSQLDLHRQHARRF
FT                   KALWTLYTTFAYLLYSIILALVLGWQNWGMTEYAAIIGGPVLIYVVRAVASKFFDYRIN
FT                   KTQRHLEDLQKQRDETIEKLKVATKYNSTQQLLEKYGAESPKPSRPKGGDEKRKTDAKR
FT                   KQPSTPQQPVMRTGLPPPPTANIRRPTPAQSPVSSPGQPQSPPSYLIQEQPQLQNSHPP
FT                   VPPALDEPGFAPNAFPSAPQYVEHSHWYDRLLDILLGEDETQPKNRMALICATCRLVNG
FT                   QAPPGVKTLEELGRWRCGSCGAWNGEESEAKKMLAGMRDQARSADGAWESVAKPDSDSH
FT                   SAGDATDEAVMVATSEDEQVEARSSGEESQNEADQQPQEQETPEASGNSKSGRGRRKGT
FT                   RKG"
FT   CDS_pept        join(complement(818461..818656),complement(818004..818231),
FT                   complement(817795..817942),complement(816654..817736),
FT                   complement(814092..816591))
FT                   /codon_start=1
FT                   /gene_family="HOG000048683" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274709"
FT                   /gene_name="dcl2"
FT                   /orf_name="AFUA_4G02930"
FT                   /product="Dicer-like protein 2 "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="regulation of defense response to
FT                   virus"
FT                   /biological_process="response to virus"
FT                   /protein_id="EAL84441.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0009615"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0050688"
FT                   /db_xref="HOGENOM:HBG054349"
FT                   /db_xref="HOGENOM:HBG327492"
FT                   /db_xref="HSSP:2FFL"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051FB41"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WA22"
FT                   /transl_table=1
FT                   /translation="MASTVSTCQDASPYQPRNYQLEMLEASMKENIIVAVCSLNSYVKL
FT                   QNGNDNDPLDGYRERQNAYVFALCIQQHEVIASNLPAVRTRTLTGLDKVELWTDQSIWD
FT                   AVLNGYRVIVSTHAVLADALSHGFVKMSQLALLIFDEAHHCTRRHAANKIMQDFYHPTL
FT                   TKSGPAAVPRIMGLTASPVVRSNHQELLMVESNLDAVCRTPRLHRQELLKFTHRPHLQQ
FT                   IWYTPTDPAGFRSASLTLGALYHAWENLDIGDDPYIQRLRKSPLDDRALKKALLTGKTY
FT                   CREQLRRFVDRSRHIFEELGEWAAEYYIYASIKQLRDRVRDSYMSGDWDEAEKAYLVDF
FT                   LSKIPTSDIHFALNDPDGFRISPKFESLLNFLDSSDQREFSGLIFVKQRVTVSAMTSLL
FT                   SVHPYTRERFRCAAYVGWSNSSASKDILGDLLNMQLQRDTLDDFRSGRKNLIIATDVLE
FT                   EGIDLSACSVVVCYDKPPNLKSFIQRRGRARRKQSTFAIMFPTDDTSADVSRWQDLEQA
FT                   MIEAYQDDERQLQSVSALESLDEEVMERLTGDSTSAVLTADMAMAHLHHFCAVLPPQPY
FT                   VDMRPVFSFETNEDGLLKGTVILPSCVHPKVRRTEGRRWWRTERAAMKETAFQAYKSLY
FT                   EFGLVNDHLLPLTKKPELKTHDLGSMPSILETSEQYDPWIEWAYSWSSPDIHQSRIVVK
FT                   MNEGRGDELCMRLIGPEYLPPLSPMTLFWNSSTTFTVTFKAAERVPLVPLSSVEDMRAI
FT                   TALYLKATSSRVCSAERDFMALFAPDLHHTELKGWLDTYEGSDPAMEVYSRGHNPLLMG
FT                   VVRDHSRYGEPFLFRKWLVSHQNPSCSIVELECAPFPHRRNFLRRQTLANSQVDVDEAI
FT                   PDSAAKNPIVAAEACTIDRLPFTMAIFGLFISAIVEQLEIELIATRLRDTILRDVSFKS
FT                   TDHIITAISTPLAHRLTNYQRYEFLGDSILKFSVSCQLFFQHPNWHEGYLSEGRDMIVQ
FT                   NPRLAKAALDTGLDAYIVTKRLASRKWSAPLISEKLGRVPAKRQMSTKVLADVVEALIG
FT                   AAYVDGGHSTAQACIRRFLPEINLHAVDTRTAARSVAPESARHMMNDRLKDHIGYTFED
FT                   ESLLVEALTHPSCDYDSTTQSYQRLEYLGDAVLDMVIVSAIFNHRIQRPQGDMTKIKHA
FT                   VVNANLLAFLCMEFAISEEKLDVAQTSKDSFAVTSSQESVELWRFMRYRGQGLKAARDA
FT                   SLARHRALRDEIASSLLQAPHYPWHALSRLNADKFFSDIIESVLGAIFVDSGGNLAPCE
FT                   VFVEQIGLMAYLRRILDHGIDVRHPRSVVQQLAKTNIQFVLQRVPTEEGGASYQCSVQM
FT                   EQAELFVVTGCLTAEEAEVTAAVEAIKFLTRDEGSTPLNKS"
FT   CDS_pept        join(complement(822027..822221),complement(820177..820401),
FT                   complement(819611..820123))
FT                   /codon_start=1
FT                   /gene_family="HOG000048682" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18210318"
FT                   /gene_name="kapC"
FT                   /orf_name="AFUA_4G02940"
FT                   /product="Putative transcription factor kapC "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84442.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG054350"
FT                   /db_xref="HOGENOM:HBG327493"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000051FD82"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WA21"
FT                   /transl_table=1
FT                   /translation="MASTPRTELVNPNPQTESINVLKRISCQPCCGCGYISKVAGAAEL
FT                   TGKWAGHTSASDAPKSNQIDQARPQPPAPQPPHMQPNTPARDQNNIDPAISGATMLTGP
FT                   PQTPTQPDVTGQETPKTYGKRPLSTSKRAAQNRAAQRAFRQRKEAHIRELEGKVKAYES
FT                   MGEAIKALQAENYQLREYIINLQSRLLDSQGEVPELPGNIDLSQPRSEIPVPPIPNSGT
FT                   ATTTAPPPTAPQQPQPSHAQAPTSNDDMNSLNRIAVAGLGMRKPPTEEANYLGNNFQAQ
FT                   ARRVRPDEGQPEASELPKQEQTHGLPLIS"
FT   CDS_pept        join(823258..823308,823709..823898,823949..824139)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210319"
FT                   /orf_name="AFUA_4G02950"
FT                   /product="Nucleotidase, putative"
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="EAL84443.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054351"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="UniParc:UPI00005208F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA20"
FT                   /transl_table=1
FT                   /translation="MDFVSLILHQEKVPARHYHVHNVELISRFAGLVKSFEPKPLVVFS
FT                   GDSFSPSLEASLLKGEHMVPFLNHLNVDVACYGNHDFDFGETRLVELSRKVHFPWVLSN
FT                   VTRVTENGDISREPLACGGRYITRTVQGYKVGFIGLAGT"
FT   CDS_pept        join(824253..824628,824673..824987,825049..825548)
FT                   /codon_start=1
FT                   /gene_family="HOG000171671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210320"
FT                   /orf_name="AFUA_4G02960"
FT                   /product="UDP-sugar hydrolase, putative "
FT                   /EC_number="3.6.1.45"
FT                   /function="UDP-sugar diphosphatase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="EAL84444.1"
FT                   /db_xref="GO:0008768"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="HOGENOM:HBG050864"
FT                   /db_xref="HOGENOM:HBG323917"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="UniParc:UPI000051E580"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA19"
FT                   /transl_table=1
FT                   /translation="MVAQELARHLRLNEGCDFVIAISHSRLAEDIRIANNAAHGIAKVD
FT                   LILGGHDHEVLHRFHGDTEEDSEIIQQGTRNEDIVSNGVVDQVAGDIRIVKSGTNWRGL
FT                   SILRLMARRLPDGRATIETVKLKQYVDIAQSSECSSLSVCPRIRKMAAEIQQRVGSVVQ
FT                   EPLVHTTTPLDGRCSVIRSSETNLGNMLADAYRAYYGADIALVNSGSIRCDRIIDPSSS
FT                   PLHVKDIIEICPFENPVVVKRVSGRALHEALENSVSDLHVDGRFMQCSGLHVVADWQQQ
FT                   EGHRILQLSLVQSSFAPPKRIIPSQLYSVVMSSFIAAGFDGYTCFQSLETLVDKETAVT
FT                   DTGLLLRIFGYDKEGLNDGNTTGIDRARRAIICGRHGLDSLPIVSPTVEAKIQFVT"
FT   CDS_pept        join(complement(828466..828547),complement(828261..828417),
FT                   complement(827910..828198),complement(827428..827859),
FT                   complement(826132..827379))
FT                   /codon_start=1
FT                   /gene_family="HOG000171344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274710"
FT                   /orf_name="AFUA_4G02970"
FT                   /product="Plasma membrane channel protein (Aqy1), putative "
FT                   /protein_id="EAL84445.1"
FT                   /db_xref="HOGENOM:HBG054352"
FT                   /db_xref="HOGENOM:HBG327420"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI000051FFBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA18"
FT                   /transl_table=1
FT                   /translation="MAFNPAPKAVQENHHVDYVIRFNYGDIDTPEAIKKFEVLLLELSE
FT                   VGLQTEVRQGDENSLFVFVRAASKKKLKRAVYQSRVRDWLYGVRNTEPEPASSAKPQSE
FT                   AERLLVIYHLITVPKAEGGAGITPRHGEWKNVDAIFPLHDEETNRQCMREWSKKTFLST
FT                   EDLDRIRNTFGEHVGFYFAFLQSYFRFLMFPAAFGFSCWLLLGSFSIIYTVVNCLWCIV
FT                   FIEYWKRQEEDLSCRWQTKGVSAVHEKRAEFKPEKEIRDESTGEVRGVFPATKRMYRQL
FT                   LQVPFALLAAVALGAIIATCFAIEIFISEVYNGPLKGYLVFIPTILVSALIPTMSAVLL
FT                   TVATKLNDYENYETQDAYKVALTQKIFVVNFITSYLPIILTAFVYVPFASRIVPYLDVF
FT                   HLTVRPFVSKEHAIKARTEFSINPDRLRKQVIYFTVTAQIVGFALETIVPFVKQRVFRE
FT                   YKEYTKKQHAKAEPGNGAGEKKTVSLGDDEDEARFLTRVRNEAELEDYDVTDDLREMCI
FT                   QFGYLALFSPVWPLVPVSFLINNWVELRSDFFKICVECKRPWPQRADTIGPWLDSLGFL
FT                   SWVGSITSSALVYMFSNGHEGPNGEPTTIRCWALLLTIFFSEHLYLIVRYAVRSALAKL
FT                   EPPNTRRERIERFMMRKRYLDTVLSAESDDDADEVKGVVSSIPPSEITRESLEQDARDW
FT                   SKQGTDPTERFWMRQRGWKESAEVGLSLITKAKGDETKKQQ"
FT   CDS_pept        complement(829052..829675)
FT                   /codon_start=1
FT                   /gene_family="HOG000078521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274711"
FT                   /orf_name="AFUA_4G02980"
FT                   /product="Acetyltransferase, GNAT family, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL84446.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051FD93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA17"
FT                   /transl_table=1
FT                   /translation="MSGEATIRLATPEGKFTPHSLQCFSARVGHRCEKVSRPLLTPCEI
FT                   ADVPYILQFIRELADYEKALHEVEATEESLLATLSFPNDTPKRGSVYTALVIPPATAEN
FT                   PSPVPVGMALFFYNYSTWRSAPGIYLEDLYVQPSARGKGYGFKLLKYLAAKVLEVKGRR
FT                   LEWSVLKWNEPSIKFYKQVGAQAMEEWMKMMVEGPALNKLAEGL"
FT   CDS_pept        complement(830034..833039)
FT                   /codon_start=1
FT                   /gene_family="HOG000171660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274712"
FT                   /orf_name="AFUA_4G02990"
FT                   /product="Vesicle-mediated transport protein (Imh1),
FT                   putative"
FT                   /protein_id="EAL84447.1"
FT                   /db_xref="HOGENOM:HBG054354"
FT                   /db_xref="HOGENOM:HBG327496"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniParc:UPI000051FFD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA16"
FT                   /transl_table=1
FT                   /translation="MAHARVLSIEPFEAALRENTPLTSIADPKALTEYLNQITLKGDMV
FT                   IEELKRVTTERDDYKKKLEEAQKSTKEACDAVADLKKDKTQGAKEEKTASTEDTASKKE
FT                   LPAKEESEEFFSFDNELPRLESELKEKQEEVETLKSQVESLKRDLAVARESTEGMVQNL
FT                   ESATRELVELRDIRDKQDSEIKKLKDTRQAEVDDVKAKLAESENTIAKAGEEAEKLKAE
FT                   LKQKTEEIEKLQDQVTQQKDNDQQKELQEKLEEVAKEKDASEKKLGVLQGLVDNLRSQL
FT                   KDTEVVVSDLKADMKGKVEELGKLQNVVDYLNNNLKDNAEWQQTRDQAASGQSPDFDSL
FT                   RKSLAPLQQEPGGGNLATEPEPPANGATGGAGASKKKKNKKKKGGKGGEDTAKATGAAV
FT                   VQDKESHAAESDQAASDLADLEQKIQTLTKQLGDKEAAIDRLSSKLKGEEGLKEEIESL
FT                   RDDLLHLGQDHVEAKDKIKELNVEKKALEETVSKLEKELADIRTSHASKSADSEKMHSD
FT                   LKEDYENLKVKLTNLETELSAAQQLAATRFKDLTELRETLQKLQPELKSLRVESSELKS
FT                   TKEALASKESELRTLEGKHEELRAEVKTLKSTISERDAEVKTLNQKIRQETDSRLKAEE
FT                   NLTVAQSDLRYSESKKQEAVETKEKIAADLSRAQDELKTARSQLREVENKVTQLNKELD
FT                   GLREEIQLKTAQHASAQSLMNSMRDQSAELALQMKEARERCESLEEELADAHRLLSERT
FT                   REGETMRRLLSDIEGRAEAKVRDFKERMEAAIEERDRAEDEASAQGRRRARELEELKTK
FT                   VREAEKALRTAEEDKEELERSQKDWKRRRDQLEEQSERSAQELNDIRQAMARLRDALDE
FT                   SEKQVRDLEKEKAELRRSVEETNSRLEKLRRSYRILSDETRAVQNPQSSRSSIDSGARK
FT                   AVASPVSKDRSPSTRRSETPTGAPIDYIYLKNVLLQFLEQKDKNYQKQLIPVLGMLLHF
FT                   DRSVTYFFNYPN"
FT   CDS_pept        join(834770..835110,835186..839413)
FT                   /codon_start=1
FT                   /gene_family="HOG000048680" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274713"
FT                   /gene_name="nte1"
FT                   /orf_name="AFUA_4G03000"
FT                   /product="Lysophospholipase nte1 "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /biological_process="phosphatidylcholine metabolic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84448.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="GO:0046470"
FT                   /db_xref="HOGENOM:HBG176479"
FT                   /db_xref="HOGENOM:HBG398180"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000051F63A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WA15"
FT                   /transl_table=1
FT                   /translation="MADGVTQVDSTGLHSFSPSPSLSSSSSLPAVALSLAVSASAVTAS
FT                   YSISHLPPPPLPPVPTTMAGWIGWVFSFFFQVIPSVLYWIITFSTITLPTWLFTLFSMS
FT                   LTFTMNFTTLLLIVLAVVSTISWFIRYRFLNMYSRLPPEPQRKEPQVDLFPDVQEGDSK
FT                   PGLANYLDEFLSAIKVFGYLERPVFHELTRTMQTRKLIAGETLMLEEEKGFCLVVDGLV
FT                   QIFVKSMRDGKSDTDEELHHLGAESSDEEHHIDGKQGYQLLTEVKNGASMSSLFSILSL
FT                   FTEDIQLRENESSGSSSSSIALRAARVPNSIPTSPRGVMDSPSLGFQDHSDDTSNMITN
FT                   GELPSVPPLHLGESRTPPSGDQHHQQHHESRKHSSRKRRKSVHPDIVARAMVDTTIAII
FT                   PASAFRRLTRVYPRATAHIVQVILTRLQRVTFATAHSYLGLSNEVLGIEKQMTKFTTYD
FT                   LPNNMRGAALDRLKDKFIKERDRLGSEEVTKGIALHNPSAGRRRRSSSFLRKDAALQAK
FT                   LMTPRRAATVVTPESAPAEHDTYGVSPGDLLSTIQSSRFGPRYEQPPAKLQTPLAEKEN
FT                   THFRLPAMQARHTFRRQDTMDEDGLFRECILDCIMKGIGLTSSTRDALRKSNHSGEASP
FT                   KLLSYDSRRQKAIFTNNAFGFIDPYEGSGDGETESLMSMSVTSAGGTSPVINLREELRN
FT                   DIEIVYFPKGSVLVEQGERHPGLYYVIDGFLDVGVPIVDKGEDLVGVSKPAASKGSFPT
FT                   LKRTTTANSVGAGGTAANDSRRRKQSRKSLYLIKPGGIQGYVGAVASYRSYTDVVAKTD
FT                   VYVGFLPRASLERIAERYPIALLTLAKRLTSILPRLLLHIDFALEWVQVNAGQVIYRQG
FT                   DESDAIYLVLNGRLRSVLESPGNKLAVVGEYGQGESVGELEVMTESTRPATLHAIRDTE
FT                   LAKFPRSLFNSLAQEHPGITIQVSKLIAQRMRDLVERPVTEKGVERSNAGSVQTATSTV
FT                   NLRTVGILPVTAGVPVVEFGNRLLHALHQVGVTNGVTSLNQAAILNHLGRHAFSKMGKL
FT                   KLSQYLADLEEKYGMVLYIADTNVSSPWTQTCITQADCILLVGLAESSPSIGEYERFLL
FT                   GMKTTARKELVLLHAERYCPPGLTRRWLKNRVWINGGHHHIQMAFRLTAEPTHPETKRF
FT                   GTVLKQRVQVLQAEIQKYTSRRIRQTPLYSAQSPFKGDFHRLARRLCGRAVGLVLGGGG
FT                   ARGIAHVGVIKALEEAGIPVDIIGGTSIGSFIGALYARDADVVPMYGRAKKFAGRMGSM
FT                   WRFALDLTYPTVSYTTGHEFNRGIFKTFGDSQIEDFWLEFYCNTTNISKSRPEYHSSGY
FT                   VWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTVDHMKGLGADVIFAVDVGSIDDNT
FT                   PQVYGDSLSGFWSVFNRWNPFSSCPNPPTLSEIQARLAYVSSIDNLERAKNIPGCLYMR
FT                   PPIDGYGTLEFGKFDEIYQVGYAFGKQFLEKLKSEGSLPLPEETEEKKKLQRTLAPRRA
FT                   SI"
FT   CDS_pept        join(complement(840852..840907),complement(840678..840800),
FT                   complement(840488..840611))
FT                   /codon_start=1
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274714"
FT                   /orf_name="AFUA_4G03010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84449.1"
FT                   /db_xref="HOGENOM:HBG054355"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000051EA52"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA14"
FT                   /transl_table=1
FT                   /translation="MPTALSKFVLAIDVIFSYLWLTAFIFAAQDYNEQNCYFNSPPFVG
FT                   CSKKKANEAFIFLAFFFTFAGMFLEIASLAAYRRENAPVREKNGHGAAPATAAAV"
FT   CDS_pept        join(complement(845604..845799),complement(845214..845534),
FT                   complement(844227..845167),complement(843363..844178))
FT                   /codon_start=1
FT                   /gene_family="HOG000171615" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274715"
FT                   /orf_name="AFUA_4G03020"
FT                   /product="Chromatin remodeling complex subunit (Arp5),
FT                   putative"
FT                   /protein_id="EAL84450.1"
FT                   /db_xref="HOGENOM:HBG327501"
FT                   /db_xref="HOGENOM:HBG351854"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI000051E581"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA13"
FT                   /transl_table=1
FT                   /translation="MTITSVQTILPSRFAVTSTEKNAAKPPPKIYNVLDNPFKGYQPPQ
FT                   PDGYERSRSKPSTSAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKGCQFIG
FT                   YDAYVDATTRGQLRYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEP
FT                   IANLNYPRRMMNEILFECYSAPSVAYGIDSLFSYRYNKGTDGLIISSSHTSTHVIPVLN
FT                   SKALLSNCSRLNWGGMHASEYMLKLMKLKYPTFPARMTESQMEDLVHKHCYVSTDYDRE
FT                   LSSYLEWTGLEDRDHIIQYPFTEHVVPEKTEEELARIAERKKESGRRLQEQAAKMRLEK
FT                   LMKKEQELEYWKDLQRGLASETKKEARRILDSEDLKDEAHLDRLIRDLERSIKRSRNRD
FT                   LGVEETEEPPEDMSFPLLDVPDEELDEAGLKEKRHQRLMKSNIEARQRAKAEKERERAR
FT                   KEEEERLDREKRENDFENWVAERRAARQNILQRIKERDRMKADLGNRKSLASQMRMKTL
FT                   ANLAADGPKKRRRGGDDDDFGANDEDWGVYRTVATGEQSDEEEEEDLGEMLTNIENELL
FT                   QYDPEFTENHTLAAQSDWTKSLVHVFLRGPWPFDPESQREAHQIHLNVERIRVPEVVFK
FT                   PSIAGIDQAGLLEIAAGIVNQRFSNPEDQAKLLRDVFLTGGNTLFKGFDERIRNELRSY
FT                   LPVDAQLNVRRASDPVLDAWKGAAQWASGSGLKNHSVSREEYLEKGSEYIKVRQVMYLP
FT                   GHVE"
FT   CDS_pept        847156..847713
FT                   /codon_start=1
FT                   /gene_family="HOG000039089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274716"
FT                   /orf_name="AFUA_4G03030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84451.1"
FT                   /db_xref="HOGENOM:HBG327503"
FT                   /db_xref="HOGENOM:HBG434839"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniParc:UPI000051EA3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA12"
FT                   /transl_table=1
FT                   /translation="MGAPPTPAESQEHQQLLNRLDIAQVPRPFRNPNWRPSQRRNKNVK
FT                   QLISENSRKEASVMATQANSGASTPFQPSTDGSQTPVDSSARTNIAQAAQNLSTLVLEK
FT                   NARAMLPSGPAVTYTNIESAPSLHPSQHTRYCDITGLPAPYTDPKTRLRYHDKEVFGVI
FT                   RTLSQGVPESYLELRGAHVVLK"
FT   CDS_pept        join(848943..848984,849099..849395)
FT                   /codon_start=1
FT                   /gene_family="HOG000035939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274717"
FT                   /orf_name="AFUA_4G03040"
FT                   /product="Got1 family protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="EAL84452.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG204028"
FT                   /db_xref="HOGENOM:HBG592905"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniParc:UPI000051EC6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA11"
FT                   /transl_table=1
FT                   /translation="MYHSGLYFESLQANILFLIGLTLIIGVQRTLAFFSRRQKLKGTAA
FT                   FAAGILLILFRWPLTGFLIELYGLFILFGDFLVTIGQFAGNIPVVGPYIKTALETLAGG
FT                   RRNAELPV"
FT   CDS_pept        join(complement(850783..850810),complement(850658..850673),
FT                   complement(850484..850583),complement(850229..850363),
FT                   complement(850012..850143))
FT                   /codon_start=1
FT                   /gene_family="HOG000171591" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274718"
FT                   /orf_name="AFUA_4G03050"
FT                   /product="Profilin Pfy1, putative "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="actin cytoskeleton"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL84453.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015629"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG038367"
FT                   /db_xref="HOGENOM:HBG388165"
FT                   /db_xref="InterPro:IPR002097"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="UniParc:UPI000051E5AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA10"
FT                   /transl_table=1
FT                   /translation="MGQHSAVWQGYVDSRAKSTSLMGSGQFDKAAILSYDFSDVEAQSP
FT                   TFQISKEEIAGLKAAFDKPGSAFETGFVVGGDKFVAIKADDRSLYGKKGKEGIVVVKAV
FT                   SCVMVAHHGEAVQTTNAATVVENLVDYINNPR"
FT   CDS_pept        join(853078..853995,854051..854962)
FT                   /codon_start=1
FT                   /gene_family="HOG000171570" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753603"
FT                   /orf_name="AFUA_4G03060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84454.1"
FT                   /db_xref="HOGENOM:HBG054356"
FT                   /db_xref="HOGENOM:HBG327505"
FT                   /db_xref="UniParc:UPI000051F646"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA09"
FT                   /transl_table=1
FT                   /translation="MARGILGRSRAPEAIEIISNPGLKYSDAIPRTDLRDVKSVANNSR
FT                   PVNRAVAQWNFQRPRTADGRQPIKKGQGVNPGFDFQIAIPPAEAVPLPKSPDDDINANM
FT                   IGIALGSPRMAEPQRILPQMQEQPPVSTSASPEQVSPQTKTLKRKPSKWRKIGGLFKAK
FT                   NAFPATANQPFYQLRCAEEWPLQESTHSVDYKHQQEAAKSEPENATPQNLPNLEKWPCL
FT                   EGKDESKSCVQSSSETVPQESVKNIDLASGTKLRTAGPFLQIDIPDVQLERYSVMFGGV
FT                   LNQNTPSLLKRRSKTLEDVRIPKPDASIPPPDFQSPRRRATSPQPRLPSFNLFPTQAPV
FT                   SKASRVLGSQNIPRGPSPLHRSQTSLSGIGRQTPTNDPNHDLLVVQSPSIKSPMLHQTK
FT                   DSVSSTVSMDSTEEQRLLQKLKQTKIYVDKEQEPEWEIINKKPTSKGLSPRPSPIQNPT
FT                   PSPRQRTPPLALKINTQVLPSTTSSISSAPSPHLSPINSAARDKPERNRSPVETLSAVF
FT                   PFSATRMPLSDDTEDIEAKEAMDPIPKVEVSIARSVSVSRGKKQVIVPIRPRAGRLNPN
FT                   ERLVVRQAKTPQVRDAQHGHRHGISQDVRIETI"
FT   CDS_pept        complement(855359..861490)
FT                   /codon_start=1
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059017"
FT                   /orf_name="AFUA_4G03070"
FT                   /product="DEAD/DEAH box helicase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL84455.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG023097"
FT                   /db_xref="HOGENOM:HBG736699"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051EC6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA08"
FT                   /transl_table=1
FT                   /translation="MTLVLNLSTGGFCFDLQSIPSSVLIILYFYRRFRPHIPVKMDGTG
FT                   PTEQWLSQLTAMREAIAALKLPKDPATEQLSYGSDLDLDLDDEYSSPGTVDDIWDIISS
FT                   DDETNDDLDDINGVPLPPAPSTSLYDQAWLEQRCQAITLQKPGMSAQELAQQITASLAT
FT                   DSGDDELQMSLAEIVGFDDLDFVIELIGHRAEILASTTSKTEAQTDGLMTGKLQTRAER
FT                   EQALRQQDFEHKHAPLLPAQARSEPRYPHVFKTHDSRNTLALGGKRYGLPVGSRQIDEQ
FT                   RYTEFEIPASRVGTLASSQKLVEIKSLDGLCRGTFKGYKTLNRMQSLLYDVAYKTSENM
FT                   LICAPTGAGKTDAAMLTILNTIGKNTVPNPIEQPDAIEFAVQVDDFKIVYVAPMKALAA
FT                   EVTEKLGKRLAWLGIRVRELTGDMQLTKREIVETQIIVTTPEKWDVVTRKSTGDTELVQ
FT                   KVRLLIIDEVHMLHDERGAVIESLVARTQRQVESTQSLIRIVGLSATLPNYVDVAEFLK
FT                   VNKMAGLFFFDASFRPVPLEQHFIGVKGKPGSKQSRENLDIVAFEKVREMLERGHQVMV
FT                   FVHSRKDTVLTARMLRQMAVENGCEDLFSCHEHENYSNALRDMKHARARELRDLFASGF
FT                   GTHHAGMTRSDRNLMERMFSEGLIKVLCCTATLAWGVNLPAAAVVIKGTQLYNPQEGKF
FT                   VDLGILDVLQIFGRAGRPQFQDTGIGFICTTHDKLHHYLSAVTAQQPIESRFSSRLVDN
FT                   LNAEISLGTVTSVSEGVQWLGYSYLFVRMLREPRNYGIDFAEIRDDPMLVQRRRQLIIQ
FT                   AARVLQKSQMIIFNEKTEELRAKDVGRIASQYYVLQTSIEIFNEMMRPRAGEADVLRMI
FT                   SMSGEFDNIQARENESKELDRLRDEAIQTEVEGGNDSPHAKTNILLQSYISRAKLEDFA
FT                   LVSDMGYVAQNAARICRALFMIALNRRWGYQCQVLLSLCKSIEKQIWPFDHPFHQFDLP
FT                   QPILKNLDEKLPTSSLESMREMDVAEIGQLVHNQRMGKTLSKLLDNFPTLSVEAEIAPL
FT                   NRDVLRIRLSLYPEFSWNDRHHGASEAYWIWVENSETSEIYHHEYFILSRKKLHDEHEL
FT                   NFTIPLSDPLPSQIYVRAISDRWLGAETVTPVSFQHLIRPDTESVYTDLLNLQPLPISA
FT                   LNNPILEELYGQRFQFFNPMQTQIFHLLYHTSANVLLGSPTGSGKTVACELAMWWAFRE
FT                   KPGSKVVYIAPMKALVRERVMDWGKRLAAPMGLKLVELTGDNTPDTRTIRDADIIITTP
FT                   EKWDGISRSWQTRDYVRKVSLVIIDEIHLLGGDRGPILEIIVSRMNYIASQSKGSVRLM
FT                   GMSTACANATDLANWLGVKEGLFNFRHSVRPVPLEIYIDGFPEQRGFCPLMQSMNRPTF
FT                   LAIKNHSPEKPVIVFVASRRQTRLTAKDLINYCGMEDNPRRFVRMSEEDLQLNLARVKD
FT                   EALREALSFGIGLHHAGLVESDRQLAEELFANNKIQILVATSTLAWGVNLPAHLVVVKG
FT                   TQYFDAKIEGYKDMDLTDVLQMLGRAGRPQFDSSGIARIFTQESKKAFYKHFLHTGFPV
FT                   ESTLHKVLDNHLGAEISAGTIATKQDALDYLTWTFFFRRLHKNPSYYGLEISAEEHNTM
FT                   AAQAIAQDFMIDLVDKSLGELAESSCVVFDSATGEVDSTPFGKIMSYYYLSHKTVRYLM
FT                   SHAKPNPTFHDVFSWLCSATEFDELPVRHNEDLINAELARNLPLSVESMGDLPLWDPHV
FT                   KAFLLLQAYMSRIDLPISDYVGDQTSVLDQGIRIIQASIDIMAELGYVRACETLVSLLQ
FT                   SIKSARWPEDNALSILPGIEPTSKLQGLPGSLVALSSLPTASVSGLARKLQLPAEFTKA
FT                   ASYLPQVSVSVANVSSTGITVSLSRRNPPTNAEHRVYAPRFPKPQTEGYFLIVCSASAD
FT                   GKDGELLALKRVSWSANNKNQSSNSGSGSGSSQNPSGRSNYRNGALTVRSLVKFPQDFL
FT                   AQYTTATGKGVNVKVISDTYPGMQWVVSNVEVELKPETQSVPESSNYPEKA"
FT   CDS_pept        complement(861833..862195)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274719"
FT                   /orf_name="AFUA_4G03080"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /protein_id="EAL84456.1"
FT                   /db_xref="HOGENOM:HBG054357"
FT                   /db_xref="UniParc:UPI000051FD71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA07"
FT                   /transl_table=1
FT                   /translation="MSLTILDLQHQQRHQARNLQCYGCHQSFKTFSGMLIHLESGSCPS
FT                   GTDIDDINRLARQCYQSRKYIDTAGDYICPACDKFCSKLSGLFQHVEDSLGCLYLKEGG
FT                   QCLAKLEYYISWNVRR"
FT   CDS_pept        join(complement(864088..864422),complement(863405..864032))
FT                   /codon_start=1
FT                   /gene_family="HOG000161288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274720"
FT                   /orf_name="AFUA_4G03090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84457.1"
FT                   /db_xref="HOGENOM:HBG054360"
FT                   /db_xref="HOGENOM:HBG327437"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI000051EEE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA06"
FT                   /transl_table=1
FT                   /translation="MRLSYRVGLAALLILAFVLIKRHLDSLQDGSHVPSSWQFSNVVWG
FT                   GAAEPVATPASKPEKEKPQTPAPAVEQSLPIKQTYEITPIIVPNDRVIVMARLSREDTS
FT                   WVSTDLNEWRNFIYTVDDVNAARHTPKNKGRESLAYLQYIVDHYHDLPSTMVFLHSHKD
FT                   GWEAGWHTDTLDYSNVESVRTLQTEYVQKSGFVNLRCQGNPGCPDEIRPLDDPPRPGKE
FT                   NSRVYARAWEELHNNTNIPEVVGAPCCSQFAVSKAQVLKRPLSDYQRYYNWVLTNNLPD
FT                   ELTAWIMEYSWHIIFGKDPVFCPDIYQCYQNVYGNPYSW"
FT   CDS_pept        join(complement(867234..867279),complement(866327..867165))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274721"
FT                   /orf_name="AFUA_4G03100"
FT                   /product="Ras-like GTP-binding protein, putative "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL84458.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000051F65E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA05"
FT                   /transl_table=1
FT                   /translation="MSSSLEAKIVVLGSQGVGKTSLVQRYVKNAFNPATITSTVGASFI
FT                   TKRVLDTTSDTIVRLQIWDTAGQERFRSISRLYYRGANACLLCYDITDEQSFEEMTGWL
FT                   LELKKHLADDDPIVIHVVGTKSDIVTLDPSRRRVPFERTIAYVAEQLYPSRASTPPPTA
FT                   GMGLGLGPSSTALQSPDSKRSSGFWGQDIGWDCCHEISAKDGEGIEEVFRVITRKLVEQ
FT                   RNKREAANSLSQGTTPGIDGVVSSLGNIDGNGSFRLGHGDKRRSWLGFPPSSTGDEADE
FT                   LMEITKKKGGRCC"
FT   CDS_pept        join(complement(870156..870249),complement(869987..870094),
FT                   complement(869386..869926),complement(868474..869317))
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905741"
FT                   /orf_name="AFUA_4G03110"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84459.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E59C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA04"
FT                   /transl_table=1
FT                   /translation="MAPSYAGMSGRPLSLTVSTIATMGFLLFGYDQGVMSGIISDNAFA
FT                   KVFTATKDDATMQALVTAVYELGCLVGAIFALFFGDRTGRRWMIFSGAIVMIVGVIIQV
FT                   TSFVGHIPLLQFFIGRVITGIGNGMNTSTIPTYQAECSKTSNRGLLICIEGGVIAIGTA
FT                   IAYWIDFGAHYGPDDLVWRFPIAFQIFFGLIIIIGMFFLPDSPRYLISKDRIQEGEYVL
FT                   AALAGREVHDHETQIQKQSVIESIRASGSAQKTRFRDLITGGRTQHFRRMLIGSSSQIF
FT                   QQLGGCNAVIYYLPVLLKESLHQSNDMALLIGGINMIVYSLFATFSWFFIEKIGRRKLF
FT                   LGGSFLQTISMVITFACLIPGDEQTSKGAVFGLFLYMAAFGAAWLPLPWLYPAELSPIK
FT                   TRAKANAVSTCSNWLFNFTVVMITPVMVAHIGWGTYLLFAALNASFIPVIWLFYPETAN
FT                   RSLEEIDLIFTKGYVENISYVKAARELPKLIDDEIEAKAAEYAFASGDSLDEIEKAHAE
FT                   HNAAQRLETTQ"
FT   CDS_pept        join(874476..874584,874637..874950,875007..876086)
FT                   /codon_start=1
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274722"
FT                   /orf_name="AFUA_4G03120"
FT                   /product="Mitochondrial cytochrome b2, putative "
FT                   /EC_number="1.1.2.3"
FT                   /function="FMN binding"
FT                   /function="L-lactate dehydrogenase (cytochrome) activity "
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84460.1"
FT                   /db_xref="GO:0004460"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG516177"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0000520921"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA03"
FT                   /transl_table=1
FT                   /translation="MKQGKLTGAEVAKHSSKDSCWVIVHGKAYDVTEFLPEHPGGQKII
FT                   LKYAGKDATEEFDPIHPRDTLDKYLDRSKHLGEVDMATVEQEEKAHDPDETERQERIKQ
FT                   MPPLQACYNLMDFETVARSVMKKTAWAYYSSGADDEITMRENHNAFHKIWFRPRVLVNV
FT                   ENVDFSTTMLGTKVSVPFYVTATALGKLGNPEGEVVLTRAAYKHNVIQMIPTLASCSFD
FT                   EIVDAKQGDQVQWLQLYVNKDRNITKRIVQHAEARGCKGLFITVDAPQLGRREKDMRSK
FT                   FSDVGASVQASGGDEVDRSQGAARAISSFIDPSLSWKDIPWFQSITKMPIILKGVQCVE
FT                   DVLRAVEMGVDGVVLSNHGGRQLEFARSAIEVLAEVMPALRERGWENKIEVYIDGGVRR
FT                   ATDILKALCLGAKGVGIGRPFLFAMSAYGQPGVERAMQLLKDEMEMNMRLIGVSKIEEL
FT                   NPSLIDVRGLTGGHHAPVPSDTLTLGAYDPLQAPRFSEKSKL"
FT   CDS_pept        complement(876402..877496)
FT                   /codon_start=1
FT                   /gene_family="HOG000171559" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210321"
FT                   /orf_name="AFUA_4G03130"
FT                   /product="Phosphoric ester hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84461.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054361"
FT                   /db_xref="HOGENOM:HBG385841"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000051F63B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA02"
FT                   /transl_table=1
FT                   /translation="MSSPFDRRPLPDYLLSSPLTALLYPLHYILLRLRGPPRLPSPDTH
FT                   PIRVVCISDTHTLEWDDVPDGDLLIHAGDLCNDGSIREIQAAVDWLQRLPHPHKVVICG
FT                   NHDSYFDIRSRRDEDRDASSSSFAAISSSTASIRSLDDDPDGLNRINWGDIHYLQHSSI
FT                   TLSFPPPSPAHAAARPRSLTIYGAPQVPAIVPFTSEHAFTYHPQHDAWSGTIPPDTDIL
FT                   ITHTPPQAHLDLSPVYSTGCPFLLAETWRVRPALHVFGHVHEAYGCEPVYWDEAQRAWE
FT                   RLCASRRPRARYGRLMSVFGLLRDLFDVHGWLDAMRVVTYGVLGVVWAKVWGGENRGCG
FT                   WMVNAACMYRNTGRLGNKPQVVVL"
FT   CDS_pept        join(879363..879544,879704..880515,880578..880662,
FT                   880724..880958,881024..881461)
FT                   /codon_start=1
FT                   /gene_family="HOG000171558" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753604"
FT                   /orf_name="AFUA_4G03140"
FT                   /product="Serine protein kinase Sky1, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL84462.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051EA4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA01"
FT                   /transl_table=1
FT                   /translation="MDGVDITKAVINKGKQMASVAANAANGNGGRKKRKGTDLKPIVTN
FT                   DAASPAIDPSATTTEGGSVPVKSAYDMPPSRSASSSSVEEIETTAEEEDSEDYCKGGYH
FT                   PVTVGETYNNGRYVVVRKLGWGHFSTVWLSRDTTTGKHVALKVVRSAAHYTETAIDEIK
FT                   LLNKIVQAKPSHPGRKHVVSLLDSFEHKGPNGVHVCMVFEVLGENLLGLIKRWNHRGIP
FT                   MPLVKQITKQVLLGLDYLHRECGIIHTDLKPENVLIEIGDVEQIVQTYVKEEAKKENKD
FT                   DSRSGRRRRRTLITGSQPLPSPLNTSFSHHDFKHSSSNSHSGLSQVIESSNTSTQEGAS
FT                   MKELLGIKADEKQKEREKTTDLLEREVSGISLDKQSSQEESEDPLCDIISVKIADLGNA
FT                   CWVGHHFTNDIQTRQYRSPEVILGSKWGASTDIWSMACMVFELITGDYLFDPQSGTKYG
FT                   KDDDHIAQIIELLGPFPKSLCLSGKWSQEIFNRKGELRNIHRLRHWALPDVLREKYHFS
FT                   VEESMRISEFLLPMLELPPEKRANAGGMAAHEWLSDTPGMKGVDLGIPPGSRGEGIDGW
FT                   ASEVKKR"
FT   CDS_pept        join(complement(882477..882591),complement(882053..882396))
FT                   /codon_start=1
FT                   /gene_family="HOG000244138" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905742"
FT                   /orf_name="AFUA_4G03150"
FT                   /product="MGMT family protein"
FT                   /function="catalytic activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="EAL84463.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG533762"
FT                   /db_xref="HOGENOM:HBG752398"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniParc:UPI000051F649"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA00"
FT                   /transl_table=1
FT                   /translation="MPRSDEADWWFNAVYEAVQSIPYGKVTSYGHIALLLGEPKRPRQV
FT                   GICLKHLPSDTSQHFHSGNVPWQRVINSKGMISHRYVDEMLSKFHDADFCRGPGSAERQ
FT                   AEALRQEGVQVDVDSMGDFYVDFARYGWFPERLPGEESEDSEDEGDAQ"
FT   CDS_pept        882852..883886
FT                   /codon_start=1
FT                   /gene_family="HOG000171537" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274723"
FT                   /gene_name="cwc26"
FT                   /orf_name="AFUA_4G03160"
FT                   /product="Pre-mRNA-splicing factor cwc26 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL84464.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG054362"
FT                   /db_xref="HOGENOM:HBG736619"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniParc:UPI000051EA3E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9Z9"
FT                   /transl_table=1
FT                   /translation="MPPSSLAEYLAKKYLTADPATDRPKKKRKKTKTVDTAGDGLIIAD
FT                   DDPPDLRTSATNFDNEDDEGPSLVTSVRSAEFRRAKKSNWRTVGGPATGSSNANDERDA
FT                   ADAILASAAAESAARRGEGEGGDDEAPAVVDEADADDGGELRMESGARAGLQTAEQTAA
FT                   MVAAQERRKKAEAARHRERPAEAQETIYRDASGRIINVALKRAEARRAEQEKREKEEAA
FT                   KEALMGDVQRAEREARRQQIQEARAMPLARTIEDDALNEELKAQQRWNDPAAGFLTKTK
FT                   GPGVSVTGKPLYKGAFQPNRYGIRPGHRWDGVDRGNGFEKEWFAARNKKGRLEALDYQW
FT                   QMDE"
FT   CDS_pept        join(885891..886078,886139..886514)
FT                   /codon_start=1
FT                   /gene_family="HOG000171515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274724"
FT                   /orf_name="AFUA_4G03170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84465.1"
FT                   /db_xref="HOGENOM:HBG054363"
FT                   /db_xref="HOGENOM:HBG327434"
FT                   /db_xref="UniParc:UPI000051FB3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z8"
FT                   /transl_table=1
FT                   /translation="MVDMASETVVNSDLRRAGTEAKRQHDRKAKWAYGGRCALPRQNLV
FT                   APFLPITRPAKPLHRHLPAIKRSNQHSLNQLARYSRVSLHHDIQEMLDTGTSDSSSGEE
FT                   VEESVAVEKDPEVMIVDQDETVHPYEVAGQTILSDAVNKAVEKYETKETEKLVKEYEIV
FT                   SHESEMGTGYLADDDFELVDHVQL"
FT   CDS_pept        join(887522..887636,887696..888603,888658..889011)
FT                   /codon_start=1
FT                   /gene_family="HOG000171504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258987"
FT                   /orf_name="AFUA_4G03180"
FT                   /product="Nuclear envelope protein Brr6, putative "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84466.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG054364"
FT                   /db_xref="HOGENOM:HBG327433"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniParc:UPI0000520423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z7"
FT                   /transl_table=1
FT                   /translation="MEKRSAESPMDFEWQTRAPGDVTSPFYQLSMQHDNQKKRPHGIFD
FT                   SPQKKEIPALRAPNSQPFLFSQNPSLSSAKDPKSLFGQTAFTTPRKLDLDFSSGAENMS
FT                   SPENADNEDTPEQPARAGHRNSLFGMYGKFAPSPGRGEIPRLNHYSNALARRVQKRRRR
FT                   DKVLGLQLRRGDSDDDSDRPSSSEGKVAGKENSKQKTGQDGKSTSRLSSFSEFFALLEA
FT                   HPNVPSILSWWAQLVVNLSLFSLAVYVVFGFVSAIRAEFEQAAEEVSDTILAEMAVCAK
FT                   SYVDNKCAGGERLPALETICENWERCMNRDPAKVGRAKVSAHTMAIIINSFIDPISWKA
FT                   IMFFLATISTVTVVSNWSFRSFRNRFNQHEYAPPPPTFSRQPSGQHHPPMPSSQYSFQP
FT                   VPGLAYGDRGQEHIPNLDNKSEVPLMLEHPQMDFVTERTRDREKHMRTPSPVKRSRHFS
FT                   "
FT   CDS_pept        join(889865..890159,890226..890592,890644..891017,
FT                   891087..891429,891481..891529)
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258988"
FT                   /orf_name="AFUA_4G03190"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase subunit,
FT                   putative"
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="EAL84467.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniParc:UPI0000520906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z6"
FT                   /transl_table=1
FT                   /translation="MAPDSSQVKRNLIIVSNRLPVSVKRTDGSYKSSLSSGGLVTSLSG
FT                   LTKSTEFRWFGWPGLDVTEKKDRELVAQSLDEHNAVAVFLDANLANEHYNKFSNSILWP
FT                   ILHYQSGVVYDDGPWQAYRRVNELFADAVAEAATRGSLIWVHDYHLMLLPKLLRQRLNK
FT                   EKPCAIGFSLHTPFPAGDFWRALPVRNDLLEGMLASDLIGFHTDEYKSNFIQTCAQVLG
FT                   ARTEIPGRIQYKDRLVETDKFIVGIDPQKFKDTLQKQEVQDRIKQLEEKYKGITVIIGV
FT                   DRLDYIKGLTQKLKGYDHFLDRHPELRNKVILIQVAVPSREDVKEYQELETELSTIAGK
FT                   INGKHSTPDGVPLLYMHRSVPFTELTALYSIADACLLTSTRDGMNLVSFEYIACQEQRH
FT                   GVLVLSEFAGAASFMKEGSISFHPANTTELADAVYKAVMMGEDEKKKKYEYLRNFIETN
FT                   TSARWGETFIDRLSKHI"
FT   CDS_pept        join(896022..896301,896353..896570,896645..896885,
FT                   896935..897545)
FT                   /codon_start=1
FT                   /gene_family="HOG000171493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749747"
FT                   /orf_name="AFUA_4G03200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84468.1"
FT                   /db_xref="HOGENOM:HBG054366"
FT                   /db_xref="UniParc:UPI000051FB3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z5"
FT                   /transl_table=1
FT                   /translation="MKFTAFSLLSLACAAVASREGEAAMDRLMSVKVEERERFRAEGLF
FT                   DANQYPDLGSQKCVNGKAGEYSCENVDLLGFLSHQAMGSKTREGNDIWGWTSPDGREFG
FT                   IIGQTDGTAFVEVHADGSLDYVGRLPTQTQSSVWRDMKVIGDHVYIGSEAPGHGLQVFD
FT                   LKKLLRTDPSKPTTFSISRDLTAWYNAFGSSHNIVAHEETNMIYAVGTTRSHSCAGGLW
FT                   MVDVSNPAKPISPGCVNQDGYVHDAQCVIYKGPDKKYNGREICFNYNEDSLTIVDVSNK
FT                   KSPVQISKTPYAGSSYTHQGWVTDMEDMSYLLLDDELDEKDGTGVAANGHTTTYVFDIR
FT                   NLAKPKHTGTYQSPVKSIDHNQYVLNGLSYMSNYSSGLRIVDVRSVTQDPTGAKFKQVG
FT                   FFDCHPDDDAEGGKVQFVGSWSVYPYFKSGNILLNSIERGVFSLKYTGPK"
FT   tRNA            complement(896061..896148)
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        join(900166..900333,900388..900605,900659..900926)
FT                   /codon_start=1
FT                   /gene_family="HOG000171425" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19901720"
FT                   /orf_name="AFUA_4G03210"
FT                   /product="Probable cutinase 3 "
FT                   /EC_number="3.1.1.74"
FT                   /function="cutinase activity"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84469.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0050525"
FT                   /db_xref="HOGENOM:HBG052940"
FT                   /db_xref="HOGENOM:HBG567328"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR011150"
FT                   /db_xref="UniParc:UPI0000520914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9Z4"
FT                   /transl_table=1
FT                   /translation="MSLRSLFVAGLATLALAVPAPQIQARQGMSSNELESGPCRDVTFI
FT                   FARGSTEQGNMGLIVGPGVCSSLKKDLGSDKVACQGVGGAYTAQLAPNFLSQNTNQASI
FT                   NAATDMFDLANTKCPNTKIVAGGYSQGSAVIDNTIQALGSDLKAKVKGVVLFGFTRNVA
FT                   DKGQIPGYPKDQTKIYCAVGDMVCVNTLIITPAHLTYGADAGDAAKFLASKVQE"
FT   sig_peptide     900166..900216
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9Z4 "
FT   mat_peptide     join(900217..900333,900388..900605,900659..900923)
FT                   /product="Probable cutinase 3 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9Z4 "
FT   CDS_pept        join(902583..902716,902763..902889,902941..903098,
FT                   903148..903327,903380..903474,903525..903896,9
FT                   03945..904357)
FT                   /codon_start=1
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206303"
FT                   /orf_name="AFUA_4G03220"
FT                   /product="Amino acid permease"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84470.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051FDA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z3"
FT                   /transl_table=1
FT                   /translation="MHANVWPGIIGPGLLVGSGNALSKGGPAGVLISFSLVGIIVFFVM
FT                   QSLGEMATLIPVTGSFTEYAQRFIDDSLAFGLGWAYWYLWVTVLANEYNAISLVIGYWT
FT                   DAVPQWGWILIFWFLFLGLSNLGVLAYGEMEFWLSLIKILALIAFFILAVCISTGGIGP
FT                   QPIGFKYWHDPGPFADSINGVARTFVVAGTLYAGTEMVGITAGESANPRKAVPTAIRQV
FT                   FWRILIFYIGTMFFIGILLPYNDKRLLGSSSNAASSPLTIALTDAGILPAAHLINALIV
FT                   ISVISAGNGSLYVASRTLLFMARNGKAPRFIGRTNGAGVPWVALIFSNLFTCIVFLTQS
FT                   SGAGKIYSALITLSGVATFIVWAVIGICHIRFRRALVVQGEDPAKLPFKAWLYPWGTYF
FT                   SVALNIFLVFFQGYTAFLNPFSADDFVINYILLPVFALFVLGYKFWHKTRWVKLEEMDI
FT                   WTGRRESPDVDVTDEPPVKKQKSWWARVLAVVIG"
FT   CDS_pept        join(905518..905532,905599..905979)
FT                   /codon_start=1
FT                   /gene_family="HOG000217295" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258989"
FT                   /orf_name="AFUA_4G03230"
FT                   /product="Extracellular guanyl-specific ribonuclease RntA "
FT                   /EC_number="3.1.27.3"
FT                   /function="RNA binding"
FT                   /function="endoribonuclease activity"
FT                   /function="ribonuclease T1 activity"
FT                   /protein_id="EAL84471.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004521"
FT                   /db_xref="GO:0046589"
FT                   /db_xref="HOGENOM:HBG054367"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniParc:UPI000051F898"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z2"
FT                   /transl_table=1
FT                   /translation="MLYKKIIAVAALLVAPVLAAPTEFDTRACDYTCGSNCYSASAVRA
FT                   AQEAGYELYSSDETVGSNNYPHKYNNYEGFDFPVSSPYYEWPILSSGKIYSGGSPGADR
FT                   VVFNSKDELAGLITHTGASGNNFVACT"
FT   CDS_pept        911258..912112
FT                   /codon_start=1
FT                   /gene_family="HOG000171414" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16258990"
FT                   /orf_name="AFUA_4G03240"
FT                   /product="Antigenic cell wall galactomannoprotein MP1 "
FT                   /protein_id="EAL84472.1"
FT                   /db_xref="EMBL:AAG09624.1"
FT                   /db_xref="HOGENOM:HBG331717"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI000006BCCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q9HFP8"
FT                   /transl_table=1
FT                   /translation="MRFSALLVTLGLTGALATPTLVSREAPAVGVISDISAQTSALASA
FT                   VSSYNGGDPSAVKSASEKLVSTINSGVDTVKSGPALSTADALALTSPVQDLTKQVEGVI
FT                   DDLISKKDKFVAANAGGTVYEDLKAQYTAADSLAKAISAKVPESLSDIAAQLSAGITAA
FT                   IQKGIDAYKDAASSTGTASSSAPATETATATETSTATGTVTETATSTPVIPTGTASGSA
FT                   SATPSTTATPTTGGSGSGSGSSTGTATASTSTNLLSTGAASKEHFSYSLGGAVVAAAIA
FT                   VAL"
FT   tRNA            complement(912922..913009)
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        join(complement(919374..919566),complement(919300..919319),
FT                   complement(919113..919247))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206304"
FT                   /orf_name="AFUA_4G03250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84473.1"
FT                   /db_xref="HOGENOM:HBG054369"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI00005201F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z0"
FT                   /transl_table=1
FT                   /translation="MEAEEAARDLLRAIFVTPSQKVSEKYIEAVIDAAVSFTVNVVPTG
FT                   SLSRTRALARAYTLIFIHDDAVESGNFDATIPNMCNNNERHSHTAFDMVAQEVMSEDTA
FT                   QGRRFLDGMMS"
FT   CDS_pept        join(922668..922885,922933..923386)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258991"
FT                   /orf_name="AFUA_4G03260"
FT                   /product="Epoxide hydrolase, putative "
FT                   /function="epoxide hydrolase activity"
FT                   /biological_process="response to toxin"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84474.1"
FT                   /db_xref="GO:0004301"
FT                   /db_xref="GO:0009636"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054370"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="UniParc:UPI000051FFB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y9"
FT                   /transl_table=1
FT                   /translation="MSAFSKLPSGASIALKPFRVSIPEEELDEFQALLKLSKIAPPTFE
FT                   NSRPSGQYGITSDWLTTLRKQWQKDFDWRACEAKANLFPQFTVDIEDIKLKFAALYSKK
FT                   PDAVPITLIHGWPGSYTEFLPMLQLFSEEFTPITLPYHLIVPSLPGCAFSWGPPLDRDF
FT                   TSEDSARILDKLMQALGLVGAILHRVAILVPGCLGSWSLTMLVAKVRPDSALMCLVTDH
FT                   V"
FT   CDS_pept        join(923462..923809,923873..924019,924061..924156)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258992"
FT                   /orf_name="AFUA_4G03270"
FT                   /product="Epoxide hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84475.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054371"
FT                   /db_xref="UniParc:UPI000051E7F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y8"
FT                   /transl_table=1
FT                   /translation="MEPPEGAADTTLTDQEKRGRRADERLPHFRQNLCIRARNQTQHHW
FT                   ARSVQQPNCLACLVPTLTYYKDHTMSHNDHRCGKNFLDWVNDSLPLDTILEFVSLYWFT
FT                   KSFPRAIYPYREAPHDADAMHDRLYIQKPLGFSYFPNEIIPAPKAWVSTTGNLVFWRQH
FT                   DKGGHFAALERPHDLKAALSAFVEQVWPEVASK"
FT   CDS_pept        join(927891..928325,928634..928675)
FT                   /codon_start=1
FT                   /gene_family="HOG000048679" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749748"
FT                   /orf_name="AFUA_4G03280"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84476.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054372"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E59D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y7"
FT                   /transl_table=1
FT                   /translation="MNNYNSVLSFAKTLEEEVPTVNILLLNAGIGLLKLERSPSGHDCV
FT                   TQVNYLSNALLIAALLPYLKASSETSGVPSRITWVGSRMYFTTSLEEKAPIKTGESVLE
FT                   HMDSKEFFFPKERYNDTKLLCAMFMYSLAQRLDKSKVILNMLLKNSYGLRLLKK"
FT   CDS_pept        complement(931706..932743)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258993"
FT                   /orf_name="AFUA_4G03290"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84477.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054373"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F8A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y6"
FT                   /transl_table=1
FT                   /translation="MRAFGNRLALTHLPAMVATYNQGTRASELVRQYAPQIAGKIILIT
FT                   GVSPGSLGESFVKQVAVAQPAMFILASRSISKVQNLIDELATAYPSVKVKPLYLNLLSF
FT                   DDVREAAETVNSWTDVPHIDILVNNAGIMAVPYKLTEDGYESQFQTNHLSHFLLTNLLM
FT                   GKILASKTPRIVVVSSNVHRIGHIHWSDPNFNGGKHYQRWLGYSQSKTANALMGVSLAE
FT                   KLGHRGLLAFPICPGVSLTNLAAHGREDLAAFSADLTDMDNIYGNKWLWGMAEMKIKDL
FT                   DQGAATHVFAAFDTSIANQNGAFLSDCHAADPDMEEVHSWATSKVDAERLWRMSEKLVG
FT                   QEFKY"
FT   mobile_element  933970..934143
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   CDS_pept        join(937257..937464,937576..937988,938035..938545,
FT                   938595..938668)
FT                   /codon_start=1
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206305"
FT                   /orf_name="AFUA_4G03310"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84479.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054375"
FT                   /db_xref="HOGENOM:HBG326851"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0000520451"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y4"
FT                   /transl_table=1
FT                   /translation="MSQMRSSPYSTHANKEKQKAPLRKKACQNCTKSKVRCGLEKPICS
FT                   RCRSKGHSCQYPPGRVAAPQIGVTAAASRSPRPRAVTSGQTRRLDLDFTDIDLTPSLNA
FT                   VDIRDRWLRPYLLPPLGRDEILKAYHLFTLQYISITLRTYPQYMVKDGGFPPIIHHTQV
FT                   NTNQMPQALANCYSLVRMWVQAAPGSETMVMSAVEAEMERLASETTSQHDYDLLCSFQA
FT                   YLVYTILMYFSPLGNVSAVTDKIMMTLMELAFRTAQNGLLCTAETTHTRPNWESWIVVS
FT                   AKRRAIYTMYLLTSVYNSDRGLPNFVADEMKGVYVPESKVLWEVTDREVWEKEYDRHLL
FT                   EWEDGMLEISELWRSTETGSTERRERIGRWVRGVDEFVPTEFRRAPSELRNRQASTLCG
FT                   ST"
FT   CDS_pept        938745..939554
FT                   /codon_start=1
FT                   /gene_family="HOG000252117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901721"
FT                   /orf_name="AFUA_4G03321"
FT                   /product="UbiE/COQ5 methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL84480.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG048333"
FT                   /db_xref="HOGENOM:HBG398028"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051EEEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y3"
FT                   /transl_table=1
FT                   /translation="MSRKAVYITDHAPSVLQTHSWRTASNSAAYLVPYIKPSMKILDIG
FT                   CGPGSISIDFARLVPQGHVTAIEYVADPLDAARSLASAHGLTNIDFRVGDIHSLDFPDD
FT                   TFDIVHVHQVLQHIADPVRALREMRRVAKSDGGIVAARESASMTWYPDNAGIAGWKEVT
FT                   DRMCKAKGSNPHPGRYIHVWAEEAGFQGTRIKKSAGAWCFSSPEERKYWGGSMEARMRS
FT                   SGFSKMAVEEGYATKEELETIANGWRDFVKDDQAWFGLLHGEILCWK"
FT   CDS_pept        join(complement(940513..941164),complement(940291..940412))
FT                   /codon_start=1
FT                   /gene_family="HOG000171381" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206306"
FT                   /orf_name="AFUA_4G03322"
FT                   /product="WW domain protein"
FT                   /protein_id="EBA27179.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI0000F51A4E"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA62"
FT                   /transl_table=1
FT                   /translation="MSYYGERDTYYGGPPQPTYGRPPYDRPPYEQQQQQQPPYNRPPYD
FT                   IPPQDSPSYNRPPYERPPYERPPPERSPSSFDPSRPRYEGPPYNSSSPAPSAQPPAIPP
FT                   PPLPLGWVQEWEPNLRRAYFVETATGRSQWETPMQDSEHARGLSGPPPESASYYASPPP
FT                   PPPPQDGGYYPPPGEYPPPEEKKKKSSGMGKIIAGGVAGVALGAAGMALWEHEKREDEE
FT                   QEELKERVERLEEEQNHSSSSSDHERAHSPDVDDW"
FT   CDS_pept        join(complement(945437..945440),complement(945387..945404),
FT                   complement(944770..945253),complement(944643..944658),
FT                   complement(944489..944596),complement(944370..944441),
FT                   complement(944237..944314),complement(943030..944185),
FT                   complement(942783..942969),complement(942660..942726))
FT                   /codon_start=1
FT                   /gene_family="HOG000083011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258994"
FT                   /orf_name="AFUA_4G03320"
FT                   /product="Membrane bound cation transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EBA27180.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG738140"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI0000F51A5D"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA63"
FT                   /transl_table=1
FT                   /translation="MLCFFQNNRIQSWAKAHASHRSSAPQDPSKRPTNEAQDSETAEPR
FT                   HNGQVKEQTGDLERPQSNPQDEQTKSNQGLVVRMRNGTVRFGRHTKEALFHSWVNVLLV
FT                   FVPVGIVVEAIGLNPAVIFAMNAVAIIPLAGILSHATECVASRLGDTVGALINVTFGNA
FT                   VELIIFIALVKNEIRIVQASLLGSILANLLLILGMSFLLGGLRFQEQIYNSTVTQMSAC
FT                   LLSLSVTSLLLPTAFHASWSNSASADRNTLKVSRGTSVVLLLVYILYIIFQLKSHSYLY
FT                   ASIPQRIIDEESHPGVLAEFMNSSSDSSSSSSDDSDDTTTSWTTAKRIKRAMRHRRRRK
FT                   SSTSSNHTASGTLSKKHSGDTARPGQNEKSGSTEGPISNHSIAIDFADDGHYEADDDKR
FT                   RNEPRSIDFGPRSIGDQETRKKDRKAKKRTSKKHKARKEDNANTLDTDASTQRPCLPSP
FT                   QPVPGPDGINSSQQAEVAAALPKRRSPFRPAIPSLLSNTVFSNTAASNNLAPGEPGLRR
FT                   TRSLPSHMNRPPPVGNAVQFARGAARMPTTLDVTANNAPPEHKEPEISRTAAVVMLLVS
FT                   TALVAVCAEFLVDAIPEMIESSSVSEAFIGLIILPIVGNAAEHVTAVSVATKNKMDLSI
FT                   GVSVGSSIQIAIFVTPLVVILGWCMDKDMSLYFTLFETICLFVTAFVVNFLVLDGRSNY
FT                   LEGALLIAAYVIISVAAFFYPGSDQSADVASRGSS"
FT   CDS_pept        complement(947858..948094)
FT                   /codon_start=1
FT                   /gene_family="HOG000171355" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901722"
FT                   /orf_name="AFUA_4G03325"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27181.1"
FT                   /db_xref="UniParc:UPI0000F51A59"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA64"
FT                   /transl_table=1
FT                   /translation="MLNCIINTINVHQPLSTSLDLMARRVFPGQNVAFGLSLFLFTFMF
FT                   LPTLVMLLAVIVFFAFYYPQLGKSTAAQNDDYE"
FT   CDS_pept        join(949509..949605,949678..949831,949883..950171,
FT                   950217..951866)
FT                   /codon_start=1
FT                   /gene_family="HOG000171344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055107"
FT                   /orf_name="AFUA_4G03330"
FT                   /product="Plasma membrane stress response protein (Ist2),
FT                   putative"
FT                   /protein_id="EAL84482.1"
FT                   /db_xref="HOGENOM:HBG054352"
FT                   /db_xref="HOGENOM:HBG327420"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI000051EA4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y1"
FT                   /transl_table=1
FT                   /translation="MALLFFHNHQFEHAELDNLGVDWVIHYQFEEVDTYQAVEVFQNLI
FT                   HNLKAAQLQIQVRHGYGSSLLVCVRVPRDHLGRMIYESRVKDWLYGIVHELPVASDHAV
FT                   AETPAEELRSVYHAVTWQRHLGGAGITPGIGQWKNIASAFPLHDQAANAELLRNMSRSL
FT                   TLTDKDLDAIRALFGEKTAFYFAFIHSYSSFLVVPAVWGIICWSYFGPYSVNCAVVNCL
FT                   WCIVFVEYWKIRETDLSLQWNVKGVGALKVNRPQYVWDKEIQDPITGETVRVFSMRKQL
FT                   LRQLLLIPFATVAAVALGSLIVVTFALEVFISEVYVGPLKGYLEFLPTVLFSLSLPTIT
FT                   SKLTDIATQLTEYENYRTQDQYDLAQTAKTFVMNFITAFLPTLLTAFVYVPFGAKIIPY
FT                   LDVFHVRGLHSSISTEFQVDTSRFQQEVIYLSVTGQVVSFGEEVILPYVKKVIWRKWRD
FT                   YRLQKTQAGRPRRHSKMTDLLLIDSPSEAAFLTRIRNEAEADEYNVHEDTLEMCVQYGY
FT                   LALFGVAWPLVPLLFLINNWLELRGDFFKLTLECQRPPPIRADSIGPSLQGLEFLTWLG
FT                   TLSTASIVYLYRDGMKEVHMSSLLLVLFIAQQVYLAVRFAVRTGLQKLGSGTLRREAAK
FT                   RYAVRKSYLEKFCARRTHGNGKPRVRFNDHVDVYSSSTDSSPTEALETKSATLHQETAY
FT                   ASEREEEFWEGQRWTAEEVGVKLIKALSGEEKKRE"
FT   CDS_pept        complement(952507..955101)
FT                   /codon_start=1
FT                   /gene_family="HOG000171322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258995"
FT                   /orf_name="AFUA_4G03340"
FT                   /product="DUF1212 domain membrane protein "
FT                   /protein_id="EAL84483.1"
FT                   /db_xref="HOGENOM:HBG124694"
FT                   /db_xref="HOGENOM:HBG324120"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniParc:UPI000051FB42"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y0"
FT                   /transl_table=1
FT                   /translation="MSDSRQGSESSAATYHSQPESENTQDSVGPESPGSPPAPPGSPRS
FT                   PEQQSQDGDNQEIPNIETTPKSGENGEGSQKRQRVRFRSAISVDYPQPGGPESSEDERS
FT                   IQEKQKAQRDQAQRQGQPHLMSTPYVHGSLDVTETPLKERTTQEDLQQAEKTPVDKKPD
FT                   GIGAAAAVGDVSRTAKDKLRWLWDTVHGKLSKWSDRLGRPERGGDDLGPGVYHNEWTSG
FT                   GNAPLGDLTDNKHKTHEEKKSHQATSTSEAHRLVRELTQDQSGNRRKTRGKPYPHTDTQ
FT                   GGQGGQGNNAIESGLRYRAGGGGVLAQLMKLNGGMQQGGQAGQAGQGGQRSPSDTGTSG
FT                   TTTPKKEKLKWYKNKQHTRSTSTLVGASGSMSGASTPVSSEVLSAASKRLGGQQFQQGG
FT                   RMRLEDEIQVTVQIAEIIARQRYIMQLCKALMTFGAPTHRLEEYMQMTAKVLEVDSQYL
FT                   YFPGCMIMSFDDPSTRTTEVKLVRVAQGINLQKLANTHRIYKNVVHDVIGVEEAIQELE
FT                   DIQKKPPRFNKWIVVLVYGLASATVGPFAFNARPIDMPIIFFNGCLLGLMQQVFAPRSA
FT                   LYSNVFEVTAAVLTSFLARAFGSIPKAVIDGKRQFLFCFSAIAQSSIALILPGFLVLCS
FT                   SLELQSHQIIAGSIRMVYAIIYSLFLGYGITVGTTIYGLMDPSAVSDIQCPKAGAFKNP
FT                   YLQRFPFVAIMTVWLLIINQGKWKQLPVMSTIAMSGYITNYFSTKRLGSNSQVANTVGA
FT                   FTIGIMGNLYSRLWHGHAATAILPAILVLVPSGLAASGSLITGVASADQIRHNISSPSG
FT                   TSQPGAGLSTNSSVWTLAVGMVQVAIGITVGLFIAALVVYPYGKRRSGLFSF"
FT   CDS_pept        join(956640..957347,957398..959029)
FT                   /codon_start=1
FT                   /gene_family="HOG000185486" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258996"
FT                   /orf_name="AFUA_4G03350"
FT                   /product="Exo-beta-1,3-glucanase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="EAL84484.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG052608"
FT                   /db_xref="HOGENOM:HBG330508"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051FB3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X9"
FT                   /transl_table=1
FT                   /translation="MRGLLLLTTLASTLTSTLATASSAAVGARAPSCSGPVKSSPSTYW
FT                   LVEQDHIGNPRGYAPHAGGNYNYPVWRNVLDYGAKNDGSGDQTASLQKAINDNGSGGSR
FT                   ESSGVTRYPAQVYLPSGTYQLGSTLNLRVGTLIVGDPINPPVIKAVAGFNGNTLVNGYD
FT                   SKNGPPETSFMTLMKNVVLDTTALRPDTRITALQWGVAQGAGLTNVQINMPNYSTGHTG
FT                   IHVQAGSTIAITDVQINGGVVGIDNSNQQVNFKNIHFNGCTTAFRASGGHTALLQGATF
FT                   ENCGVGIDMTSNGLGSLVLLDSTSVNSGTTIKFHDSSNDGGNRNSQILIENLTHDNGNP
FT                   IAEDSKGNVKLANTSHVDTWVWGNVTPGQYETGTSFNTNRPNVLLSGGKFFMKAQPTYA
FT                   EYASDQIVNVKAVAGHTVKGDGYTDDSASLNAILADNAASCKISYFPYGVYIVKDTLII
FT                   PPGSRIVGEAWSVISGAGNAFKGARNPKAVVRVGNPGDVGVAEIQDMRFSVSEVLPGAK
FT                   ILEVNMAGSAPGDVGLWNTIVTVGGTAETSISTGCTNQDTSQCMAAYMVMHLTKSSSAY
FT                   IENFWGWTADHNLDGGSGYTVISTGRGVLVESTKGTWLTGTGSEHHWLYNYNFHNAENV
FT                   YAGLLQTESPYMQSSGATQTAPAPWTADSSVGDPDFSWCAGGDQKCRTALATNVDGGKD
FT                   VLLYNSAAWAFFDGEWYGDYGTQCSGNCQSNMMRVSNNPENLVWYSINTRKTNVMVLDG
FT                   QSNPTEYYHPGGWEAIIQAYRQFSSH"
FT   CDS_pept        960152..960748
FT                   /codon_start=1
FT                   /gene_family="HOG000171311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258997"
FT                   /orf_name="AFUA_4G03360"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL84485.2"
FT                   /db_xref="HOGENOM:HBG054377"
FT                   /db_xref="UniParc:UPI0000F51ABD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X8"
FT                   /transl_table=1
FT                   /translation="MQLVHLTALLLATATSTYAQDNNAIDSLVSAANNIVSNGQNIASN
FT                   VVADATSIASAFETGGAAAVSSLTSEAGAAASNVQSWASSVASDAQSRASDVASKASSA
FT                   WNEQLTTLTGTNGTPTATETRSVSETTSSTTATLTDTTTSTSGSFTTTMTRTSTSAGAA
FT                   GTSTSTSEGAGAQATPFLGAGIVGVAGVLGVMAAL"
FT   CDS_pept        join(complement(962840..962939),complement(962638..962783),
FT                   complement(962542..962589),complement(962343..962490),
FT                   complement(961757..962289),complement(961609..961695),
FT                   complement(961164..961548),complement(960937..961103))
FT                   /codon_start=1
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055108"
FT                   /orf_name="AFUA_4G03370"
FT                   /product="GABA permease (Uga4), putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84486.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG324420"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51A80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X7"
FT                   /transl_table=1
FT                   /translation="MILKMRSQTTVDAAGAEHGVDGHRAVVDDTQLLAELGYKQELRRQ
FT                   YSTLEIFAVAFSIMGLVPSIASTIAFSLPAGPVGMVWGWFTASILIFFVGLAMADMASA
FT                   MPTAGGLYWWTHYFAGEKFKNPLSFLVGYSNTLGLIGGMCSVDYTLSLLLLACISISRD
FT                   GEWSASNGTIYGVYVGVILVHAVCAVFAGPIMNKIQTFSIFVNVAMIIATVVALPVGKV
FT                   SRGQSLNPGSYVFGDVENLTTWPTGWAFVLAFLAPIWSIGFFDSCVHMSEEALHAAKAV
FT                   PLGIIWSSGCATVLGFLVLSVIAATMDPDVSKTMGSTFGQPMAQIYYDALGKKGALGFT
FT                   GVLIVIQFLVGLSLIVAASRQAWAFSRDGALPFSGYFRHISKRIRYQPVRAIVGFVAVC
FT                   IVAGLLCLINSIAANALFSLFVASNYVAWGTPILCRVVWSKKHFRPGEFYTGKLSRPIA
FT                   IVAILWLIFGLMLSMFPSGGPNPTPSTMNYTIVINGFVWVACMTYYFLFARKWYTGPKM
FT                   TIDSSSSEVVSPPEKDAAAN"
FT   CDS_pept        join(complement(965275..965583),complement(964923..965223),
FT                   complement(964539..964870))
FT                   /codon_start=1
FT                   /gene_family="HOG000171289" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16258998"
FT                   /orf_name="AFUA_4G03390"
FT                   /product="Aquaporin"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84488.2"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG541897"
FT                   /db_xref="HOGENOM:HBG705794"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI0000F51A67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X5"
FT                   /transl_table=1
FT                   /translation="MAFGKRNGEERRVLHRTQSQLPMLGLADSARNNLIAVVGEFVGTF
FT                   LFLFFSFAGTQVSNTPKPVAGAPPNTSNLLYSALSFGFSLTVNIWAFYRVTGGLFNPVV
FT                   SLALCLVGGMPPLRGVLVFMAQLVGGIAAAGVVSALFPGDLNVGTRLGGGASISQGLFI
FT                   EMFLTAQLVFVIIMLAVVKHKSTFLAPVGIGLTFFVTEMIGDYYTGGSLNPARSLGPDV
FT                   INRSFPGYHWIYWVGPLLGSLLACGFYAFLRMFKYESVNPGQDYDEWEAKRNHGSFDGN
FT                   GRESTAFSDSTAGAQSQSPRGVNRPVSGAEQV"
FT   CDS_pept        join(966892..967669,967724..968277)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749749"
FT                   /orf_name="AFUA_4G03400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84489.1"
FT                   /db_xref="HOGENOM:HBG054380"
FT                   /db_xref="UniParc:UPI000051F64A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X4"
FT                   /transl_table=1
FT                   /translation="MVCRPATYLGIAQALDHVLQYSSYLLLSVSMKRSDRHSSPRPGKD
FT                   PVGIVKHPQSGIAVSQVVIAMVMSGENQEIRVLRILSLFLHHLKDLAYGSFPYSCIPGL
FT                   LNPCKYAPCGFSLSGRQFIQLTGSSQVHRGPICSPKILPFSTCDHIPACYSWLTIMPFK
FT                   QHDGKIYRIAALLAFHVVFIISACPRQSSAAGDVFLFPPQSGYTGEYISNLAFTVGQSI
FT                   DIKWKSGCDESIQFWLMKDSNGGDCQFQRDARCSQIAETPNNGSTAWNVSFMGLAGPGV
FT                   YYIYGLCSDPGSTHFSCHYFNITSKPVSTSTTAPQATVTIPASTTQSRLQDPTTSISTS
FT                   LALVGTTKSTTPVGAIVGGVIGGLLIIGLTLIAGIVLLRKRASSDPGGSMPQTWRGKAE
FT                   FPEATPSGGHELPCPESSPGTTNHDDQGPQSPGNQRRAPIELPS"
FT   CDS_pept        969137..970378
FT                   /codon_start=1
FT                   /gene_family="HOG000238921" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19901723"
FT                   /orf_name="AFUA_4G03410"
FT                   /product="Flavohemoprotein"
FT                   /EC_number="1.5.1.34"
FT                   /function="6,7-dihydropteridine reductase activity "
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="oxygen transport"
FT                   /protein_id="EAL84490.1"
FT                   /db_xref="GO:0004155"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG004858"
FT                   /db_xref="HOGENOM:HBG623097"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051F647"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X3"
FT                   /transl_table=1
FT                   /translation="MPLTPEQVQFIKATVPVLAEHGTTITTVFYKNMLTAHPELNNVFN
FT                   TTHQVTGHQARALAGALFAYASNIDNLGALGPAVELMCHKHASLYIKPDDYKIVGKFLL
FT                   EAMGQVLGDALTPEILDAWATAYWQLADIMIGREAQLYEQAEGWTDFRDFVVALKVPES
FT                   SEITSFYLKPADGKPLPAFQPGQYISVQVHVPELNYLQARQYSLSDMPRSDYYRISVKK
FT                   ESGLNPAEPGAKAHPGHVSNILHASVNEGDTIKVSHPFGDFFLSDAKAAHPVVLLSAGV
FT                   GLTPMTSILNTLTSQAPERKVSFIHGARNARARAFKNHITSLEQKLPNLKSTFFTSHPT
FT                   EEDKEGDDYQFRGRVDLSQLDSNRDLFLDDATTEYYVCGPDTFMTDMLNVLKSKGVSED
FT                   RVKLELFGTGGVPH"
FT   CDS_pept        join(970475..970760,970826..971118)
FT                   /codon_start=1
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206307"
FT                   /orf_name="AFUA_4G03420"
FT                   /product="L-PSP endoribonuclease family protein, putative "
FT                   /protein_id="EAL84491.1"
FT                   /db_xref="HOGENOM:HBG054381"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000520424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X2"
FT                   /transl_table=1
FT                   /translation="MFHIRDIIYSRILHEYSSAEYIFRYSNIKATNSIKLQNYKTTKLQ
FT                   NYKTTKLQYNYVKMSHLTYYNYDGVGKAKQAQFKYSQAVRVGDRIECAGQGGWNPSTGT
FT                   IPRDINAQIDQAFANVDLNLRNAGGAGWSQVYRVNSYHVPINDEALEAMVRNFRKWVPG
FT                   HEPIWTCVGVTRLGEDDMRVEIEVVAHVP"
FT   CDS_pept        join(971333..971413,971475..972203,972250..972459,
FT                   972518..972645,972692..973469)
FT                   /codon_start=1
FT                   /gene_family="HOG000217290" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055109"
FT                   /orf_name="AFUA_4G03430"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84492.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054382"
FT                   /db_xref="HOGENOM:HBG326597"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F17D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X1"
FT                   /transl_table=1
FT                   /translation="MPPAEKKQSRGKYTTKACEECRRRRAKCDGKKPSCSRCLQWSISC
FT                   QYSSTEDGRRPASKSYVDLLRQRIQFLEDFLAKRGLDPDAETSLGEDSAEVSYMEALCD
FT                   QFKGCLALDESLNFDADGEMRFFGPTSGRLQFAAQGVSPEKDSNARVEPEPLASTAYDA
FT                   FVPTELETHLIDLYFAWEQPWYQIVDEDLFRDSMANRGRYFTPLLLYSILAMGSRYSDR
FT                   IETRTDANDPNTAGRFFLEQAKTLLHREMERPSLTTIQALGLIGMFYIATGADAAGWLH
FT                   HGMANRLSLDMGLNLDPAAFEGAVSMSSKEMQLRRQIYWTLYCHDKLSASYTGRVCSML
FT                   DVQGAVNLPSHAEASCSRQQTILSLQIALIRICQVHERILMSLWAPKPSLNQHQRPAFL
FT                   ELCLLDLKTWLYDLPPALRIDQPNPLPHAYTLHMVYHTARILLAKPFTVRHQSAAHDAD
FT                   ASGGAQTPTQARSVSTDSARAICAIAQKYRQHFGSFRLSPITATHCTLSAATVLLEDIA
FT                   GGDMLPSQKSRLEVCVGVLDELAGVWQPARRIGTNLRRLLRTRYNLTLLPGSRAESPLQ
FT                   ATADDLSAPSAGLDLDFVDEWNPAFLSPYAEGLPAALGLPPALDSLPVDYGLFDMLNRT
FT                   NLDRMW"
FT   CDS_pept        join(complement(974204..974273),complement(973787..974143),
FT                   complement(973613..973740))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258999"
FT                   /orf_name="AFUA_4G03435"
FT                   /product="Formate/nitrite transporter family protein,
FT                   putative"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27182.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI0000F51A9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA66"
FT                   /transl_table=1
FT                   /translation="MLRPRSPWGNLAGSLFVVAIIFGYGNVFAADPYKSEVIAFATKKQ
FT                   LTPDFHQIFLRGIGCNWLVCLACFLGVQGRDLASKVVGIWFPTFAFVSLGFDHLVANMT
FT                   FIPLAIWLGAPKITVALYIWKGIIPTLLGNIIGGGLFVATYYWYMYLVSGEMATLTGMR
FT                   QSATTTPRSLDIEAMAAEKQN"
FT   CDS_pept        join(975430..976106,976167..976620)
FT                   /codon_start=1
FT                   /gene_family="HOG000159139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259000"
FT                   /orf_name="AFUA_4G03440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84493.1"
FT                   /db_xref="HOGENOM:HBG054383"
FT                   /db_xref="HOGENOM:HBG670383"
FT                   /db_xref="UniParc:UPI0000520209"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X0"
FT                   /transl_table=1
FT                   /translation="MKSIFALTGLLSLVLSASAADPRLCPKGNDPLPASAFTLQQSKDN
FT                   SHLASLSHIFSVAGKNVSIARVLDSANRDLAKGKPPVGTTPVEAWKWNPGDMATKKWVP
FT                   QGITGSADASASGKWDGREMWLVSWHRDDDKSVRVSFVDRKTHKYRHVLLVEPTADDNF
FT                   AAVPVHAGGIAWYGEWLYVVDTSHGIRVFDLGQIWQVEDGDDVGKKGGKYSAAGYLYVL
FT                   PQIRSYKWTPGSSSPFRFSWISVDRSDNTLLVGEFIRDSSKDPIRLVKYPLDTNSGKLK
FT                   TNDKSIVTATFAHCADFLRMQGGFSYDNTFYISRSNGRSPKAGDMFKWKPGKPAELRNR
FT                   WFMAGNEDLSYNKVRKEYYTVSEYDGERFILAYNKM"
FT   CDS_pept        join(976914..977174,977243..977920)
FT                   /codon_start=1
FT                   /gene_family="HOG000171278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259001"
FT                   /orf_name="AFUA_4G03450"
FT                   /product="NmrA-like family protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84494.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054384"
FT                   /db_xref="HOGENOM:HBG327460"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F3E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W9"
FT                   /transl_table=1
FT                   /translation="MSQKIGIFPASGGLGTSIINHLVKLVPASQLILIARNPEKLASFS
FT                   RDGATIRRADYDDRASLERVFDGVGVLMLISYASFEIQHRVEAHKAAIDAARRSGVKHI
FT                   FYSSLAFAGDLGESSLAHVMGAHLATEKYLAELPGHFTYTAIREGLYSESFPIYTAWFD
FT                   PHQPVEEITIPHPGTGPGVAWAKRDELGEATAKMIYAYAKNTAGFPYLNRVVLLSGPRE
FT                   VSLAETAEVLGRAVGKPVRIREISVDEYVALPQIGDKHTYHGLNLSREWATAWAAIRAG
FT                   ETAVVSPLLGEILGREPEDFETTIRALVGAR"
FT   CDS_pept        join(981962..982249,982311..982922)
FT                   /codon_start=1
FT                   /gene_family="HOG000171267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259002"
FT                   /orf_name="AFUA_4G03460"
FT                   /product="HLH DNA binding domain protein, putative "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84495.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG051277"
FT                   /db_xref="HOGENOM:HBG327458"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000051EA53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W8"
FT                   /transl_table=1
FT                   /translation="MAYNNRPDASTAFTFDNDDRFVNQQPKGPDPLSANWSYDSAIDLF
FT                   SLNTMLPETFPLDIPNDMLLDPKDFPTDLFAPPADISGFAISHSGEDSLSSDQESEDQP
FT                   WSPAYRVSSLDSTTPDAPTVSPRSTEKPATRRRTTTQKREQATRWSSSPEMTPQEYPVT
FT                   SQATTSPAPAPVSPPAASTSRKNSRSLSTDSQTATGRNAAKRAAHNIIEKRYRTNMNAK
FT                   FVALEKAMSGSGVQKPTKGGSGPASLKKSEILTNAIAYMQELQDQNAALQKELALLKQN
FT                   LLPGGLWRHNKENDKFRT"
FT   CDS_pept        985297..987063
FT                   /codon_start=1
FT                   /gene_family="HOG000217289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259003"
FT                   /orf_name="AFUA_4G03470"
FT                   /product="Tannase, putative"
FT                   /EC_number="3.1.1.20"
FT                   /function="tannase activity"
FT                   /protein_id="EAL84496.1"
FT                   /db_xref="GO:0050318"
FT                   /db_xref="HOGENOM:HBG054385"
FT                   /db_xref="HOGENOM:HBG325297"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniParc:UPI000051EEF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W7"
FT                   /transl_table=1
FT                   /translation="MRISYGSAVAALAAAANAASLADVCTISHVQSVLPSNGTLLGINV
FT                   IPSAVTASAVYNSTSSGGMGGMGGSNSANYPYCNVTVTYTHPGKGDKVVVKYAFPQPSD
FT                   FKNRFYVAGGGGYSLSSDATGGLEYGAASGATDAGYDAFSYSYDEVVLYGNGSINWDAT
FT                   YMFAYQALGEMTTLGKTLTRNFYGLSSDAKIYTYYEGCSDGGREGMSQVQRYGDLYDGA
FT                   ITGAPAFRYAQQQVHHVFSSVVEKTLDYYPPPCELAKIVNATIEACDPLDGRTDGVVSR
FT                   TDLCKLHFDLSKIIGEPYYCAAKTSTSLGFGFSKRQAAGSTTSYQPAQNGTVTKEGVAV
FT                   AKAIYDGLHNTQGQRAYLSWQIASEFSDATTEWNNDTGSWELSIPSTGGEFVTKFVQLL
FT                   DLDNLSTLDNVTYDTLVEWMNTAMVRYMDSLQTTVPDLTTFKSSGGKLLHYHGESDPSI
FT                   PAASSVHYWQSVRSIMYPGVSAAKSLKELQEWYQFYLIPGAAHCGANSLQPGPYPQNNM
FT                   DIMIDWVENGVQPSRLNTTVSSGDYAGETQMLCQWPTRPLWKDNSTFDCVNDEKSIESW
FT                   TYTFPAFKVPVY"
FT   CDS_pept        join(complement(987491..987594),complement(987238..987273),
FT                   complement(987124..987136))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259004"
FT                   /orf_name="AFUA_4G03480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84497.1"
FT                   /db_xref="HOGENOM:HBG054387"
FT                   /db_xref="UniParc:UPI00005201EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W6"
FT                   /transl_table=1
FT                   /translation="MDLLQKHGHLKHDRRKSSARKEEAELRHQQTQQRMRRSTGESLEK
FT                   RELHA"
FT   CDS_pept        join(989601..989706,989756..991458)
FT                   /codon_start=1
FT                   /gene_family="HOG000171253" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16259005"
FT                   /gene_name="sed2"
FT                   /gene_synonym="sedB"
FT                   /orf_name="AFUA_4G03490"
FT                   /product="Tripeptidyl-peptidase sed2 "
FT                   /EC_number="3.4.14.-"
FT                   /function="metal ion binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="pathogenesis"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="extracellular space"
FT                   /protein_id="EAL84498.1"
FT                   /db_xref="EMBL:CAE17674.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005615"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0009405"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG324076"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniParc:UPI0000241628"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q70J59"
FT                   /transl_table=1
FT                   /translation="MFSSLLNRGALLAVVSLLSSSVAAEVFEKLSAVPQGWKYSHTPSD
FT                   RDPIRLQIALKQHDVEGFETALLEMSDPYHPNYGKHFQTHEEMKRMLLPTQEAVESVRG
FT                   WLESAGISDIEEDADWIKFRTTVGVANDLLDADFKWYVNEVGHVERLRTLAYSLPQSVA
FT                   SHVNMVQPTTRFGQIKPNRATMRGRPVQVDADILSAAVQAGDTSTCDQVITPQCLKDLY
FT                   NIGDYKADPNGGSKVAFASFLEEYARYDDLAKFEEKLAPYAIGQNFSVIQYNGGLNDQN
FT                   SASDSGEANLDLQYIVGVSSPIPVTEFSTGGRGLLIPDLSQPDPNDNSNEPYLEFLQNV
FT                   LKMDQDKLPQVISTSYGEDEQTIPEKYARSVCNLYAQLGSRGVSVIFSSGDSGVGAACL
FT                   TNDGTNRTHFPPQFPAACPWVTSVGGTTKTQPEEAVYFSSGGFSDLWERPSWQDSAVKR
FT                   YLKKLGPRYKGLYNPKGRAFPDVAAQAENYAVFDKGVLHQFDGTSCSAPAFSAIVALLN
FT                   DARLRAHKPVMGFLNPWLYSKASKGFNDIVKGGSKGCDGRNRFGGTPNGSPVVPYASWN
FT                   ATDGWDPATGLGTPDFGKLLSLAMRR"
FT   sig_peptide     989601..989669
FT                   /db_xref="UniProtKB/Swiss-Prot:Q70J59 "
FT   pro_peptide     join(989670..989706,989756..990264)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q70J59 "
FT   mat_peptide     990265..991455
FT                   /product="Tripeptidyl-peptidase sed2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q70J59 "
FT   CDS_pept        join(991821..992458,992523..992676)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259006"
FT                   /orf_name="AFUA_4G03500"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL84499.1"
FT                   /db_xref="HOGENOM:HBG054388"
FT                   /db_xref="UniParc:UPI000051F64B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W4"
FT                   /transl_table=1
FT                   /translation="MLLSLVTVISVFQLAIATNLNPPILYSRHAAQEGSLEKRETCEDG
FT                   SRCLLGSCCGDGCALNCCALDNGGCKPFPSFPPPPPPSSPLLSRLMSDGHLQWAAESPN
FT                   GASSAGMCLSGVVGISWGRVVSFLLFKLVLTAQGLHGRGDACHGPHALLDCDARGADGC
FT                   EDYAYEYEDDYDDDGADVYCDFGDEKRDCDCDCHCHCHCNRVKKHDHEGDTSVAAETTS
FT                   STSHRSAATTAAFSPNNNGASAMGVEAPVLAGMVALGAVLL"
FT   CDS_pept        join(993327..993477,993538..994994)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259007"
FT                   /orf_name="AFUA_4G03510"
FT                   /product="Amino acid permease family protein, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84500.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000520425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W3"
FT                   /transl_table=1
FT                   /translation="MDIEHIKAADSASVDQSVQDARDLATMGHDQALTRKFDLWSMLAL
FT                   AFCVLGTYSTFAQGLSSGLTNGGPITILWGLVLVTVCNLCVAVSLGELTSSMPTALGQA
FT                   YWVYRLWHTPTGRFVSYLCAWINTFGWWTLTASQIAFMTEFLLGMKVMFDEKWGGAGVG
FT                   WLQFVIYLGLVLVLTGVNVVGCRREKILPWLNGFVGVWFTGLFVVLSLALLISVGTKAD
FT                   LSFQPGRFVFGAWMNQTGWSDGVVWFTGLVQAAYGLTAFDAVIHMVEEMPAPRINAPRV
FT                   TYLAVLSGAVTGFVFMVVCLFCMQDVDRIVDSPSGLPFIELMLETVGLKGGAALIALFI
FT                   FNGVGQGISILTTASRLTWGFARDGGLPWSRYLTVVDPAWKAPVRALWAQGVLIALVGV
FT                   LYLFANTVLEAILSVSTIALTISYALPIAVLQRVGRDQLPPGPFRLGRWGTAVNWVSIV
FT                   YCAITTVFFFFPGSPDPAPGDMNYAIAVFGVMLVVAVGFWFLQGSRTYLQTADAIAQLI
FT                   LAQGLELEPEPPKKKSDS"
FT   CDS_pept        complement(995010..995996)
FT                   /codon_start=1
FT                   /gene_family="HOG000217286" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259008"
FT                   /orf_name="AFUA_4G03520"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84501.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054389"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W2"
FT                   /transl_table=1
FT                   /translation="MSATNKIIVVTGATGIQGSAVAHTFLRLPAWHVRIITRTPSSAAA
FT                   QALAAAGAEVVRADLSDLDSLRAAFKDATALFLNTDFWGPYRATRDSTAAYDTEILHGR
FT                   NAAIAAGEVASLHRVVYSTLPGMRELSAGKYTTSYHWDAKAEVVKILEREEGLRGKVSF
FT                   LVMGAYATNPLILPTVQPGAAGEGRVLRFTIPGTKTMRLPIIAADSSTGEFVRAMVEGP
FT                   PGTWVLGYDSYLSMEEVVEVWKRVTGWEVEAEEVDLQEMHERFQIPWEVLDAPRFIAEF
FT                   GYTGSLEVMMPEQLEIRTKSYEEWLAGTNWEETLIKAQEELAGYREK"
FT   CDS_pept        join(996283..996397,996446..997158)
FT                   /codon_start=1
FT                   /gene_family="HOG000217285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259009"
FT                   /orf_name="AFUA_4G03530"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL84502.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG054390"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI000051F65F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W1"
FT                   /transl_table=1
FT                   /translation="MAVMSLKMQTQIANAEPKSKRIITPARRDQNRRAQQAYRQRRRER
FT                   LAEKQSHAGPRELRPAPPAHASIPNITTSNRLDVARKTMPAMLTVDHFFPPHDPARNGR
FT                   TEDPVRDEVPPPLFTTYTLLLAACVYNAAALGISTDQFFGEDNCMSLCSPFYRPYTAMS
FT                   ADPSSLLAAATGTRPAIPAHLRPTLPQILFPHHPLFDLLPLPALRAKAITFAATAPSLL
FT                   DAVEFKRDIVERGGIVCSSESAGGMQPWDMRAWTVAPWFRRKWRILSQSEDLA"
FT   CDS_pept        join(998082..998231,998292..998399,998460..998842,
FT                   998891..998955,999024..999325)
FT                   /codon_start=1
FT                   /gene_family="HOG000161999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259010"
FT                   /orf_name="AFUA_4G03540"
FT                   /product="Integral membrane protein , putative "
FT                   /protein_id="EAL84503.1"
FT                   /db_xref="HOGENOM:HBG052262"
FT                   /db_xref="HOGENOM:HBG326373"
FT                   /db_xref="UniParc:UPI000051E80B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W0"
FT                   /transl_table=1
FT                   /translation="MALHSRSRAIFTVSMVFLCLSFIAVALRCFVRLRLVKAFGWDDGL
FT                   MVLAMLLNIWFSICILAGSVAGFGKRFSQFDSLEDTQTALLWWWLAQIAYVCTVATARI
FT                   SIAMLLLRLTVRRRQSAVLYMVIGLTSTVGLAFLLILTLQCSPVRDFWQQTDRSHCIDA
FT                   KYVVDIAYLYSATACLCDFTLGLFPVYLVKDLHMSWRTKWAIRGILSMGCLAGAAVVVR
FT                   FPYLRNYNHPDFLYATAGIAITSNIEAGLGIMAGGLITLRPLMRWLRDVSQKVSSAAKG
FT                   VASSSNRTQTSSSVEQKHPSPIQGLPDIEAPDIEAAMSSHPSLTEEPRLAAGAI"
FT   CDS_pept        999848..1000690
FT                   /codon_start=1
FT                   /gene_family="HOG000217284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259011"
FT                   /orf_name="AFUA_4G03550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84504.1"
FT                   /db_xref="HOGENOM:HBG054391"
FT                   /db_xref="UniParc:UPI000051FDA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V9"
FT                   /transl_table=1
FT                   /translation="MVVNADSISRHALGLSPTTSEYPYQGMKHFRDIVYKEAATTRNDY
FT                   VIFTNIDEHTFLRDFDESLRKSYSDFFPQARILVARMPATEVHEAAHTELHNTLMIMLG
FT                   AMNVHSQLLSLGVADVVTPTRTKEPDQSYKPMNFPAGYSSHWPSMVIETAFSESQSTPA
FT                   NDARWWLNASGGELKIVITIAVQKKREAITIDKWEATSRPTRGDPGKTVPEVVQKVTIT
FT                   REGGDAPVHVTGAPLIIGFEKLFLRPAEEEKGEGDVLFSHDDLAEIADKVWSVLNTGN"
FT   CDS_pept        join(complement(1002356..1002389),
FT                   complement(1001990..1002312),complement(1001180..1001915),
FT                   complement(1000802..1001073))
FT                   /codon_start=1
FT                   /gene_family="HOG000216770" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16259012"
FT                   /orf_name="AFUA_4G03560"
FT                   /product="Polyhydroxybutyrate depolymerase, putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84505.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG054392"
FT                   /db_xref="HOGENOM:HBG547264"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="PDB:2D80"
FT                   /db_xref="PDB:2D81"
FT                   /db_xref="UniParc:UPI00005201E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V8"
FT                   /transl_table=1
FT                   /translation="MRGVWRYMPVYYYKCMLIPLLTFTKISIISKPQESRISLIICRTM
FT                   PTVATFLGLAISGAAMASGAALGAYNVDPNSISVSGLSSGGFMSAQLGVAYSDTFKVGF
FT                   GVFAGGPYDCARGQSYTTCMYNQNPSITTPVANMKSWSGNKINPVSNLQSRKIYMWTGT
FT                   ADTTVGPNVMSQLKTQLANFASAANVSYITTSGAAHTFPTDFDAAGDNSCSSSVSPYIS
FT                   NCQCDGAGAVLQWMYGPLNARNPGTLSGSIVSFSQTGEYGASGMDTTGYLYVPRACQPG
FT                   SSTVCKLHVALHGCKQSYSMIGSKFVSNTGYNMWADTNDIIILYPQAVADNTMHTIWTG
FT                   MPLPNPNGCWDWVGWYGANADQVGGVQMAAIVNQVARVVSGYGAGSSSSTTAATPTTTT
FT                   GSITTTTTTTATVTTTAVAPLYGQCGGIGWTGPTACATGVCTAYSPYYAQCLLIV"
FT   CDS_pept        join(1004780..1004835,1004880..1005603)
FT                   /codon_start=1
FT                   /gene_family="HOG000171221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259013"
FT                   /orf_name="AFUA_4G03580"
FT                   /product="Phosphoglycerate mutase family protein "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /protein_id="EBA27183.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000F51A90"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA67"
FT                   /transl_table=1
FT                   /translation="MKLYLIRHAETVDNVAHRLAGVKDSPLTNHGALQIIRLGRYFASQ
FT                   NIKFSHIFSSDLSRAIRTAEGLSSHQPELSPVLLPSLRERDFGSFEGQKWHSTWESSIV
FT                   PKQPESEASMRQRANTFLTDYLVPLLLAGDEAGDEAGDEAVVAVVSHGLLLRSLWRALL
FT                   AYFHPSDVCIVGDADVNAFNPFWANTGYLELLVRPRLSPLVGVPEMPVLGGYSLQVLGV
FT                   NSRAHLADLRRTKGGVGSATFDQRQKRIDHFFGQKNR"
FT   CDS_pept        join(1006066..1006166,1006210..1006610,1006657..1008146)
FT                   /codon_start=1
FT                   /gene_family="HOG000217283" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259014"
FT                   /gene_name="aglD"
FT                   /orf_name="AFUA_4G03585"
FT                   /product="Probable alpha-galactosidase D "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EBA27184.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000F51A9A"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4DA70"
FT                   /transl_table=1
FT                   /translation="MEFIVSLLLLSPALVAGSLHSRIDNGLARTPQMGWNSYNYYSCSP
FT                   NEAIIRSNAKALVDLGLAELGYRYVTTDCGWSVADRLPNGTLTWNETLFPSGFPAMGEY
FT                   LHELGLLFGVYGDSGTKLCGSPPDQVGSLCKSPSSMILTLANVPDHEEQDAKTFAEWGA
FT                   DSLKYDNCYSDAATNYPNVNYEPSTSPRPRYEIMSSALARVGRPILFQICEWGIDFPAL
FT                   WAPALGNSWRIGNDIIPAWRSIFRTLNQAVPNTDFAGPGQWADLDMLYVGNGVFSLPEE
FT                   QTHFSLWAILKSPLTIGAALKDDDTSISQASLEVLKQKDVIGFNQDALGVSASLKRRWS
FT                   DEGYEVWSGPLSGNRTVVAVINWRNESRDLTLDLPDVGLQYAQVARNIWGKTVVRDVRT
FT                   SYTAGVAGHGTILLELQGTLPSGLYPAKIFAKSTGQRSTFESIYAATTSANYELAITFS
FT                   RPSTETVTITTSSGQTVSISGKSGRIALTAGSNTITIQHKTPIESIQITPPTGTYYANT
FT                   VFNVTGSAKHTTCGSGCSPVGSKIGYLSPTSNAYTSISTTTAGSKYLAIDYINNEVAFS
FT                   SSWGWGSNSRNLTVSVNDGAPVRLEVPLSGRHSELYSPGKGWWDTATLGVLTSGWKKGE
FT                   NKVVFGNEGGEDGFQTYAADFVGVRVLD"
FT   CDS_pept        join(1008472..1008723,1008845..1009246,1009301..1009666,
FT                   1009722..1010066)
FT                   /codon_start=1
FT                   /gene_family="HOG000171144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901724"
FT                   /orf_name="AFUA_4G03590"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84508.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054396"
FT                   /db_xref="HOGENOM:HBG327335"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EC8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V5"
FT                   /transl_table=1
FT                   /translation="MATTTTTTTTTTTTTTTTATTKTYSRNEDNNELASIQLEASTPPP
FT                   SGNVFPAIERWNHPKANIYKTITTFWCFLVMGANDAAYGLEQHYSLTYTIVSLVFLSPL
FT                   GGYALAALTNNHIHLRFGRRGVAIIAPSCHVISYIINCLHPPYPVLVVSFIFAGFGNGL
FT                   ADSGWNAWIGNMADANQVLGLLHGFYGAGAVLAPLVATALVTKAEVGWWYFYYIMIGCA
FT                   VIELTTSVYCFWDDTGAVFRRDTQHSTGGTGSGGGSLRKALFTKHAGRITWLCAVFLLL
FT                   YVGVEVALGGWIVTFMMRVRHGEPFASGMAATGFWLGITVGRVVLGFVTPRLGEKLAIS
FT                   IYLISSIALGLILWLVPNFYVSTVAVSLQGFFLGPLFPAVVVVATKLLPRGLHVTAIGF
FT                   AAAFGAGGGSVLPFAVGAIAQAKGVKVLQPFAIGLLGAIMGLWMCLPRIPAQHET"
FT   CDS_pept        complement(1011241..1011687)
FT                   /codon_start=1
FT                   /gene_family="HOG000217751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259015"
FT                   /orf_name="AFUA_4G03595"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27185.1"
FT                   /db_xref="HOGENOM:HBG324425"
FT                   /db_xref="UniParc:UPI0000F51A91"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA71"
FT                   /transl_table=1
FT                   /translation="MTSMSTSTTTGTAAASTCTGNRWVLPVQDVACALPATGNYSSIMD
FT                   KCCSPAAVTKYNDGCGLYCLAQGQSMGDLLDCIKENGGNKDVFCGGQLNATATASLSET
FT                   ASSTATRTGTGASASETRDNGAPTKRVSVLGVGLVAMIVCGMFV"
FT   CDS_pept        complement(1012399..1013166)
FT                   /codon_start=1
FT                   /gene_family="HOG000171121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206308"
FT                   /orf_name="AFUA_4G03600"
FT                   /product="Acetyltransferase, GNAT family family "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EBA27186.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG324426"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000F51A47"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA68"
FT                   /transl_table=1
FT                   /translation="MSPTTTTTTTSITSTTKQDASQDLPQDIPDLQTYRATTKEDLIPG
FT                   LRLIADSIAQQRQTAAHALIFHPFWLSAMAALIAIVYKALYTDSSDLPLIGTTSAGCVM
FT                   AGLLVVRGLTGGYIEEAERVGKGEWLLPSRTNPKERGQGEEQEILVTKFGERIIGVVVL
FT                   RGVPVPAGEKKVKMTGVIWAWTVERRYRGKGVGAGLLEEAVEMCRQKGWEGPVFDEEHA
FT                   NAKRVLPGLFNGEFERREKWARGVLEGVKNRME"
FT   CDS_pept        join(complement(1014793..1015319),
FT                   complement(1014232..1014728),complement(1013503..1014179))
FT                   /codon_start=1
FT                   /gene_family="HOG000171119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259016"
FT                   /orf_name="AFUA_4G03610"
FT                   /product="Phosphate:H+ symporter"
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84510.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744844"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F406"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V3"
FT                   /transl_table=1
FT                   /translation="MASTGGGNSAFRNYNNELAHVEDARERRRQALAEIDNAKFSWYHV
FT                   RAVVVAGVGFFTDSYDIFAINLASSMLGVVFWQDAKSSPGKIPSSADTAIKVSTSGGTV
FT                   IGQLFFGWLADRIGRKRMYGIELMVIIMATLAQALSSDSRAISIVGILIFWRVIMGIGI
FT                   GGDYPLSSIITSEFATTKWRGAMMGSVFAMQGFGQFAAAIVALIVTAGFKESLETASSV
FT                   GKCSGVCQLAVDKMWRVVIGFGAVPACIALYYRLTIPETPRYTFDVAHDIVKADEDVRA
FT                   YMTGKHEGHPDEIRRQSVLQKHAGDVTPKASWADFWRHYLQWKNGSILLGTAGSWFFLD
FT                   VAFYGLGLNNSIILSAIGWSGGKDVYEVFYKNAVGNLILICAGAIPGYWMTVATVDTIG
FT                   RKPIQLLGFIILTIVFIVIGFAYEPLKKSHNGLLGLYVIAQFFFNFGPNATTFIVPGEC
FT                   FPTRYRSTSHGISAASGKVGAIIAQCVFGPLVHKGAKDPSQSPWLNHVMQIFALFMLCG
FT                   CFTTLLIPETKRKTLEQLSGEEYESDTLVQNSPMIQAEKKVDNSSAADV"
FT   CDS_pept        join(1017220..1017296,1017353..1017490,1017547..1017643)
FT                   /codon_start=1
FT                   /gene_family="HOG000166313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901725"
FT                   /orf_name="AFUA_4G03615"
FT                   /product="Conidiation protein Con-6, putative "
FT                   /protein_id="EBA27187.1"
FT                   /db_xref="HOGENOM:HBG676962"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniParc:UPI0000F51AB6"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA72"
FT                   /transl_table=1
FT                   /translation="MPRARSRSREPSEGRDPENVMRGYKATLHNPNVSQQAKQHAQQEL
FT                   DRYESGYATSKSEEDRHASNVKRGLKAATHNPNVTDMGKKQARDKLQAMGEQPEEPGD"
FT   CDS_pept        join(complement(1019125..1019281),
FT                   complement(1017696..1019053))
FT                   /codon_start=1
FT                   /gene_family="HOG000171098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259017"
FT                   /orf_name="AFUA_4G03620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84511.1"
FT                   /db_xref="HOGENOM:HBG054398"
FT                   /db_xref="HOGENOM:HBG327402"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI000051F18B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V2"
FT                   /transl_table=1
FT                   /translation="MIEDNKSGGNSTKSAETLRETEPSSTGAVSVGFWDPALQETRKRI
FT                   IYLWSRTVLGLCVFILSILSLYWAVQFRSEDRLHTLTVWVVDFDNQVDPYRNESITPIV
FT                   GPAVTDVANRLIKSEREHVGYEIRSPADFNFDPWAVRQGVYDEHAYAAIIVNPNATTLL
FT                   YEAVTNGHSSYDPTGAAQFIIISARDQATYSNYIEPALSWFQLEVFAEFGPRWIQTLTR
FT                   ESMDISRVPQAVNPAIGFYKVDLRPFGPAAATPSVTIGLIYLIIIAFFNTPFLMPVHMQ
FT                   FIKGDHPPLKNAQWLIWRLCSSILAYFFLSLFYSFVSLAFQIPFAHSPAPDTLPADDPN
FT                   AYGHGSFVVFWMLNWVGMTALGLPCENMGMILGFPYSALFLIFWVITNVATGFYALDLA
FT                   PGFFAWGYAFPLHRSKSSILRTALRLSNSCSCRGAPDYSLRHAFLDWTRLWHSVCVDRI
FT                   VHHIIPICRICHALEDEARIVIFARDRSIHSNQFIILDTSQHNLFS"
FT   CDS_pept        join(complement(1022027..1022230),
FT                   complement(1021926..1021960),complement(1020975..1021869))
FT                   /codon_start=1
FT                   /gene_family="HOG000171097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259018"
FT                   /orf_name="AFUA_4G03630"
FT                   /product="Sterol 24-c-methyltransferase, putative "
FT                   /EC_number="2.1.1.41"
FT                   /function="sterol 24-C-methyltransferase activity "
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="EAL84512.1"
FT                   /db_xref="GO:0003838"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG061165"
FT                   /db_xref="HOGENOM:HBG316404"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="UniParc:UPI000051EEF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V1"
FT                   /transl_table=1
FT                   /translation="MAPVALEQENHLRDAEFNRAMHGKSAQFRGGFAALRGKDSAAQKA
FT                   AVDEYFKHWDNKPAEDETEETRAARRAEYATLTRHYYNLATDLYEYGWGTSFHFCRFAQ
FT                   GEPFYQAIARHEHYLAHQMGIKEGMKVLDVGCGVGGPAREIVKFTDANVVGLNNNDYQI
FT                   ERATRYAEREGLSHKLSFVKGDFMQMKFPDNSFDAVYAIEATVHAPDLEGVYKEIFRVL
FT                   KPGGVFGVYEWLMTDAYDNDNPEHRRIRLGIELGDGISNMVKVSEGLTAFKNAGFELLH
FT                   NEDLADRPDAIPWYYPLAGSFKHMTSPWDFFTIARMTWWGRGIAHRFCGAMETIGLFPK
FT                   GTQKTADSLAIAGDCLVAGGEKKLFTPMYLMVGRKPE"
FT   CDS_pept        join(1023111..1023251,1023305..1024315)
FT                   /codon_start=1
FT                   /gene_family="HOG000171086" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19901726"
FT                   /gene_name="slt11"
FT                   /orf_name="AFUA_4G03640"
FT                   /product="Pre-mRNA-splicing factor slt11 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL84513.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG347612"
FT                   /db_xref="HOGENOM:HBG736998"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FB2F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9V0"
FT                   /transl_table=1
FT                   /translation="MPPPQIKQDLNRSGWESTDFPSVCENCLPDNPYVQMLKEDYGAEC
FT                   KICTRPFTIFRWKADRTARTKRTTICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMV
FT                   APGPESSINREYYAQEHEKEIQEGRGAVEAYEKTDEKARELLRRLANSEPYYRKPRQQL
FT                   EGPSDDSTEAQPTDAPVVQSRYGNGPGPIRTSESRRGTPLPGRGRGNMRGGRAGRPFPG
FT                   TAQIPPSPEDYLPPADPNIMSLFVTGVEDDLPEHTLRTFFTQFGQLRSLICSHRAHCAF
FT                   INFATREGAEAAAQHCKGKAVIQGCPLRVRWGKPKPLDNMDREERMKNAREGRLTVQAQ
FT                   KDGESGQRAITAAGEPATEKPQSFVVAPPPGSGDVQYSSLSGD"
FT   CDS_pept        join(complement(1025250..1025362),
FT                   complement(1024970..1025205),complement(1024740..1024916),
FT                   complement(1024569..1024663))
FT                   /codon_start=1
FT                   /gene_family="HOG000201565" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901727"
FT                   /orf_name="AFUA_4G03645"
FT                   /product="Mitochondrial complex I protein Fmp36, putative "
FT                   /protein_id="EBA27188.1"
FT                   /db_xref="UniParc:UPI0000F51AA5"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA73"
FT                   /transl_table=1
FT                   /translation="MQGNFIFSAPTSRPRLDQWTSGSFGGHGSKIDVRKTRTSDAFYTG
FT                   TLEIERFLYHLKNEPENGTWYGVPYHLQKDNQYTWNTSQITLILDTMASQTAVTARSAY
FT                   RQILRATRIAFQDDFRVLVAARQEARRQFDEHRREGIDTPMQINHAKEVAAILRHNIVQ
FT                   GVRDSNDENGKWELRIHDDIERGDNDSIRVGGKKVKVDKPCSA"
FT   CDS_pept        join(1025465..1025614,1025679..1025819,1025873..1026922)
FT                   /codon_start=1
FT                   /gene_family="HOG000171054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206309"
FT                   /orf_name="AFUA_4G03650"
FT                   /product="Ribosome associated DnaJ chaperone Zuotin,
FT                   putative"
FT                   /function="heat shock protein binding"
FT                   /protein_id="EAL84514.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG383362"
FT                   /db_xref="HOGENOM:HBG525199"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000051E818"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U9"
FT                   /transl_table=1
FT                   /translation="MASQVINVTLPALPQGWSAEKDFTAVGTLSATTQRNLEPVGPHFL
FT                   AHARRKRHHRTFSEDERIQAQQNVKKTEDDDDDEISEPEDPVMLSRDAKDWKAQDHYAV
FT                   LGLSKYRWRATPEQIKRAHRKKVLRHHPDKKAALGDRDENDNFFKCIQKAHELLTDPVK
FT                   RRQFDSVDEAADVDPPSKKEVAKRGFYKAWGPVFEAEARFSKVQPVPQLGDENSTQEEV
FT                   ETFYNFWYNFDSWRSFEYLDEDVPDDNENRDQKRHIEKKNANARRKRKTEDIARLRHLV
FT                   DDCLAQDERIKKFRQQARAGKDKKRLEKEAEAKRLAEEKEKARLEEEQRKKEAEEAAKA
FT                   EREKNKKAKEAAKNAAKKNKRILKGSVKDVNYFAESGEPSPAQVDSVLTDVDSIIAKID
FT                   SEELAALAERLTTAGKDAAAVKGVWTEEVKRLVDAGKLKDGEAKFFA"
FT   CDS_pept        join(1028054..1028245,1028308..1029360)
FT                   /codon_start=1
FT                   /gene_family="HOG000212034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259019"
FT                   /orf_name="AFUA_4G03660"
FT                   /product="Acid phosphatase, putative "
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="EAL84515.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG058806"
FT                   /db_xref="HOGENOM:HBG736259"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI000051F899"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U8"
FT                   /transl_table=1
FT                   /translation="MFTKKSLVTLLGGLSVALAQTSSEQYPSLSEIEAAQATVLPHSPV
FT                   SNVKGLAFDRFVNIWLENTDFDKAAADAHMSALAKKGLLLTNFWAVTHPSEPNYCAAAG
FT                   GDTFGMDNDNFNQVPANVSTIADLFDTKNIAWGEYQEHLPYPGYQGFRYPESGPNDYVR
FT                   KHNPAILFDSVTQDATRLRQIKNFTSFYDDLKNHRLPQHMFITPNMTNDAHDTNITFAA
FT                   TWSWNFLSELLENDYFTKDTLILLTFDENGTYKLGNKIYSILLGGAVPKHLIGKEDNTY
FT                   YNHYSVIASLSANWGLPSLGRWDCGANLLSFIAEKTGYVNWEVDTSNLYLNHSYPGPLS
FT                   TSSHTPNWPVPLTKGSCSAGHGILKAVRKTYKDMAPTYNYTSPVPYDAASKTNVGVKYT
FT                   RKLVSLLDQSLTHEY"
FT   CDS_pept        join(1029779..1030612,1030663..1031490)
FT                   /codon_start=1
FT                   /gene_family="HOG000217282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259020"
FT                   /orf_name="AFUA_4G03670"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84516.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054399"
FT                   /db_xref="HOGENOM:HBG327393"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F8BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U7"
FT                   /transl_table=1
FT                   /translation="MPLNKRPRTEPIVRVRTGCWTCRRRKKKCDENRPVCGGCTRNKLS
FT                   CHWPAHVSSRPLENDRGAIPVQTDQHSRGSGQMDEENIIIPHGSPQSVRSSISHGASSH
FT                   SPFSPAVSPTSPAQSVCLPTVSPTGAIGLEDLDAASLVPMGYSHPRSNSQASIRDVMPR
FT                   SLSMLPGYSPESYQLLSHYLATTADCMANGSTPVNPFLVQIVPLAFTSDLLLQLVLTQS
FT                   AAHRAFRCRNDSDEVAQSHYTKALQLFRKGVTDFIDGKESNPLMLTVGALLMCFTETAR
FT                   GDMNGTIFDHLSAANTLLIRLLAESDTAVPKDLKNFVIEYYTYTATVSMISIDARVSRQ
FT                   LFLNFDLEQRARQLLESEYIGNLCGCWLELLLMIPCIFDLGRQWMMEDGQPGLPTADDI
FT                   AMFGSLQAQILRWTPYPSVTPEVFLAGRIFQQAMLLYLYTSLGAFSRAEQGIYQGLIDA
FT                   AITDAMSYLHQLSATARINSGLCWPIAVVGSCLSDLDQQNSLRQRLHIMVNTFGLGNMQ
FT                   RTLLLLEHMWQVPLEQAGPWNICRAMQQHQIWISFA"
FT   CDS_pept        join(complement(1032490..1032539),
FT                   complement(1031875..1032417),complement(1031586..1031826))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259021"
FT                   /orf_name="AFUA_4G03680"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.1.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84517.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51A40"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U6"
FT                   /transl_table=1
FT                   /translation="MVGRLAGKNAIVTGAAGGIGLETTILMLREGASVLMTDISAAGLE
FT                   RAIAKVHEVVPQHDGRVEYRVVDVSKESEVEAAVAHLDAWGGLDVMFNNAGIMHPKDGD
FT                   SEETPEEIWDLTMNINVKGVWYGSKHAVKSLRRHGKKKGSIINTASMVALVGAATPQLA
FT                   YTASKGAVLAMTRELAIVHAREGFRFNSLCPAPLNTPLLQDWLGDDKEKRFRREVHFPT
FT                   GRFGEAIEQAHAVIFLASDESSFVNAADFVVDGGLTKAYVTPEGPATEAPKNLGS"
FT   CDS_pept        join(complement(1034312..1034713),
FT                   complement(1033789..1034261),complement(1033295..1033715),
FT                   complement(1033107..1033220))
FT                   /codon_start=1
FT                   /gene_family="HOG000271513" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259022"
FT                   /orf_name="AFUA_4G03690"
FT                   /product="Aldehyde dehydrogenase family protein, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84518.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000F51A8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U5"
FT                   /transl_table=1
FT                   /translation="MANQIRTLSPSTNEVIFEHQGTSLEEARKIAQASYEAFKLYKKIT
FT                   LSERKDIIVKALELIAANIDTLSNELTTQMGRPIAYSAKEIETMRKRADYLLSIAEDSL
FT                   QEHPGQLEKGFRRSVKKEPVGPTLIATAWNYPYLITINTLVPALLAGNTVILRPSPQTP
FT                   LIGERLLSYFTQAGLPPNVLQLIHVGSLDVLDEIVKLPQIKLVSFTGSTAGGVRIREAT
FT                   ARRIVPVNLELGGKDPAYVRADADIPYVAAQIVDGAVFNSGQSCCSIERVYVHADVHDD
FT                   FVAEVQKELQTYKLGDPTDNSTTTGPVISRHAVKTIQSHIDDALSKGAINATPPNESFL
FT                   SVPSQKPQGNYIAPTVLTNVTHDMTVMKDETFGPVLPIMKVSSDEEAVALMNDSEYGLT
FT                   ASVWTRDIARGEELIAEIEAGTVFINRCDYPSPDLAWVGWKNSGLGCTLGPHAFDGFYK
FT                   LKSYHIKEEQA"
FT   CDS_pept        join(complement(1035641..1035869),
FT                   complement(1035358..1035584),complement(1034996..1035304))
FT                   /codon_start=1
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749750"
FT                   /orf_name="AFUA_4G03700"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /function="GMP synthase (glutamine-hydrolyzing) activity "
FT                   /protein_id="EAL84519.2"
FT                   /db_xref="GO:0003922"
FT                   /db_xref="HOGENOM:HBG097859"
FT                   /db_xref="HOGENOM:HBG593654"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000F51AAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U4"
FT                   /transl_table=1
FT                   /translation="MARLLRAAILECDTPIQPVKDRYGTYGDLFENLLKASLKAQGLDP
FT                   QVDLQITKWDVVNGSVYPEPDDCDAILLTGSKHDAFADEPWIIKLTNYTRELYEKHKKP
FT                   IIGICFGHQIIARALGARVGRSDRGWEIAVEPIILTDTGRVLFSKNVLSLHQMHRDIAY
FT                   EVPEGCVNLGSSAICEIHGLYRAGRIFSVQGHPEYDEFVVSKLIETRHAMGVFDDQLSK
FT                   DGLSRAGKPHDGLVVGEAICKFLLDDPGVNRV"
FT   CDS_pept        join(1036321..1036738,1036785..1037044,1037092..1037144,
FT                   1037200..1037877,1037935..1037965)
FT                   /codon_start=1
FT                   /gene_family="HOG000005159" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206310"
FT                   /orf_name="AFUA_4G03710"
FT                   /product="Glutamine synthetase, putative "
FT                   /EC_number="6.3.1.2"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="EBA27189.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="HOGENOM:HBG553755"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI0000F51A99"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA74"
FT                   /transl_table=1
FT                   /translation="MSQDTITVEDLPALLEHDISVKVAGIDCDGILRGKVMAKEKFLGI
FT                   AQKGFGFSSAVFGWDMQDVLYTTDAKIAPPESGYVDFIAVPDLSSYRRIPWEDNIPFFL
FT                   VRFVQNEKPVAADGRSMLRAITDKLAEANCQAMAGVELEFMNFQTPSQDGYSNGSQTRD
FT                   IAAFLERNAPSALRPMTAGSFSYSATRPVAFKKYFWDIFNTSARFNCGIEGWHTEGGPG
FT                   VYEAALKVCNVAEMADRVSLFKLLAKSIGVEHGITPCFMAKPMYGQPGSSGHIHISLCD
FT                   LEGKNLFARDTPDPNALWSDAACLSDMGRQFLAGLLEALPDIMPLFAPTINSYKRLVEN
FT                   YWAPVNISWGLEDRMASIRIITPPVCKPGATRMEVRIPGADLHPHYALSVILAAGWRGI
FT                   EKKLDIKVPPMSALKQGERPELLPNTLEEAIKRFSAPESIAREILDGEFVDFFTATRQH
FT                   ELKVWREAVTDWEFKRYIETV"
FT   CDS_pept        join(1038284..1038454,1038513..1038629,1038697..1039183,
FT                   1039269..1039678)
FT                   /codon_start=1
FT                   /gene_family="HOG000171043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259023"
FT                   /orf_name="AFUA_4G03722"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27190.1"
FT                   /db_xref="HOGENOM:HBG324429"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniParc:UPI0000F51A6F"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA75"
FT                   /transl_table=1
FT                   /translation="MDFSLQNHRSFIGRPATDLPTPAVVLSKPILERNIKQLLQDVKDL
FT                   EISFRPHVKTLKSIEVTRMMLGNGTHRRIVASTLCEIRGALPLAEEGILDEALYGIPIY
FT                   PSALPQLAALSSKLKIVLMVDNEAQIDALESFAQSTGRTAPWPVFIKVDVGSHRAGLES
FT                   SSSAMRLLVEKVESSHAAEVYGFYCHAGHSYACRTEEAAAAVLKSELEGVVRAAGYLDR
FT                   KEGRKVVVSFGSTPTAHVVNSLRRALPEGMDVELHAGNFPANDLQQVCTGLVAEEQQAV
FT                   RVLVEVCSVYPERNEALINAGTVALTKETSDVVGFGRVTDRPGWAVVRMAQEHGILGLA
FT                   NASGVQRVEETFRVGQKVMLYIQHACITAAQHHVYHVVDEEDIVRETWVPWKGW"
FT   CDS_pept        join(complement(1041223..1041469),
FT                   complement(1040730..1041167),complement(1039880..1040673))
FT                   /codon_start=1
FT                   /gene_family="HOG000171032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901728"
FT                   /orf_name="AFUA_4G03730"
FT                   /product="Dienelactone hydrolase"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84522.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG023629"
FT                   /db_xref="HOGENOM:HBG054402"
FT                   /db_xref="UniParc:UPI000051E803"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U1"
FT                   /transl_table=1
FT                   /translation="MALLSINAGGASGGFLYNSSLAKTRVCITAETPDFDTAFIRQWQD
FT                   EGFEVMYLPYNDGGKEYTSQLKSIKEGLGVGVNYAVIALGDAASFCLDFYLKPTNASRL
FT                   SALICYYPTNIPDPRSSFPPSVRFLTHLAGETIDVTTVPTALGLQGKKRRTTRRINQGI
FT                   GTGERLNIGHQAYTYDNVQPGFAEHDLEEYDRLAAELAFSRSLQVIRSTVTDKIDLEKR
FT                   WEDHLEARFFSMNLNNVMEQYVDHLTPNVTYAPTISGGIGARDLRRFYEHHFLRNLPPS
FT                   MRLRLLSRTIGVDRVVDELYASFEHTQEIPWMLPGVPPTNKKVEAILISIVSLRSGKLY
FT                   SEHVYWDQASVLVQIGLLDPKLVPQGVEGVDRLPVVGKEAARRILTEDPESEQRRYHNR
FT                   LIRATHAKHKGQHGKHELVEGSGAELRSEAGDSVKTGNVKGKSVQGQSWPEKEDGADGE
FT                   EEETGTGRNGNGVANGSNGKRAASVEDDNGENDD"
FT   CDS_pept        join(1043838..1044054,1044128..1044290,1044349..1045410,
FT                   1045461..1045764)
FT                   /codon_start=1
FT                   /gene_family="HOG000171019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055110"
FT                   /orf_name="AFUA_4G03740"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84523.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054403"
FT                   /db_xref="HOGENOM:HBG326531"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00005208F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U0"
FT                   /transl_table=1
FT                   /translation="MSLVQHVSVIDGVDREIEPDLRDDETITTYHDESLVPIRRKISYD
FT                   VLHERQQPVIGDKSGTPAYEVSTAIRLVQVTITILACWFASGIVFGFAALKPVLIDQGV
FT                   YRDLCTKEELRDGVEVCFEQDLRLNLFFTIGSITANVSALPVGTILDRYGSRLCGFIGS
FT                   ALLVAGSVLMSLSFSRPDFDGYIIANFFLALGGTFVFVPSFQIANAFPKHAGIIVALVT
FT                   GAFDASAAVYLFYRILYESNPETFTPQRFFLAYVAVPVCLLLALLTIMPAQDYQSSHQL
FT                   EIKMEQAKDSTRDIHESDQEIESDTELRRVRSQRAEERMDDMRQIDRVLGDADERRHRE
FT                   EQEAERQATSVVWGVLHGLPARKQMATPWFILITLMTVLQMLRMNYFIATIRAQYEFML
FT                   ASDRLAEKINEYFDVALPVGGVFATPFIGLLLDHLSVPNMLAIIVILTTLIGALNSVPA
FT                   AWAGYTTVTLFVLLRPLYYSAMSDYATKVFGFATFGRVYGTIICVSGLVNFSQYALDAL
FT                   THGPFDGNPIPVNIFLAAAGFVVGTVLVLYVQIAGKHLKEKRLALERDEEQERERLIPI
FT                   QEEDA"
FT   CDS_pept        join(1047529..1047746,1047798..1047837,1047884..1048097,
FT                   1048235..1048380,1048439..1048656,1048704..1049165,
FT                   1049225..1049348)
FT                   /codon_start=1
FT                   /gene_family="HOG000157494" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259024"
FT                   /orf_name="AFUA_4G03750"
FT                   /product="Phthalate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84524.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328832"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051EC6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T9"
FT                   /transl_table=1
FT                   /translation="MSPPTSEKPGSVQNIEDVGQRALDNIDYDEEYSYEEQRKIIHRID
FT                   RRLVTMTGLAYCISLMDRTNLSMAAVAGMTKELGLHIGTRYSVIVLIFFVPYVIFQPIM
FT                   TVITRKLGPTFFLGAIVISWGAILIVCFPVQVEGHQPNHKTGNGLHERLEANDYDVQKR
FT                   FSVFYLIGCVASALAGILAFGLSQMGGIQGLGGWRWIFIMEGVITGVIGVLTLLLLVDF
FT                   PDRAHKSWRFLSEKECAFVVRRINRDRSDADDEPFSLIRFLTPALDPKIWGFAMIFLCT
FT                   TTVTYAIAYFLPIILQQGMGYSVGASQCLVAPPFVFAGIVMFSSAWVGDKYRVRGVLVA
FT                   VNSILCLIGLPILGFHSNNAVRYFGVFLATAGANANIPAIMAYQANNVRGQWTRALSSA
FT                   TLVGFGGIGGILSSLVFRSQDAPGYRPGMWTTIGCNILILVIVAAMSVWFRICNKQADR
FT                   GQRIIEGSADFRYTI"
FT   CDS_pept        join(1051133..1054259,1054324..1054379)
FT                   /codon_start=1
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206311"
FT                   /orf_name="AFUA_4G03760"
FT                   /product="Glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /function="glycine dehydrogenase (decarboxylating) activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glycine decarboxylation via glycine
FT                   cleavage system"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84525.1"
FT                   /db_xref="GO:0004375"
FT                   /db_xref="GO:0019464"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000849"
FT                   /db_xref="HOGENOM:HBG286723"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniParc:UPI000051F3DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T8"
FT                   /transl_table=1
FT                   /translation="MAASLCALRGTRQLVIRTRLRASPASISLRKAAPSPVLATRRYLN
FT                   TATQAPPASRRAVYTSSVADHGDPHPRDLFQPLDTFPRRHIGPSPEAAQEMLAALDPPV
FT                   ATLDEFVKQVLPADILSKKDLTVTPPSADINLPRSSVHGGLGETDMLKLLETYRKQIDI
FT                   SGKSYLGTGYYPTIVPPVILRNILENPAWYTSYTPYQPEISQGRLESLLNFQTLTADLT
FT                   GLPFANASVLDEATAAAEAMTMSLATLPMAKQKKPGKAYVVSHLCHPQTIAVMQSRAEG
FT                   FGINLVVGDIMANDFELVKKQGDNLIGVLAQYPDTEGGVYDFQALSDSIHAAGGTFSVA
FT                   TDLLALTLLKAPGEFGADIAFGNAQRFGVPMGFGGPHAAFFACADKYKRKVPGRVVGVS
FT                   KDRLGNRALRLALQTREQHIRREKATSNICTAQALLANMSAMYAVYHGPAGLKSIAQRV
FT                   MAMTSTLQEKLTALGYNVPVKGSAIFDTLTVEFGSSEEADALIAAAQEQNIFLRRVSSS
FT                   KVGISLDETVGREEVKSLLQVFAKHAGKGEVELSEEIGIKSIPPNLERTSPYLTHPVFN
FT                   THHSETEMLRYIRHLESKDLSLAHSMIPLGSCTMKLNATTEMIPVSWPEFSQIHPFMPA
FT                   DKAKGYTQMIDDLERQLADITGMAEITVQPNSGAQGEFAGLRVIKKYHEANGGEKRNIC
FT                   LIPVSAHGTNPASAAMAGMRVVSIKCDTKTGNLDLADLKAKCEKHKDELAAIMITYPST
FT                   FGVYEPGVKEACEIVHQHGGQVYMDGANMNAQIGLCSPGEIGADVCHLNLHKTFCIPHG
FT                   GGGPGVGPIGVAEHLRPFLPSHPASEYLQSKRAATSSPPISAAPWGSASILPITFNYIN
FT                   MMGAKGLTHATKITLLNANYILSRLKPHYPILYTNNNGRCAHEFILDVRKFKDTCGIEA
FT                   IDIAKRLQDYGFHAPTMSWPVANTLMIEPTESENKAELDRFCDALISIRKEIAAVESGE
FT                   QPREGNVLKNAPHTQRDLLSSEWNRPYSREAAAYPLPYLVEKKFWPSVTRVDDAYGDQN
FT                   LFCTCGPVEETD"
FT   CDS_pept        join(1055168..1055462,1055509..1056845)
FT                   /codon_start=1
FT                   /gene_family="HOG000257692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206312"
FT                   /orf_name="AFUA_4G03770"
FT                   /product="Chlorohydrolase family protein "
FT                   /EC_number="3.5.4.3"
FT                   /function="guanine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84526.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008892"
FT                   /db_xref="HOGENOM:HBG004678"
FT                   /db_xref="HOGENOM:HBG417542"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniParc:UPI000051E819"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T7"
FT                   /transl_table=1
FT                   /translation="MATATAPTYTLFLGTFIHLPRKPTGADPGAKWRPALEINHGALWV
FT                   SNSDGKIAGFDWSFSPADGDVNSLTEKLGLSGKVTEVVRAREERNEFFFPGFIADRQDT
FT                   HIHAPQYPNSGIFGSSTLLDWLETYTFPLESSFGDASKARAVYSRVIARTLANGTTCAS
FT                   YFATIHVPATNLLASLCHSRGQRALIGRVCMDNPSFCPDYYLDSSPESSVSKSKETIAH
FT                   IHSIDPAGTLIHPILTPRFAPTCSPPALHGLAQLAQSYNPPLHIQTHLSENTGEISLVR
FT                   ELFPQSKDYTSVYDDFGLLTPRTILAHAVHLSPSERELIAARGAKVSHCPASNSALGSG
FT                   LCAVRKLLEAGVEVGLGTDVSGGYNCSVLEAVRQGCLVSRLLRHSGTDDPGDGDDGEEV
FT                   LSVEEGLYLATRGGAAVVDLAGEIGGFEVGMSFDAQMVRLGHSHTSSSPTAEHGVVDVF
FT                   GWESWTEKVHKWVWTGDDRNVKAVWVRGRLVHSLDEGQSQSDVSIPEKGKPTWIWAGTG
FT                   AAWESKWWLCGLGFVSAWFIFDRVMR"
FT   CDS_pept        join(complement(1058816..1059071),
FT                   complement(1058665..1058766),complement(1058499..1058620),
FT                   complement(1058383..1058452),complement(1058262..1058337),
FT                   complement(1058155..1058206),complement(1057896..1058107),
FT                   complement(1057622..1057843),complement(1057314..1057560),
FT                   complement(1057124..1057264),complement(1057014..1057070),
FT                   complement(1056939..1056968))
FT                   /codon_start=1
FT                   /gene_family="HOG000171008" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19901729"
FT                   /gene_name="rglA"
FT                   /orf_name="AFUA_4G03780"
FT                   /product="Probable rhamnogalacturonate lyase A "
FT                   /EC_number="4.2.2.-"
FT                   /function="carbohydrate binding"
FT                   /function="carbon-oxygen lyase activity, acting on
FT                   polysaccharides"
FT                   /function="carboxypeptidase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84527.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016837"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG054405"
FT                   /db_xref="HOGENOM:HBG327370"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR015364"
FT                   /db_xref="InterPro:IPR016590"
FT                   /db_xref="UniParc:UPI000051F89A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9T6"
FT                   /transl_table=1
FT                   /translation="MLSKATLLLFLPSWARVTYAAFGITTTSSSYVIDANSPNPLKFTV
FT                   NRSNCDITSINFYGAELQYQGTGSHIGSGLGSASVSATQSGDYIKVTCSTSTLTHYFVV
FT                   HNGDPIIHMATYITAEPSIGELRFIARLNNELLPNEEPFGEVSNTSGGTAIEGSDVFLV
FT                   NGQTRSKFYSSERFIDDHRHCVSGSAHRVCMILNQYESSSGGPFHRDINTNNGGQYNAL
FT                   YWYMNSGHVQTEANRMGLHGPYSMYFSRSGTPGTNIDTSFFANLDIQGYVPDSARGKVS
FT                   GKASGADSTFKWVVHWYNDEAQYWTYTASDGSFTSPAMKPGTYTMVYYQGEYKVASTSV
FT                   SVSAGSTTTKNISGSVTTGKTIFKIGEWDGQPTGFRNAANQLRMHPSDSRMSSWGPLTY
FT                   TVGSSSLSDFPMAIFKSVNSPVTIKFTASSSQTGAATLRIGTTLSFAGGRPQVTVNSWT
FT                   GPIPSAPKDLNSRGVTRGAYRGLGEVYDVAIPAGTIVAGTNTITISVVSGSSGDAFLSP
FT                   NFIFDCVELFQ"
FT   mat_peptide     join(complement(1058816..1059011),
FT                   complement(1058665..1058766),complement(1058499..1058620),
FT                   complement(1058383..1058452),complement(1058262..1058337),
FT                   complement(1058155..1058206),complement(1057896..1058107),
FT                   complement(1057622..1057843),complement(1057314..1057560),
FT                   complement(1057124..1057264),complement(1057014..1057070),
FT                   complement(1056942..1056968))
FT                   /product="Probable rhamnogalacturonate lyase A "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9T6 "
FT   sig_peptide     complement(1059012..1059071)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9T6 "
FT   CDS_pept        join(1061654..1061869,1061918..1062129,1062182..1063436)
FT                   /codon_start=1
FT                   /gene_family="HOG000170997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055111"
FT                   /orf_name="AFUA_4G03790"
FT                   /product="Serine peptidase, family S28, putative "
FT                   /EC_number="3.4.-.-"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL84528.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="HOGENOM:HBG054406"
FT                   /db_xref="HOGENOM:HBG327369"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="UniParc:UPI000052020E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T5"
FT                   /transl_table=1
FT                   /translation="MKLHSPWLAAMKLAVIFDPVTGIGLPASTLGRDLRLAAELGLDSH
FT                   LAMNDPETFRSMIADSVGSISAAEHTEMLIDHEDPSVGTYRNRFWVNEDFYISGSPIMV
FT                   YDIGEATAEYSVSLLTNSSSWLSLLLQEFNAMGIVWEHRYYGGSLPYPVSQDMPVEHLK
FT                   YLTTEQALADIPYFAANFSRLNHPDFDLTPRGTPWIMIGGSYPGIRAAITRNKYPDTIF
FT                   AAYASSAPVQAQLNMSVYYEQIYRAIVGNGYSNCTKDIQAALKYIDGQLSNKRTFALIK
FT                   RLFLGPDAEKNSNEDFTTALVTLYGPFQAHGLWSGNQSLPDFCNYLELDPATNQSAGPE
FT                   GLSPIHGSKYVAERWASFPYFISLVNRMYGTNCNGLNASEPLSCDFSQTNTIPELISWT
FT                   WQYCTEWGFFQSNNFGSHALLSSYQTLEYQQELCYRQFPNAVQAGVLPPRPQTESLNEK
FT                   FGGWTIRPSNVYFSGGQFDPWRTFSVLSDEDWAPQGVNFTTEIPACGVPTSKDAIFGYI
FT                   MENAVHCPDFRLTPDAAVSRNYFSRALKQWLPCFRRSQSRQSH"
FT   CDS_pept        join(1063947..1064393,1064438..1065101,1065158..1065424,
FT                   1065477..1065646)
FT                   /codon_start=1
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259025"
FT                   /orf_name="AFUA_4G03800"
FT                   /product="Cytochrome P450 alkane hydroxylase, putative "
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84529.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051262"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI00005206B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T4"
FT                   /transl_table=1
FT                   /translation="MLAPAVALFAAVYTTFLVLRYFQQLYKHRKQARSLRCQPPADGEA
FT                   GFLGIASFLRLRKAAKEKRWIELIAEQYGKYGNTFTQTIFGQPLVSTIEPENLKALLAT
FT                   QFNDFELGTRHREFYPLLGDGIFTLDGAGWSHARALLRPQFTRDQVADLDLMDGHVSRL
FT                   IDLVPKDGSAFDIQRLFFLLTIDSATHFLFGESVGSLHAGTDTGLLGRSAVGNAEGFAE
FT                   AFNKAQEYLAARSRAVVFYWMINPKEFRDANKRVHEVVDHYVQLALESRRNPEKKQPGG
FT                   RYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLSSTFFYLARHPNVWIKLRQVIV
FT                   DAFGDAEHPKEEITQTKLKDIPYLRYVLNEVLRLLPPVPANFRVANKDTTLPVGGGPDQ
FT                   KSPVYIRKGTIVTYSVYAMHRRTDFYGPDANEFRPERWEENGKRGWEYLPFNGGPRICL
FT                   GQQYALTEASFTIVKLLQRFDRIENGDPDLIEPIQQTNLTLAHDRGVYIRLYSSKAL"
FT   CDS_pept        join(1066207..1066395,1066456..1067109,1067171..1067368)
FT                   /codon_start=1
FT                   /gene_family="HOG000170975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259026"
FT                   /orf_name="AFUA_4G03810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84530.1"
FT                   /db_xref="HOGENOM:HBG054407"
FT                   /db_xref="HOGENOM:HBG327367"
FT                   /db_xref="InterPro:IPR021627"
FT                   /db_xref="UniParc:UPI000051FB30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T3"
FT                   /transl_table=1
FT                   /translation="MASISKPSSQPPATGVIVPKMEHPPQTTTPAEVPERDNLSGEAWT
FT                   SEMQYVSSLAKLQKMEATIHQLRTLLSGRLIEPIIPIINPKVASRRPLPKSPRVLFEQL
FT                   SQTARASVAEVQEFQAMWRSPEMKAIWDHVDARIKQNGGQLLQPTGMWEQDYDVLLEEL
FT                   EKEEQAQKEQQQRAKEEEERAKIQGVEGGWRTIVETFTRRNLPGIRVMAHQDQPRITVV
FT                   SVKAGMAFQLQAVNGDGHDMVDWRVQELAAPGRPKTKLETAVAACLNARPRQWDLAYLL
FT                   DMIASYSDVKQTPCVKCGKMTDNAAQLPSVRRPNPLQSSQGQPVLWEAYHPTCIDPPPS
FT                   SRPTFS"
FT   CDS_pept        join(complement(1069401..1069524),
FT                   complement(1068722..1069351),complement(1068531..1068667))
FT                   /codon_start=1
FT                   /gene_family="HOG000170964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259027"
FT                   /orf_name="AFUA_4G03820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84531.1"
FT                   /db_xref="HOGENOM:HBG054408"
FT                   /db_xref="HOGENOM:HBG327366"
FT                   /db_xref="UniParc:UPI000051EC81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T2"
FT                   /transl_table=1
FT                   /translation="MRSLNFLSLLSLLLLLGTISSAWPWPQDGLNMAHGEIVARADTTA
FT                   SDETKTDSKASKTDSASDTNTADSTATDSSSGKKTSTGTAKETGTQTESGTSTETATDK
FT                   SGKNSKTKTSTKSTSIDPRLPAGGTSMLIPTAGATTYYKIGDYVTFAWNYTSLLVTPSA
FT                   VNVLATCTMNSATYTLTSNMSVEETGKVVWDTGKYQANATVPLLTATYTLYVVDVDKDI
FT                   GDTASPGHLGSQNGYLFGMYSPQPYTPLNEFNCATCNSALSDVERQALKFALGMVMITI
FT                   ASFTWFAGDFGVFST"
FT   CDS_pept        join(complement(1070872..1071178),
FT                   complement(1070686..1070813))
FT                   /codon_start=1
FT                   /gene_family="HOG000170953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259028"
FT                   /orf_name="AFUA_4G03830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84532.1"
FT                   /db_xref="HOGENOM:HBG054409"
FT                   /db_xref="HOGENOM:HBG327365"
FT                   /db_xref="UniParc:UPI00005201FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T1"
FT                   /transl_table=1
FT                   /translation="MRLLSTLTLLVSAVAANPMFHTARQDTSATKPFHLKTADASNEKH
FT                   NDLYVYAYHTGAGFNDAVLTPDKDTASTAFLNGTYTQFDLKTPFPWGFKPIAVTNYAQW
FT                   ESVEINVGYGAEGFFIDSTGLQWSEQQGFGGWLGKQFPCR"
FT   CDS_pept        join(complement(1076026..1076256),
FT                   complement(1075900..1075973),complement(1072502..1075841))
FT                   /codon_start=1
FT                   /gene_family="HOG000170952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259029"
FT                   /orf_name="AFUA_4G03840"
FT                   /product="DNA repair protein Rhp26/Rad26, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="EAL84533.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054410"
FT                   /db_xref="HOGENOM:HBG590781"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051EC70"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T0"
FT                   /transl_table=1
FT                   /translation="MDHSVKNEGDSSAEIEVVETPQRTEGLDPSDTAEVATAPDSKQQE
FT                   DPSAVTDEVTRLRELQADIRDQDDLERDISRQADRLLMEQADERDKRRLEKTTLEKEKL
FT                   EAQILKVHQRLSQPVGTSARVRLENELNNLESRNASLENDLKEIQKRIDDRHEGLEAGT
FT                   QATGTGRMPNESRRDYLIRTGKITPFSRMGTGPNEGPLASLHDALIDAEDERDEDEALE
FT                   QLKDRSAVSHRNLVRPGFDFDHESTDTSIAQTRPSKRRKLEGDARRKKAAIKQEDSDSI
FT                   AADEGIEISEDNDESADYVASEDQESLLGDEEEFFPDGKPERPLAHKKGKKPGDEMEDF
FT                   SGLDDGDERLYQSRLQSWVSRRSAARKRASKALQATEGHESTIDEQASTEEDEWFLPHP
FT                   TVPDVSYDNGYRLPGDLNPYLFDYQKTGVQWLWELYQQKVGGIIGDEMGLGKTIQAIAF
FT                   LAGLHYSKKLDRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRSESSRE
FT                   DALLSQTYSSNSRGITSNQKAARKVVKRVVEEGHVLVTTYSGLQTYSHFLIPVEWGCAI
FT                   LDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNF
FT                   RNQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKTEQVL
FT                   FCKLTKPQRMAYESFLKSEEMESILKGRRQILYGVDILRKICNHPDLQNHKMQSHQSGY
FT                   GNANKSGKMQVVKSLLELWRDTGHKTLLFAQHRIMLDILEKFVRSLSGFNYRRMDGTTP
FT                   IQNRQTMVDEFNNDPNIHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAW
FT                   RLGQKRDVSVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTSFQLSDLYDLFAL
FT                   GDEKPGATETSKLFQDAQVTFHGDGDGNTAQPTKAEDVSSDMQAEKNDISKVVGVSSVE
FT                   RYQGESEQPSDQEKGPGGVNSESRIMEGIFARSGVHSALEHDQIVNGKRVVRADPKIIE
FT                   AEAKRVAAEAAEELRRAGEAARSVPIGTPTWTGQFGVAGRPEERPLPSAFGGRSSTARR
FT                   TAAGPSSASILANLSARTPSSRSATNSPAPSRSPTGVDFMTMIRDYILSQGGAVYTQML
FT                   IDHFNRYCTTPQRSAEFKEMLKTIAVLEKGGRNGRGRWSLKPEFAKVK"
FT   CDS_pept        join(1078016..1078568,1078629..1078900,1078952..1079151,
FT                   1079217..1079376,1079427..1079686,1079744..1079863,
FT                   1079911..1080269,1080321..1081081)
FT                   /codon_start=1
FT                   /gene_family="HOG000170931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259030"
FT                   /orf_name="AFUA_4G03850"
FT                   /product="Protein kinase Yak1, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL84534.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG191920"
FT                   /db_xref="HOGENOM:HBG327364"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051EA59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S9"
FT                   /transl_table=1
FT                   /translation="MGSQWQPYQDPLMGRPAQFNNGLASTPQQLGPKYGGQPQQSQPPV
FT                   GYTYEAFQTPGTAAKPPSAGANSKSVSMASSPAATPRSRDYVTDADTTMEDADPYNRAK
FT                   YSARPNHHSRPSSQFFSPEESSAARRYSPMNVLSPSMSYNTSPGKSQNSYAFPPGPNNS
FT                   RRSPTRALNYSSPAQSFQSPPSVSRPPRLPPLQPTEMSSDQFYPPSAGSQVNAHFGQDG
FT                   RSPRSGSISGASKQAGRGPVPKFQKIKSVQELQPRINAQPPYRRANPEGGFISPLQALT
FT                   SHLPATYRICNPSFNYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAG
FT                   HKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSK
FT                   YDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLN
FT                   ALSLLNKAHLIHCDLKPENILLKNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEV
FT                   LLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQS
FT                   GEFFEKTQDEFGRKTYRLKSLEQYSREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMK
FT                   QAEIERELNNRVAFIDFVRGLLSINPLERWSPQQAKLHPFITQQKFTGPFVPPMNLKYS
FT                   SLNKTIPPGIQQQQQAEAASKQRAAQAAHAQSAAQNAYSMQMNQFHTPSHGQPPPMYNG
FT                   MFAGHQQGAPPPYPAQPPGYGHQMNLMPGQMPQSQYAPSQSLYAQATTRAGRQRASTMD
FT                   HQGGGIPPTIQRVASHLDPNAPIRLQPSPAYYPPPPDGYVDNNAQRRRGSRAGAGQRNR
FT                   DFIRTLEDGVLGGDGYMNQSQWH"
FT   CDS_pept        join(1082663..1082999,1083094..1085345)
FT                   /codon_start=1
FT                   /gene_family="HOG000029414" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206313"
FT                   /gene_name="nip1"
FT                   /orf_name="AFUA_4G03860"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit C"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="EAL84535.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="HOGENOM:HBG354580"
FT                   /db_xref="HOGENOM:HBG608917"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000051E804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9S8"
FT                   /transl_table=1
FT                   /translation="MSSRFFYGGGSDSDSSSSDEEELYSDREEEEKSEEEESSEEEDET
FT                   SEEEESDEETGARKFLKDVASDSEEEEEEEKVTVVKSAKDKRLDELENTIKLIENAKKI
FT                   NDWAVISTEFDKLNRQVAKITQSGPTPKIYIKAVADLEDFVNETVAKQKSGDKKLNASQ
FT                   AKGFNAAKQRIKKNNKDYGNLIDKYRKDKEDFMESDDEEAIPVIAAPRITKLERIEAPA
FT                   AAIDDDGFATVGRGGKTLQYTPESILKHLRVIVESRGKKNTDRMEQIRTMEKLLEVAQT
FT                   PYQRIRVYLTLISTRFDLTSTSSANYMAVDQWKSAEQDFSSLLSVLENNRDHVVFEGAE
FT                   EWEDDEKQPTIAPGETLYIPGSIVSFAERLDDELTRSLQHIDPHTAEYIERLSDEKLLY
FT                   TDLVRAQAYVEGLNEVEKTDPRQDSVNRVVMRRLEHVYFKPSQVITILEDATWKSLPSE
FT                   LDSSITPRASSGNVENLVLSLCNYLFKYSDGIIRARAMLCQIYFLALHDQYYRSRDLML
FT                   MSHLTENISNFDVSTQILFNRTLVQIGLCAFRSGLIYEAQNTLSEVCGSGRQKELLAQG
FT                   IIMQRYSTVSPEQERLERQRQLPFHMHINLELLECIYLTSSMFLEVPLMAQTSSSPEMK
FT                   RRVISKTFRRMLDYNERQVFTGPPENTRDGVIMSAKFLAAGDWKKAAEMLNSIKIWDLM
FT                   PQPDKIKEMLSQQIQEEGLRTYLFTYAPFYDSLSIATLSNMFELSEKKISAIISRMISH
FT                   EELAAALDQVNNAIVFRKGVELSRLQSQIVTLADKSMNLLEANEKTLEQRTQGMANAFQ
FT                   RDQGAGARGGRGSGRGGQARGGPRFPGGQQGRRPGGQQFGGGALGGAIKA"
FT   CDS_pept        join(complement(1086486..1086955),
FT                   complement(1086114..1086426))
FT                   /codon_start=1
FT                   /gene_family="HOG000170930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259031"
FT                   /orf_name="AFUA_4G03870"
FT                   /product="ELL complex subunit Eap30, putative "
FT                   /protein_id="EAL84536.1"
FT                   /db_xref="HOGENOM:HBG030340"
FT                   /db_xref="HOGENOM:HBG397278"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="UniParc:UPI0000520452"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S7"
FT                   /transl_table=1
FT                   /translation="MSTRRGVGLGAFANRTQTSQSYANHGANLRSAHLESLQTQLSVFQ
FT                   SLLHTFALEHGSTIKSNPTFRAEFARMCNAIGVDPLAASNVKGKNGRRGESASFWTQIM
FT                   GGDMNDFYFEVAVRVVELCRSTRSDNGGLLGVEECRKKVGKGKAIGSGLEVTDDDVLRA
FT                   VKSLGPLGSGFSIVQVGSKQYIRSIPKELNTDQATVLEAIQILGYVSLSMLQLNLNWTK
FT                   ARAQTVIDDLVADGLVWVDTQGEENEYWSPQNLLDDSG"
FT   CDS_pept        join(1087468..1087618,1087871..1087986,1088178..1088344,
FT                   1088399..1088858)
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20749751"
FT                   /orf_name="AFUA_4G03880"
FT                   /product="60S ribosomal protein L7 "
FT                   /function="structural constituent of ribosome"
FT                   /function="transcription regulator activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="EAL84537.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG359947"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI0000520427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S6"
FT                   /transl_table=1
FT                   /translation="MAWGIEVESVVSLLLEKHCCELSCPPTVLRTDCQESVRTATTYLP
FT                   ERNAWASTVPTQDQVLVPETLLKKRKSQEQARAAAREEAQKRKEANKKKREAIFKRAEA
FT                   YVKEYRDAEREKIRLARVARQQGNFYVPDEPKLAFVIRIKGINKIAPQPRKILQLLRLV
FT                   QINNGTFVRLTKATQEMLTIINPYIAYGYPNLKSVRELIYKRGYGKVNKQRVPLTDNQV
FT                   IEEALGKYGIVCMEDLIHEIYTVGPNFKQANNFLWPFKLSNPTGGFRTRKFKHYIEGGD
FT                   TGNREENINALIRQMN"
FT   CDS_pept        join(complement(1090390..1090545),
FT                   complement(1089603..1090331))
FT                   /codon_start=1
FT                   /gene_family="HOG000170906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259032"
FT                   /orf_name="AFUA_4G03890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84538.1"
FT                   /db_xref="HOGENOM:HBG054412"
FT                   /db_xref="UniParc:UPI000051F3E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S5"
FT                   /transl_table=1
FT                   /translation="MPELIDDKSQYCIPFLLKRLEAHQARYGNDSNNTPPFFLGLNGVQ
FT                   GAGKTVLVSTLQSTLRAAPYSLPVVTISLDDFYLTHEQQQILAKTFPSNPLLQHRGQPA
FT                   THDLPLAEKVFESLCAGRPTAIPQYDKSAYSGQGDRVPESQWETVNGDGQDKIKVVIFE
FT                   GWCVGFRALDEDVLREKWEAAVRQKDQGGYNGRLGYVKFEDVKAVNDALRKYDVLTEFV
FT                   SLPSWIALDVDANCSSEPARRIGSYVSATLLHSLSYQYPLAKHLQAMRKTSTLSTTGDR
FT                   NRRERCVQSKERE"
FT   CDS_pept        join(1091411..1091566,1091631..1091858,1091924..1092032,
FT                   1092081..1092170,1092228..1092615,1092670..1093078,
FT                   1093140..1094459)
FT                   /codon_start=1
FT                   /gene_family="HOG000170895" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259033"
FT                   /orf_name="AFUA_4G03900"
FT                   /product="Peroxisomal multifunctional beta-oxidation
FT                   protein (MFP), putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84539.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG037639"
FT                   /db_xref="HOGENOM:HBG327812"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051F407"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S4"
FT                   /transl_table=1
FT                   /translation="MSELRFDNQTVVVTGAGGGLGKAYATFFASRGANVVVNDLGVSHS
FT                   GEGASSKAADVVVEEIRAAGGKAVANYDSVENGEAIIETAIKNFGRIDVLINNAGILRD
FT                   VSFKNMKDQDWDLINKVHTYGAYKCARAAWPHFRKQKYGRIINTASAAGLFGNFGQANY
FT                   SAAKLGQVGFTETLAKEGAKYNIIANVIAPIAASRMTATIMPPEVLENLKPDWVVPLVA
FT                   VLVHPSNTTESGSIFEVGGGHMAKLRWERAKGALLKTDASLTPGAIARKWKDVYDYSQP
FT                   EYPIGPADFMTLLENGMKTPSAPAGEEPDLKGKVALVTGGGNGLGRSYCLLFAKLGASV
FT                   VVNDLVDPEPVVQEIKKMGGKAVGNKASCEDGDAVVKTAIDAFGRIDILVNNAGILRDK
FT                   AFTNMNDDLWNAVINVHLRGTYKVTKAAWPHMLKQKYGRIVNTTSTSGIYGNFGQANYA
FT                   AAKLGILGFSRALAIEGAKYNIKVNTIAPNAGTNMTRTIMPEEMVQAFKPDYVAPMVAL
FT                   LCSDMCPEPSSKGLYECGSGWFSSTRWQRSGGHGFPVDVKLTPETVLKNWKQITDFDDG
FT                   RADHPQDSQAGTEKVMANMSNRSGGEGGNNILANIEKAKQATTEGTAFDYIDRDIILYN
FT                   LSVGAKRTDLPLVYENNEHFQALPTFGVIPWFNTATPWNMDDIVANFSPMMLLHGEQYM
FT                   EIRKFPIPTEAKTLTYPKLIDVVDKGKAALVVAGYTTKDAKTGEDLFYNESTVFIRGSG
FT                   GFGGSPKPTASRPKGATAAYNPPKRQPDVVIEEKTSEDQAALYRLNGDRNPLHIDPEFS
FT                   KVGGFKTPILHGLCSLGISGKHVFNKFGAFKSLKVRFAGVVLPGQTLKTEMWKEGNTVI
FT                   FQTTVVETGKPAILGAGAELLEGAKAKL"
FT   CDS_pept        1094933..1097143
FT                   /codon_start=1
FT                   /gene_family="HOG000170874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749752"
FT                   /orf_name="AFUA_4G03910"
FT                   /product="RING finger protein (Zin), putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84540.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054413"
FT                   /db_xref="HOGENOM:HBG327811"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="UniParc:UPI00005206AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S3"
FT                   /transl_table=1
FT                   /translation="MVLSLPVPGFSKSTLTSPALRSSNSSSGSSNSNSQSTTLSEALRN
FT                   NPFGNTSRSRAIAALTSSTQAENAKQEQEELNNALETLARIFPDVKIEVFRELLVRFDG
FT                   QSRLQVCVEQLLRHKNEWVAGRWNVPTRTGGEQGDGDGDVSREHDERLVPPEERFRSDE
FT                   YKASVKGVLAKEFSGLSRSTIEAVLAEANFCYMRARPTLKELSRRTWRATLNNILPSFK
FT                   RKKDKDEHPLVVWQRRADGELLPRLKETGCVELDRELYDALLAPLLRVRREEQEEKDFK
FT                   LAEELNEREAQAVDALYECECCLADVTFEKISTCSVDSHIICYSCIQRTIHEALFGQGW
FT                   GKSVDVERSTLKCIAPIAQGSCEGSLDPESVKRAIVMEKAGLETYCKFETRLASESLMK
FT                   SQLKLVRCPFCSYAEVDPVYHPSSKGITWHFRRDGLLSTILMTVILLDMVPLLAIPLII
FT                   LYLLDPTAVPTILKNSLLNLCLKVRPKRFTCANPLCRRVSCITCQKPWRDPHICHEPLL
FT                   LDLRATVEAARTAAVKRTCPRCGLSFVKSSGCNKLTCVCGYSMCYLCRKALGSSLPAAG
FT                   QARVPRLVAGIFNQENIAPAGRNPVDNDRNGLDGEDAEEGYKHFCEHFRINPGSRCTEC
FT                   NKCDLYQAEDEEAVARRAGERAEREWRARQGASAAGVAVGALQVNNDFSADTHRKSWGL
FT                   PLHQGKGWGYWLNEVWHDGQWKLEGQALVDWVVEQVVVIDEI"
FT   CDS_pept        join(complement(1099263..1099418),
FT                   complement(1099082..1099167),complement(1098231..1099030),
FT                   complement(1097992..1098181),complement(1097878..1097934),
FT                   complement(1097384..1097702))
FT                   /codon_start=1
FT                   /gene_family="HOG000170863" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206314"
FT                   /orf_name="AFUA_4G03920"
FT                   /product="MFS drug transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84541.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG032742"
FT                   /db_xref="HOGENOM:HBG328580"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EA5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S2"
FT                   /transl_table=1
FT                   /translation="MPDPLISQRQESSPSSSSGTIVEVTEGTETKTEGQHVFNEQTNYV
FT                   PKSTIITTTLAASLSIVGNALNASNQTSWISGAYFVTSTCFQLLYGRLSDIWSRKYVLF
FT                   AGLAIFFFGSLAASLAQTATQLIIFRAFTGIGGGGLMTVAQMIVSDVVPLRERGKYQGI
FT                   LGAVVAIANGIGPVIGGALASASIEKESWRWIFRLNLPLTVLTTLCVFFFMPLRKVTGS
FT                   WKVKLAAVDFVGAALALSGTAVLLLGLNWGGGEYAWDSAHVIATLVVGVAVCVAFVLWQ
FT                   WKGAAFPLVPMHIFRSRIVNGACLTMFINGWNFLVQVYYIPTFYQLVFGYSTVKAGAML
FT                   LPITLLQTASSTASGLVVHWIGRYRECILFGWTIWAVGLGLFSTLDQSSGLGKQIGYGI
FT                   LTGVGVGNTLQPALIAIQAGVDRRDMAVVTSNNILSSSISSLGLTVSETRSFLSSPQNY
FT                   LSGLSVAEAERVRALVIPAYKRGFRIIFVIGGALAAFAFCLAFALMPQVELNRADDAKL
FT                   KEEAKKRAAGEDDEKNTC"
FT   CDS_pept        join(1100281..1100470,1100521..1101350,1101406..1101966)
FT                   /codon_start=1
FT                   /gene_family="HOG000170852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749753"
FT                   /orf_name="AFUA_4G03930"
FT                   /product="Cysteine synthase B, putative "
FT                   /EC_number="2.5.1.47"
FT                   /function="cysteine synthase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="EAL84542.1"
FT                   /db_xref="GO:0004124"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG054414"
FT                   /db_xref="HOGENOM:HBG327810"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000051EEFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S1"
FT                   /transl_table=1
FT                   /translation="MAANELNVYRGPDALRKYFDPDCQPPLPLVEVPEYLNPYHPDGVR
FT                   IYAKMMSMHPANNVKAMPALNMLEKKVVPGKTKTIIEYSSGSTVISMSMIARIMHGIHD
FT                   TRAFLSNKTSDAKLKLMQFFGLDITLFGGPSQPEPFDDRGGIQRARKMGLESDEILNPN
FT                   QYENNDNWGAHVRWTGPQILKQLPEINVLCAGMGTSGTMTGLGMFFKENKPSVLRLGVC
FT                   TAAGDRVPGPRSLALLKPVEFPWREAVDAIEEVNSYDSFSLSLDLCREGIVCGPSSGFN
FT                   LQGLFQLLGKRKQAGTLAELAGPDGLIHCVFICCDLPYQYIGEYFSKLGEEKFHPIKNQ
FT                   NLSAVDIYRYDESWERSPIVLFTHFYETPRSLSDSLLRNIELRPLCCVLDLRTAADYST
FT                   WHLPGSVNIPLRSLDSHTPKPFADPGVLEAQWLELETLFKTEEALSKLRGQHVLVICYH
FT                   GDTARVATSVLRAKGIEADSLRGGYQALRDHGLWGENEVSTCTANGTRTGSEHMTSTIS
FT                   LESVPLQVG"
FT   CDS_pept        join(1102643..1102779,1102840..1103090,1103139..1103259,
FT                   1103306..1103557,1103620..1103718,1103767..1104724)
FT                   /codon_start=1
FT                   /gene_family="HOG000170841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206315"
FT                   /orf_name="AFUA_4G03940"
FT                   /product="Ferric-chelate reductase, putative "
FT                   /EC_number="1.16.1.7"
FT                   /function="electron carrier activity"
FT                   /function="ferric-chelate reductase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84543.2"
FT                   /db_xref="GO:0000293"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054415"
FT                   /db_xref="HOGENOM:HBG324432"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0000F51ABB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S0"
FT                   /transl_table=1
FT                   /translation="MMDMSDDAGSGLPWLDQPVMLHSSRKDTCKLSPEQCAYRRGHWRY
FT                   WYEADHVYALNTVYFMCVTIGVFAIAHFLSRRAPLPVKRSAVWRKTTAAIRYLSYQGYQ
FT                   ISSLRYWSPSLGVMFLGLVGFVFFFVMTLGPKPYYWPNTATVSYGSSPPIATRTGWMAL
FT                   GLLPFVLVLGTKANLISMLTGVPHEKLQVFHHWASYAMFVLALIHTFPFIIVHIDKGDM
FT                   VKQWKTEVTYWTGVAALIPQAYLTFMSLPAIRNRYYEFFKATHITVALLFVLFFFFHCD
FT                   FRLTSWDYFIAGGALYLFSLCAAYIRTTLLHGRHKATLDVLPCGLVRIKIPTFITWSPG
FT                   QHVFLRFLNASQLGLHSLTAHPFTITSIAHDAASLSKHNELVFYIQPRGGITARLASLA
FT                   AQRPGTEQTVLLEGPYGGLAASAGKDLARFDLVLVISGGSGSGFSLGIVDAVLASSSHS
FT                   SSSTPALQTIFATRNQSMAEWYVEEIESRISTSNVSTRGGDVSASVFVTRQQEQQHRQT
FT                   DDESKLPSTKPLARSMSQIGITHGPPPDLPAFIAGCTSPSSARGKRLGIFVCGPASMLH
FT                   DVRNAAARAQRDVLGDGPEEVYLHLEPFS"
FT   CDS_pept        join(complement(1105824..1106041),
FT                   complement(1104973..1105750))
FT                   /codon_start=1
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206316"
FT                   /orf_name="AFUA_4G03945"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27191.1"
FT                   /db_xref="HOGENOM:HBG332679"
FT                   /db_xref="UniParc:UPI0000F51AA7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA76"
FT                   /transl_table=1
FT                   /translation="MSRNALTPDGPVTIPAPAAERALKPPTAPTASASATASSRWNTDK
FT                   LGMRLGVDIASAMTAGALTCPVITVIDRAIIEKAAKGLPIRSTLTACFRSMLTRPAAFV
FT                   TSVPFLLIYTLYTSTYLTANAIDTLASTLRDRPFETVFPGTAKFLTTTAVNMGICVYKD
FT                   ARFARIFGAGNNAAASTTTGSRTGGGAPGGATCHPSGTSALKVPKISYALFCLRDSITI
FT                   FASFNVPALLAPRIPDGIVATAGGKSALAQFACPALMQFVSTPMHLLGLDLYNRQPVGG
FT                   LGWRERVGRIRRDYVASCFARMGKIVPAYGVGGVVNVRMREGLMRRLSAS"
FT   CDS_pept        join(complement(1107735..1107944),
FT                   complement(1106638..1107681),complement(1106496..1106573))
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055112"
FT                   /orf_name="AFUA_4G03950"
FT                   /product="Cystathionine beta-lyase MetG "
FT                   /EC_number="4.4.1.8"
FT                   /function="cystathionine beta-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EBA27192.1"
FT                   /db_xref="GO:0004121"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000F51A66"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA77"
FT                   /transl_table=1
FT                   /translation="MSASGSGAAVPAATDVMKKAFPHVDLDGHNLPPSPAPSSPRTGKR
FT                   YAIATELVYTDSNDQYNASSVPIYQSATFKQTSGGGGGEYDYTRSGNPTRTHLERHLAK
FT                   IMSAQRALVVSSGMAALDVISRLLRPGDEVVTGDDLYGGTHRLLKYLSTNGGIIVHHVD
FT                   TTQPEKVREVLTPKTAMVLLETPTNPLIKIVDIPQIATAAHEVNPSCLVAVDNTMMSPL
FT                   LLNPLELGADIVYESGTKYLSGHHDLMAGVIAVNDLALGERLYFPINASGCGLSPFDSW
FT                   LLMRGVKTLKVRMDQQQSNAQRIAEFLEAHGFKVRYPGLRSHPQYELHHSMARGAGAVL
FT                   SFETGDVAVSERIVESAKLWAISVSFGCVNSLISMPCRMSHASIDAKTRQERAMPEDLI
FT                   RLCVGIEDVDDLIDDLRRALVQAGAVNITLDGFEANASNETNSA"
FT   CDS_pept        join(complement(1111407..1111549),
FT                   complement(1110608..1111338),complement(1110486..1110558),
FT                   complement(1110008..1110436),complement(1109772..1109954),
FT                   complement(1108708..1109719))
FT                   /codon_start=1
FT                   /gene_family="HOG000170819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259034"
FT                   /orf_name="AFUA_4G03960"
FT                   /product="C6 transcription factor Ctf1A, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84545.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054417"
FT                   /db_xref="HOGENOM:HBG324433"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51A75"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R8"
FT                   /transl_table=1
FT                   /translation="MNLLEQVRCDAASLGVPCTNCVAFSIECKIPTPKRKKQQSKSKDT
FT                   NSGTDERNEDGKDKQEESPGDGTDSKDAFGYRKNRMAVDGMPVTTLTEQQEAQQASHNT
FT                   AYAQFMKPKFARAPIKEAGRVAYLGESSNLSLLVQDRHGTTDVVHYPLPPNIRGSRARL
FT                   TDLDNLELDILHQRGAFLLPPKPLCDELVEAYFRWVAPIVPIVNRSRFMRQYRDPKNPP
FT                   SLLLLQAILLAGSRVCTNPQLMDANGSTTPAAMTFYKRAKALYDANYEDDRVTIVQALV
FT                   LLGWYWEGPEDVTKNVFYWTRVAMVVAQGSGMHRSVETSQLSKPDKRLWKRIWWTLFTR
FT                   DRSVAVALGRPIGINTDDSDVGMLTEDDFIEDEIDSVAEYPPDPVHVQFFLQYVKLCEI
FT                   MGLVLSQQYSVASKSRRMNAMDLTHSDMALADWLQNCPKEVCWQKSRHHFLAALLHANY
FT                   YTTLCLLHRAHMPPASSAPNSYRVEEMAYPSRTIAFQAAGMITSIVENLQTHQEIRYAP
FT                   AFIVYSLFSALIMHVYQMRSSVPSIVATCQERINICMQALKDVSKVWLVAKMVHTLFES
FT                   ILGNKVLEERLQKAAGKRHQRVRPETQTQQPPAKKPDPPKRKFDDMDLGLPNGGPTPPV
FT                   SYERSRPQTPAVTPSRELGQPPGISVPQGSPTGPQNAMPGNSRSNTRPTTPFNGHFSLP
FT                   ATPPDLFLVTRTSPNLSPSLWENFQPDQLFPDGTAIFPELASPQNHTVDPQLQMQSQLQ
FT                   SQGMQQRHMMVNQTPQMPGRHLSSPELMSGLPPGMGLHGGQPQQVFGLENQHGWPMQGL
FT                   EAALNATGMDNTSQDDNWSSSSRSGPTAPTTLNVEDWYVCIRDA"
FT   CDS_pept        join(complement(1116457..1118205),
FT                   complement(1116220..1116422),complement(1116016..1116157),
FT                   complement(1115804..1115912),complement(1114832..1115727))
FT                   /codon_start=1
FT                   /gene_family="HOG000170818" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16259035"
FT                   /gene_name="mcd4"
FT                   /gene_synonym="pigN"
FT                   /orf_name="AFUA_4G03970"
FT                   /product="GPI ethanolamine phosphate transferase 1 "
FT                   /EC_number="2.-.-.-"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84546.1"
FT                   /db_xref="EMBL:ABD84043.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG524563"
FT                   /db_xref="HOGENOM:HBG609268"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="UniParc:UPI000051F3E9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9R7"
FT                   /transl_table=1
FT                   /translation="MARLGRFGFLALAVVFHLIYAYSIFDIYFVSPIVSGMRSYGVERE
FT                   PGAKAPASRLVLFVADGLRADKAFQPAPDPSPEDGEDAENNDPIYLAPFIRSRVLSHGT
FT                   FGVSHTRVPTESRPGHVALIAGLYEDVSAVTTGWKLNPVNFDSVFNQSRHTWSWGSPDI
FT                   LAMFKEGAVPGRVDADMYGEEIEDFTMDATQLDTWVFNKVKELFASAKSDPELDAKLRQ
FT                   DKVVFFLHLLGLDTTGHGYRPYSREYLHNIKIVDKGVQEIATLIEEFYGDDRTAFVFTA
FT                   DHGMSDWGSHGDGHPDNTRTPLVVWGSGVAGPKYTDGKAVTGHEDGFSADWGLDGIQRH
FT                   DVAQADVAALMAYLAGLDFPVNSVGQLPLEYIDASPKEKALAALANTQEVLEMYRVKEA
FT                   QKRAALLRYKPFEPLADHGKNSVEEHIAEIQVLIANGSYDEPIKRSGALFATALEGLRY
FT                   LQTYDWLFLRTIITFGYLGWIAYALTTVIDLHVLHRTSDSKRTVGSTIFFTSILAALFS
FT                   VLLYQKSSWQYYVYGAFPIFFWEEVFARRKALIAGREILLGHVRSFGGYIASGFQLVAF
FT                   VAVLEALLMRHQVQSYFHREIYTVCFVLGSFWPILYGVDFVRQNTVLSATWAVGCSLMS
FT                   TFTLLPVIKVENINTITYGALLMFFTGLFYLLFEDTILKHSKSSGHAPGAISSLGSRVI
FT                   MGMQVGMVLLALIVTRSSVSSLQAKQGLPFGNQVVGWFVLVASLVLPFFHRLYPNSHYL
FT                   HRLMVLFLTFSPTFIILTISYEGLFYFVFCMTLVTWVRLEHAIYVYTARSSAHYGGNNT
FT                   VPKKPGLNATAVIDGQEYRYRRLGLADTRVALFFFFLLQSAFFSTGNIASVSSFSLESV
FT                   FRLIPVFSPFSQSALLILKLLIPFAIISANLGILNRRLEVAPSALFMVVMSISDVMTLN
FT                   FFYMVRDEGSWLDIGTTISHFLIASFLCTFVAGLEFLSEVFISGVDFGPTTKAIGASIT
FT                   KTVGGTAGSDVVDSQSGPEDAANSKKAEGLEGSETIRQNGGSV"
FT   CDS_pept        join(complement(1119504..1120443),
FT                   complement(1119026..1119454),complement(1118749..1118969))
FT                   /codon_start=1
FT                   /gene_family="HOG000170796" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259036"
FT                   /orf_name="AFUA_4G03980"
FT                   /product="Chromosome segregation protein (Pcs1), putative "
FT                   /function="DNA binding"
FT                   /protein_id="EAL84547.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG054419"
FT                   /db_xref="HOGENOM:HBG327807"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="UniParc:UPI000051FFAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R6"
FT                   /transl_table=1
FT                   /translation="MPKRKATGRLSGQAGSDGANAMQVNGNDAGQRENERPAKRARGRP
FT                   RSKSVESKPPAETKRNSTVAQAQAPDSGPKKASKRGRPKGSRNSAHGATQEGPERKGGN
FT                   EKIKDEVGVQESESLAASDDELDDAPVATKTNQKAKSAKPAATRGRKKVSAGKQVQTDG
FT                   EFEYTPRATRHVQPPAESQDQLEQPMSQSRHIHWTDPSSVAAENEQEEMELVEDTNLHE
FT                   EAVVPRSTSASPMKGRRPSQPAPGSSPLKKKLGVSTDDDRTGEPELRRRLGDLTKKYDT
FT                   LENRYRNLREIGIVEANANMEKLRQHCEAVTTASNNLVASLKAELEAQKKLGQQSRALQ
FT                   KQLKERDAEVAELKSQVSEAKKQLTSAQSEVKALQTKLAAARNTTASLENAAAKVPGSA
FT                   IKNNRANRAADAEAAQAAHLSQLKEELYSDLTGLVILDVKKRESDHLYDCLQTGVNGTL
FT                   HFKLAVPTITSTNFETAEFQYIPLLDESRDRELVEILPEYLTVDITFVRQQASKFYTRV
FT                   IDALTKRRSSTN"
FT   CDS_pept        join(1120887..1120952,1121006..1122199)
FT                   /codon_start=1
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19901730"
FT                   /orf_name="AFUA_4G03990"
FT                   /product="Membrane-spanning ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="EAL84548.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000051E5AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R5"
FT                   /transl_table=1
FT                   /translation="MASARGPRWQQFLQELVMVAGTSASAYFLIRYLLSRLDFDPESQK
FT                   KEEQRRKSAAILRKLDGGEESDGDSPRRGAKKARRQRRGDLVLNQYEQAIAMDVVAPDD
FT                   IHVSFEDIGGLDDIIEELKESVIYPLTMPHLYSSTSSLLNAPSGVLLYGPPGCGKTMLA
FT                   KALAHESGACFINLHISTLTEKWYGDSNKLVNAVFSLARKLQPSIVFIDEIDAVLGTRR
FT                   SGEHEASGMVKAEFMTHWDGLTSANSLGEPQRVVVLGATNRIQDIDEAILRRMPKKFPV
FT                   TLPPAAQRLRILSLILKDTKVDRENFDVHYLVKAMAGMSGSDIKEACRDAAMVPVRELI
FT                   RQKKAEGLQMTSVNPTEVRGLRTEDFFSRAGGVRVISQPSQHQTRPTSKASSEKEWSTA
FT                   ESDAASEVESRPAEMTEPPE"
FT   CDS_pept        1123334..1125292
FT                   /codon_start=1
FT                   /gene_family="HOG000170785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749754"
FT                   /orf_name="AFUA_4G04000"
FT                   /product="LysM domain protein, putative "
FT                   /protein_id="EAL84549.1"
FT                   /db_xref="HOGENOM:HBG054420"
FT                   /db_xref="HOGENOM:HBG327806"
FT                   /db_xref="UniParc:UPI000051FB31"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R4"
FT                   /transl_table=1
FT                   /translation="MSSNNGIIDTFSPGAASTNTGSRSTSTVRPRTRRLISVDDVTDED
FT                   YEGPLQSTRLSTTTLSRDSSAVRSRGATPSPHTSRGTSPLPMRHPSRATESLNLDNLNR
FT                   FGGSLGGHSQTGKAQVKFADSSRAAVDFLDSSWTSLQSLASSFLGSDIARSAPNGTART
FT                   HARKPSRPDPYMRANPKTPSAWGPSTPSTSEIAAGTKEERLAMVQAKKREALLLADTGS
FT                   EASRDIRHKRRDSSDRTDHAAVDARQDEEALVYVHHVQPNDSITGVAIKYGCQPAIFRK
FT                   ANGFWPTDSIQSRKTVLLPVTSCSVKGRPIRAPTEIDLLGGDTSNRDSLEDLTGSSIAP
FT                   APSSDARASSTEGEAPTEAPLEGEADKIWKHQSWVQIDGFSAPVEIGRVPRKALGFFPR
FT                   TRRKSLSYTDSEPRSSISGRERTAALTSALPSPTESPSSQASTAQNRSSTDPSGARAIS
FT                   SAKPRPHHQRQRSNIQLVGTGVGTLDRSAMAPGPALDGLSKFVAQHLPQLAPAPAPPGL
FT                   GRTPSEYAAATASNASTSLDNIGGAVEGWVRKLTTRAKAGLSELQQSAQAYQSNTGART
FT                   SRRGMGDLIELDAGLESRDSSGLLPESSRKPNLNRSGSNLHDASLRERFPSPSSSGTSR
FT                   TRTGGSNLGYGNRVKDD"
FT   CDS_pept        join(1126130..1126668,1126721..1126835,1126884..1127002,
FT                   1127056..1127123,1127174..1127264,1127311..1127899,
FT                   1127950..1128085,1128131..1128276)
FT                   /codon_start=1
FT                   /gene_family="HOG000169228" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055113"
FT                   /orf_name="AFUA_4G04010"
FT                   /product="Triacylglycerol lipase (LipA), putative "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /protein_id="EAL84550.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="HOGENOM:HBG053663"
FT                   /db_xref="HOGENOM:HBG326885"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000051E59E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R3"
FT                   /transl_table=1
FT                   /translation="MARRISSLAWLSLLLGALSRALPSSQTQGAIADYPTATLRTSYQS
FT                   GSKTVFVGRSLPEFDQELFLGIKYADQPIRFTPSSLKTSYAANDSNSGPYDASGTGLAL
FT                   SKGTVLYNATQYGHECPGYGSDETKLVDMGLITLHEDCLNLNIIRPTRKSDNEELLPVM
FT                   IWIFGGGWQQGATADPRYNMSYILRQGALNGKPVLGVSINYRVAAFGFLDSEEVRATGN
FT                   NNLGLRDQRVAMRWVKENIKAFGGDPDKVTIWGESAGAYSVGAHLVANGGDNEGLFRAA
FT                   IMESGNAVGPPWNGTDWHQPMYDRIVNKAGCSTSSDTLQCLREVPYQSLYDIAYEGLEW
FT                   FAAIDGSFIKEYPQISYTEGRLAKVPILLGSNTDEGTSFGTTGTNTDEECINQLICGFF
FT                   CRPRQRLVLTMTASKRWVLTREEATRLLTYYPNDPALGCPYGWGNVTWPKLGLMYKRYE
FT                   SMAGDLTMVAPRRLLAQTMAKYTKQVYSYRWDVPALNTSSTIGVGHFAEIPFVFANPVQ
FT                   NITPLGTDPSRLELGNMAARMWTSFVTDLNPNGHGVPRIPQWPKYTPGKKASNFVFRLP
FT                   ANGSYVERDDYRLDGMDYINNIAR"
FT   CDS_pept        join(complement(1129179..1129309),
FT                   complement(1129048..1129112),complement(1128904..1128964),
FT                   complement(1128812..1128832),complement(1128714..1128755),
FT                   complement(1128601..1128643))
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259037"
FT                   /gene_name="fpr1B"
FT                   /orf_name="AFUA_4G04020"
FT                   /product="FK506-binding protein 1B "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL84551.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG430304"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI0000520413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9R2"
FT                   /transl_table=1
FT                   /translation="MGLEKQTLRMGNGKDHPQPGDPVELNYTGYLYDESNPDHHKGKEF
FT                   DSSKRRGPLKATIGAGDVIRGWDEGVRQMSLGEKAILTMSGEYAYGEKGFPGLIPPNAS
FT                   LVFEVELLKIKDHGLD"
FT   CDS_pept        join(complement(1130473..1130631),
FT                   complement(1129890..1130426),complement(1129610..1129840))
FT                   /codon_start=1
FT                   /gene_family="HOG000170774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259038"
FT                   /orf_name="AFUA_4G04030"
FT                   /product="Histidinol-phosphatase"
FT                   /function="histidinol-phosphatase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="EAL84552.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004401"
FT                   /db_xref="HOGENOM:HBG176125"
FT                   /db_xref="HOGENOM:HBG327805"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI000051EA3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R1"
FT                   /transl_table=1
FT                   /translation="MPFSHHSHSGQFCPGHAKDSLEEIIKLAISKKFKVFCLTEHMPRA
FT                   KEDFYPEEIETGNTEASLIANEAAYFAEAVRLREKYADQIQILIGFEIDWIRPESRTLI
FT                   EQSLSRLPFEFFVGSVHHTLTVPIDYDRPMYEKARELAGGTDKRLFERYFDEQLDMVTQ
FT                   LRPLVVGHFDLIKLKSDDPERSFKQWPSVWERILRNLDFIAGYGGMLELNSAALRKGMS
FT                   EPYPKEEICREFLARGGRFVLSDDSHGLDQVGFNFHGVLAFMEKAGISTLHYLELGDEP
FT                   AVDERFPRTQIRSIHVSELKKMSFWQV"
FT   CDS_pept        complement(1131962..1132423)
FT                   /codon_start=1
FT                   /gene_family="HOG000014315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055114"
FT                   /gene_name="pptB"
FT                   /orf_name="AFUA_4G04040"
FT                   /product="Mitochondrial phosphopantetheinyl transferase B "
FT                   /EC_number="2.7.8.-"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL84553.1"
FT                   /db_xref="EMBL:AAY99390.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG054421"
FT                   /db_xref="HOGENOM:HBG327804"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI000051E59F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R0"
FT                   /transl_table=1
FT                   /translation="MKLIPFPYPLNIGTDVVHLPRILRLINRPDYFHRFTRRILHEQEQ
FT                   RDFRTRFSLPPPSSGAEKTGLNPITPDMARWLAGRFAAKEAARKAAPAGASSLGWKDVI
FT                   VRVGEADKGRPEIVYLDPMGCGETGGGRVGKLSISHDGDYVVATVLAAG"
FT   CDS_pept        join(1134381..1134479,1134556..1134641,1134677..1135289,
FT                   1135360..1135767)
FT                   /codon_start=1
FT                   /gene_family="HOG000170752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901731"
FT                   /orf_name="AFUA_4G04060"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbonate dehydratase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbon utilization"
FT                   /protein_id="EAL84554.1"
FT                   /db_xref="GO:0004089"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015976"
FT                   /db_xref="HOGENOM:HBG054422"
FT                   /db_xref="HOGENOM:HBG327802"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniParc:UPI000051EA54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q9"
FT                   /transl_table=1
FT                   /translation="MFWGKRDHRDETPTDTPQQPIPREKLPAQLQKISFREAVPCRLSK
FT                   FILRNYGIIISACPRKIPRRPSFPRPPHHRTAMTNPSSNMDSSVDSTDTNYRYAGYVNR
FT                   IRTILLSAHRYVAYTSDIGESFRPVAHPYLVRTAYGISWTYLFGDVAHEGYKAYLRNRH
FT                   VLAPPGEAYKDAKDLSANEVVMGMATGDMGSPSAGTDAELAPWPTTRIPLIEDYRMVMV
FT                   KRAVFQSIASMGLPAFTIHSVVKYSGQMMKNNKNVFVRTWTPIGLGLAVVPFLPYIFDE
FT                   PVGEAVEWSFRTALRAYAGEDAVRPFPAPATASAAHPAETGADAPSVSRYLKTQAEKNS
FT                   SVALGADGSVAASANLSWEEYKAERQKAKEERRRQREAKGWTGPLAWLGLGSDSDSKSK
FT                   TE"
FT   CDS_pept        complement(1136730..1139435)
FT                   /codon_start=1
FT                   /gene_family="HOG000170741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259039"
FT                   /orf_name="AFUA_4G04070"
FT                   /product="Mucin family signaling protein Msb2, putative "
FT                   /protein_id="EAL84555.1"
FT                   /db_xref="HOGENOM:HBG054423"
FT                   /db_xref="UniParc:UPI000051FDA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q8"
FT                   /transl_table=1
FT                   /translation="MRPATLVAALLSLGGLELVAAENAQELKPRFIPKQFKRHVVHGPD
FT                   SSATTSSNTNIHLDKRADVNPFISYFNSLLQNGPTATSSAPLVSLPIIVSIDASGVTHT
FT                   ITPTPTPSPSAETSSDATSGSTLEPSSATDQSAPNNVPATALSTAQTSSPAKTDTSDNS
FT                   QTAPASSPATSSGNTVSDTLSAVVSSVLGDPSSSTSTSPPVSSSATDGSKAPESSTTVS
FT                   AAQTSQAKTDPSDNSQTTPASSTPATSSGNVVSDALGGVGGLVSSVLGNPSSSTIAVPT
FT                   ATEAKSTGSSATESNDPSTNSTTPTGSSSPAAPVETTPTPAASSSGLLDTVASDLSGIL
FT                   PTASSSLASGAATTDSSNADGTVTHSTVVIPSSTGNNSSPEASPSPTPSPSGVLDPLTS
FT                   AVTDLLPGSASSSAVTNGSSGAETSASTDLGQSTVPVSVPAVTPSATSSSGLGGILGPI
FT                   LSSAGSTGVIPTASTHTSSFVGVPTGLTSILIPGGSSGSESPTSYTQISPSVPTTAPSV
FT                   TSTAVIPGSSDTAIGSSIAVTGSTGVSSTLPTPTADFSSSAIQTLSTTEQTTPSPSTTP
FT                   ETTTAAPTTTTTSTTYPPETTTTENTDFVPSSILVEPTTTTQLSTAETATGTNRPAQLP
FT                   GSISPANGLTSPPPDSTLIQLGFNGKLRYSFVATTPLSSSQIFLYIPQGLIYALEILGK
FT                   DIAMFAIQPYDNSASTGYIATVALAYIPTDKVDTLRKLLRSPLSKLYQQPNESVKTLFS
FT                   MIDPSIPLVVGESGSSSGSGLYSDSGISGSGSSSDGNGSGSNSGNDADAGASRSASARA
FT                   SSVGIGVGVVCGAAAYGAGMFWVARRYRKKRQLHRRSNSTMEQTSEGRGAGSLFAAGGR
FT                   LSRNSQNSRGSGRGQMISAPVMAENSLGWN"
FT   CDS_pept        join(1144928..1145186,1145249..1145775,1145847..1146626)
FT                   /codon_start=1
FT                   /gene_family="HOG000170730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055115"
FT                   /orf_name="AFUA_4G04080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84556.1"
FT                   /db_xref="HOGENOM:HBG054424"
FT                   /db_xref="UniParc:UPI000051F18C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q7"
FT                   /transl_table=1
FT                   /translation="MARYSSRLETIPESPELPNPALQMTENWRPIPDLEPDRKKMRGPG
FT                   PVPESKSPVEVCVHGLTAKFFLDLPDDRIIPSYYLKKAERTVIVHRTPWCFRNADDARD
FT                   VDINKWSPVDIRFRSVFMTLRKLPEFGSLYDEDEDEDEGYGTTDAGGSKPKPKFDEMVK
FT                   LQGQVVYALLQGILEAFKVTRETDDSDSYLFFRSVASPWHVIPGACTHSGHRARLLNCQ
FT                   LEYWIGYSERYKDGPLTAGLACLDHHPDKRACPTVLPVSASLENTFLRSALEDKLKLML
FT                   GQLLLNISRLRPHGDQIPDQEVYLIGIYGSRLHILRAIFLGQKTSHLWSGRHNRSSSDA
FT                   DVIDPNPSTVYDRFYTGKNLERLRQQVEWLSVKNLDNNPNPRHFRVLGSREFDLWCKQD
FT                   FRAAVKMIVALFIYMMSGQARCGVLQKVFQNYPIDEESDDELEEVHDTRKRVAIEEEKL
FT                   AKKEKELEETERKKREEEQKMSKSKGKRRSYIHGRFQGFKGWRKPCEDFAWQKETDSSL
FT                   DDDL"
FT   CDS_pept        complement(1146874..1149135)
FT                   /codon_start=1
FT                   /gene_family="HOG000170719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259040"
FT                   /orf_name="AFUA_4G04090"
FT                   /product="Conserved serine-threonine rich protein "
FT                   /protein_id="EAL84557.1"
FT                   /db_xref="HOGENOM:HBG054427"
FT                   /db_xref="HOGENOM:HBG327798"
FT                   /db_xref="UniParc:UPI000051FFAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q6"
FT                   /transl_table=1
FT                   /translation="MAYTLVLSNPKHLRCSRAILRYSQVPYVTYLKVPSTTSVQSRGIW
FT                   RLTYHRYGSRSSDERRRLEKYLRHGPSKLRDRQVGHRQRSQSSFDDHHSWWNSGWGWSQ
FT                   LRFHGPTNWNEHAPRNDYWEAQRIRLEKRMEQIKKEIEADPYEALFGRRLDPFKSWGKH
FT                   ENIFSSLFRSLFGQGSKAEAEPKVTDTTARVKTDAAHPSDPRPSGKQSASPRSEVNAYK
FT                   EPTEDDTGDYEFDPITGRMVPKKGETFERSQDSPYTETPNSSICSNTVQSESARSAGFL
FT                   SPLDRSEPHPNTKGVTEAGAHDNTVQSETVDGPSPQSTTQDPNEFAYGGSILTAKPGIS
FT                   DENILKEPTEPRDTNTTFTKGVPSSEIEMANEQLSIDNPRLKADNVPPSAISHQNEGSS
FT                   GVPTETKDPLATAQRTSHGLKLQEEWVTQAERAEDLDILRASDIRTPYELKNKDGDPEE
FT                   QLRDKRRKLDLAFEMTEDPVKDIDVRRIREKYKIHEASKSKETVLEPLDSRKAQLPSQS
FT                   SMIASTFLPHSQGDIRNVRLDPNHEAQGARNEVQVSPNDSWATATYRVLVYDPSTSQVV
FT                   EAETSSSLQSTDKLLSPAEVLPRLSQPAKFVPYLAEMRDDGYEIVSGGEDIIVFRKASG
FT                   SGSALRSKTPSNGGSAGRLTSPQLDPGENIRAATAPSDSSSNPGIVSTADGSKVTGHAN
FT                   AWSRVQTALRRMLIGGVATAGTCYAIGVVVEYFRTGGEEGLGIDAFTEFESERRRRDRE
FT                   "
FT   CDS_pept        join(complement(1151583..1151683),
FT                   complement(1149658..1151170))
FT                   /codon_start=1
FT                   /gene_family="HOG000170708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749755"
FT                   /orf_name="AFUA_4G04100"
FT                   /product="Vacuolar protein sorting protein (Vps36),
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL84558.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059077"
FT                   /db_xref="HOGENOM:HBG327797"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="UniParc:UPI00005201FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q5"
FT                   /transl_table=1
FT                   /translation="MFFKSLDLTTALRPSLLPDETLLFVQDAVGLYEGSQCPLPATPYK
FT                   QPAPKPINATWVCPICSFTNPVPSNFDPATATASTPLSPCLACGIKPPFTTVLKAAITA
FT                   AASREAAQVHPASHEPGQPESNDDETVRKPNASTPCPRCTFVNHPYLLECEICGAPLAP
FT                   AVARGASVDGSRRSESPAPVFGQGNIANTETFEVVKLSFRGGGEKTFYERLKGALVQRK
FT                   WLLYDAPPVPQQPSQSPATPNLTASGAVAANVSTPAQPRSPAVGIAGLEQRGLEARRNN
FT                   EVVIGSSFEDLEALMASAKRIINLAETLARESGMAGDENTAATNAVLSESAAALGMTTT
FT                   KDMLGSGAENLYLSELSRDLAEYLTDDNKGILQKEGGIMSLVDLWAMFNRSRNGVELVS
FT                   PSDFQKAAELWEKLKLPVRLRRFKSGLLVVQRYDWNDEKTIRQLQEWMAELRQIPPADP
FT                   VPWDWRQFGRAVTAQEAAQRFKWSVGVAAEELEMAEDKGVLCREEGIEGLRFWSNYITS
FT                   DLSSMNSIDSIDLRVSSLAI"
FT   CDS_pept        join(1152248..1153626,1153685..1153901)
FT                   /codon_start=1
FT                   /gene_family="HOG000170697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206317"
FT                   /orf_name="AFUA_4G04110"
FT                   /product="SAC3/GANP domain protein "
FT                   /protein_id="EAL84559.1"
FT                   /db_xref="HOGENOM:HBG243792"
FT                   /db_xref="HOGENOM:HBG735264"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI000051F3EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q4"
FT                   /transl_table=1
FT                   /translation="MSSGIPPWRTTASATATTAHFPAHGMCFLTLISLYSISNCDLATP
FT                   AYIPVQARRSFAHTSTTAMVPQPQPTTTQAPRKRVEWPAPLRSYVQRSFAPENQLPGVN
FT                   RQEMEVKLKGVITEAAEKGQLEKINWDALPLPQVMIQNERNQILTNPAVSGWSDSLLTA
FT                   AQKPDTVTEDVSRKRKSAEYGDKDSCPPWRQTNNHHAFGDRTTYPSADKRQRVDHKNPS
FT                   KSKANLEMRRKRFEEPRARYGSSPSSSRGESPAPSANQGPVVGRCQELEKNYFRLTSAP
FT                   NPDTVRPLHVLHKTLDLLKKKWKKDNNYGYICDQFKSLRQDLTVQHIRNEFTVSVYEIH
FT                   ARIALEKGDLGEYNQCQTQLRALYAQNLGGHPTEFKAYRILYFIHTRNWTAMNDALADL
FT                   TAADKRDPAVKHALDVRSALALGNYHRFFQLYLDTPNMGAYLMDMFVDRERLSALAAIC
FT                   KAYKPDVKIRFITEELGFESDEQSARFILDHASEDLLQEKDGSVRLFTSGRAAQLFEAA
FT                   KSEAHRVVDIKGQI"
FT   CDS_pept        join(1157175..1157180,1157480..1157581,1157782..1158549,
FT                   1158614..1159534)
FT                   /codon_start=1
FT                   /gene_family="HOG000170685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259041"
FT                   /orf_name="AFUA_4G04120"
FT                   /product="Protein kinase activator Bem1, putative "
FT                   /function="kinase activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="EAL84560.2"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG174475"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0000F51A8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q3"
FT                   /transl_table=1
FT                   /translation="MKAIRRSLKGEKDPKPHHHHLSITPKSAIAILPPKKVIKALYDYQ
FT                   PEPGNTQELAFSKGDFFHVISREDDLDWYEACNPLIPSARGLVPVSFFEVIGKNERDSG
FT                   GSVDLHKKKESHDSGFSDRGPAQFSSPDHTPTQLQHSPSTPRMSTLGKASSAMVYGIVQ
FT                   YDFQAERPDELDAKAGEAIIVIAQSNPEWFVAKPIGRLGGPGLIPVSFIELRDMQTGQA
FT                   VSDPLEAVKRAGVPRVEEWKKMTAEYKNSSITLGKIDSAASAVQSVTSGVEKMSMGRNS
FT                   AGHAGQNGNAYGYHNRNASKASLPQHLSQPPMPNHHQQPLVAPVAASIPRYCFDNDKYW
FT                   YIIEAKMEDGRCWELSRYYHDFYDFQIALLTQFEEEAGNRGKPRTLPFMPGPVTHVTDA
FT                   ISNGRRQNLDEYIKKLLAMPPHISRCQLVRQLFAPRPGDFEIDPSAFGEDARYSGGSHH
FT                   SSTQETSRTASRQSSQAQMSSHPDRASHQRNQPSVSHAADRPAPMNRQASSLTQVSTTS
FT                   SGGAMKVKVFFQDDLIAIRVPSDISFQQLREKLLDRLKLNEEIVVQYKDEPSGAYMDLN
FT                   NDSDLDTAMQRNSKLTLHVGLA"
FT   CDS_pept        join(1160527..1160905,1160962..1161412,1161462..1161975,
FT                   1162039..1162386)
FT                   /codon_start=1
FT                   /gene_family="HOG000259600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259042"
FT                   /orf_name="AFUA_4G04130"
FT                   /product="Mitochondrial ATPase (Afg1), putative "
FT                   /function="ATP binding"
FT                   /protein_id="EAL84561.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG320636"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI000051F660"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q2"
FT                   /transl_table=1
FT                   /translation="MSRPSAKLCAESLPSALRSRAPGLSAGRPGRARVLNGACRRSIHS
FT                   SNGAARRQVAEAQGVWLNARNAQPRTGVYMRRFATAAVQPQTETIAGQTEDARAGLSGR
FT                   GPLQEYEGRVQQGRLRDDPHQREIVQKLQDLHNVLKGYTPPTVVHPSVESLDPKPKSSF
FT                   FGSLFGRQSAKAETEIPENLPKGLYMYGDVGCGKTMLMDLFYETLPANIKSKSRIHFHN
FT                   FMQDVHKRMHVVKMQYGNDFDALPLVAANIADLSSVLCFDEFQCTDVADAMILRRLLES
FT                   LMSHGVVLVTTSNRHPDDLYKNGIQRKSFIPCINLLKTALTVINLNSPTDYRKMPRPPA
FT                   AVYHHPLGPEADRHAQKWYEFLGDPNDPPHPETQEVWGRKIKVPSASGKAARFTFQELI
FT                   GSATGAADYLELVRNYEAFIVTDVPGMTLQQRDLARRFITFIDAVYESRAKLVLTTAVP
FT                   LTNLFMSEQEVRTSLEENGDHSDLSDAMRMMMDDLGLSVQALKSTSIFSGDEERFAFAR
FT                   ALSRLFEMGSKDWVERGLGVGKTVEEGKSEHDAWMKARSHWSEDNM"
FT   CDS_pept        join(1163634..1163743,1163790..1163868,1163917..1164876,
FT                   1164935..1165534)
FT                   /codon_start=1
FT                   /gene_family="HOG000168909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259043"
FT                   /orf_name="AFUA_4G04140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84562.1"
FT                   /db_xref="HOGENOM:HBG051387"
FT                   /db_xref="HOGENOM:HBG396029"
FT                   /db_xref="UniParc:UPI0000520922"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q1"
FT                   /transl_table=1
FT                   /translation="METRNTRFDLPGYSIPLNWSPGAYEMFPNALESSQAERLTTHREI
FT                   LMMRALNSITDKLDWEKKVFDEEITAKWRKEIIGSGEDITPNMMDWIIKEAQWKAKVFQ
FT                   DTKHVVAFDAGVVKSDIAIGEDLRQVLKDAVRPLEDVPEGLKNYHPGSDDKVVDLVHPS
FT                   LFPVVYGRTRILHRKLIGLEDFLNYVGEGKILAIPPEEEATATIDRDWGGVRRPYSRKF
FT                   QWLPCDVHFTDNGECRIASYINNLHPNKHRQLYQVIEKILEQTIPLWNTTLTLVRDKYK
FT                   RIPYNEVQYDEHPEPEPQPENEEDEHSDEYYQRYDEWQKREPIRRPEPGEFAPHVTEAK
FT                   KQVNLHKDFAERGLQVIIKLANIELTPEKPEYEGGSWHVEGQLNEHICASAIYYYDSQN
FT                   ITDSRLAFRQRADTEEVSYISYDQSRHEFLHEIFGLDNEAGWNEGNVTQFLGGVDTRQG
FT                   RLLTFPNSLQHQVSPFALADRSKPGHRKILAFFLVDPHLSIISSANVPPQQEDWWKERQ
FT                   EVVGKLLSERLPAELQNMVNEVLDATPITLEEAKQYRKELMEERSNKAQEQNRDFERGE
FT                   FNLCEH"
FT   CDS_pept        join(1166181..1166226,1166283..1166332,1166379..1166423,
FT                   1166481..1166628,1166692..1166879,1166956..1167175,
FT                   1167227..1167306,1167363..1167587)
FT                   /codon_start=1
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259044"
FT                   /orf_name="AFUA_4G04150"
FT                   /product="Di-, tri-valent inorganic cation transporter,
FT                   putative"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84563.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG317426"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI000052020A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q0"
FT                   /transl_table=1
FT                   /translation="MVIGISSCFFLTEISFGLYTHSLALVADAFHYLTDLIGLVVALLA
FT                   LKLSEIDDPPKILAFGWQRAPVLGAFFNGALLFALGISILLHSVERFISLHNSCSLLDA
FT                   LAWVLISSALLFFMAGLSFWMCSPVANVKALEKSSHTHRHALDTSTDSSIGAHDEGSIR
FT                   LPPERTGSSCRDVGMLGVLLHVIGDAVNNLGVMIAALVIWFTEYEGRYYADPGASLWIG
FT                   VIIILSSLPLLRKAGSILLGCTPSGIDLNDLRSDLEKIQGVLSIHEINVWHISQHKSLA
FT                   VIGVLLTDQQVPGSTKVISMVNECCQKYGIQSVALRQKLHSQELSLAALDRI"
FT   CDS_pept        join(1168485..1168763,1168824..1168922,1168981..1169054,
FT                   1169102..1169201,1169251..1169712)
FT                   /codon_start=1
FT                   /gene_family="HOG000216676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259045"
FT                   /orf_name="AFUA_4G04160"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A,
FT                   putative"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="transferase activity"
FT                   /protein_id="EAL84564.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG054428"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000052020F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P9"
FT                   /transl_table=1
FT                   /translation="MSVQNWEIRACRAKDVLLNSVPKQWILPAHKLPPAHQKNVEDFPR
FT                   KSGILSDREVSITEMSATALVAGMGAGLLSAEEVVVAFLKRAVLGHQLLNFATEFMAER
FT                   AISRAKKLDEYFKRTGKLVGPLHGVPISVKEHIEIKGRTCNAGFVAWVDDIANEDALLV
FT                   QYLERAGAIFHVRTNQPQSLMHLCCDNNLTGPTRNPYNRTLTPGGSSGGEGASMGFKCA
FT                   ALGVGTDIGGSIRAPAGFCGAYGFRPTALRMPATGIKVPGPGQESIHGTAGPLASQSVE
FT                   DLNLFQRAVIDQEPWETETSLVPLPWRQVKATKNMTVGIMWDDGYSLNLNHYSPLR"
FT   CDS_pept        join(1169726..1169857,1169914..1170459)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259046"
FT                   /orf_name="AFUA_4G04170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL84565.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG054429"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI000051F3E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P8"
FT                   /transl_table=1
FT                   /translation="MHRCVRPHPPVTRALRHAKEKLLAAGLKVVDWEPYRHDHGWEIIS
FT                   SLYFPDAANSQRTVLSQSGEPLLPLTEWAFAYSRASPLSIPENWALNCKRDAYRDTYHA
FT                   LMKSRDVDFILCPVYVGAAAVMGESQYWNYTAIWNILDYPGVVFPSGLIVDPELDPVDG
FT                   GYRPRSEVDAREWAKYRPERYEGAPIGLQLVGKRFKDEETLAAAGLVSDIVQGKEEDIR
FT                   SRL"
FT   CDS_pept        join(complement(1174282..1174520),
FT                   complement(1172133..1173892),complement(1171891..1172075),
FT                   complement(1171677..1171843),complement(1170719..1171622))
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259047"
FT                   /orf_name="AFUA_4G04180"
FT                   /product="Chitin synthase B"
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="EAL84566.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI000051FB43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P7"
FT                   /transl_table=1
FT                   /translation="MSSNSSRMYPPAPNYEEEPPAYGNYGETTSFLADHDSSPRHQGVT
FT                   MRLLPNSTDVDDDLSVDVERGASHHYGIEYSDDESTRANVQYVPYSGNANGGYNRFYGY
FT                   NAEESPSRPASSLGNVPSIPPPAVSAVEVPQYSSRPASPLRPWSPARAADWTRPPAPPS
FT                   VTGSQYERADLNGSPRPGTPSSRYGGSPRRPLPPAPLFAGPGAATGQDTSIDIGDGNDP
FT                   EDPFGGGGRTNNRHEHRGSIRSFMSDSTMITDEKEEMAKINLNEDDVVDVDPNMHYGPA
FT                   PEKQSRRGVREAQMSKKEVQLINGELILECKIPTILHSFLPRRDDREFTHMRYTAVTCD
FT                   PDDFTQRGYKLRQQIGSTMRETELFICVTMYNEDETHFTRTMHGIMRNISHFCSRSKSR
FT                   TWGKDGWKKIVVCIIADGRKKVHPRTLNALAAMGVYQEGIAKNIVNQKQVTAHVYEYTT
FT                   QVSLDSDLKFKGAEKGIMPCQVIFCLKEHNQKKLNSHRWFFNAFGRALQPNICILLDVG
FT                   TKPEPTALYHLWKAFDQDSNVAGAAGEIKAGKGKNMMGLLNPLVASQNFEYKMSNILDK
FT                   PLESVFGYITVLPGALSAYRFFALQNDADGNGPLNQYFKGETLHGKDADVFTANMYLAE
FT                   DRILCWELVAKREERWVLKFVKSAVGETDVPDTIPEFISQRRRWLNGAFFAAVYSLVNV
FT                   KQLWKTDHSVPRKILLQIEAFYQFLNLLFTYFGLANFYLAFFFIAGSLSDERIDPFGHN
FT                   MGKYIFFVLRYACILVMCLQFIISMGNRPQGAKKLYMSGIIVYSIIMVYTAFCALYLVV
FT                   LELMAKAGVGKKELAVSDSLFINIVVSLLSTVGLYFYSSFLYLDPWHMFTSSAQYFALL
FT                   PSYICTLQVYAFCNTHDVTWGTKGDNTINNDLGAARIINGTTVEVEMPSEQLDIDSGYD
FT                   AALRNLRDRLEVPPPPVSENQQQEDYYRAVRTYMVSIWMVANVILAMSVSEIYGVDSGG
FT                   TNVYLGIILWSVAVLALIRAVGSTTYAILLVVQKIVEGKTKFDAGNIVNSNAATSSYVS
FT                   SRSTAQYGGGTSFKDKVTEAGWTLKRTAGKAMFWKK"
FT   CDS_pept        join(complement(1176880..1176889),
FT                   complement(1176582..1176795),complement(1176077..1176516),
FT                   complement(1175819..1176024))
FT                   /codon_start=1
FT                   /gene_family="HOG000170674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055116"
FT                   /orf_name="AFUA_4G04190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84567.1"
FT                   /db_xref="HOGENOM:HBG054431"
FT                   /db_xref="HOGENOM:HBG327736"
FT                   /db_xref="InterPro:IPR013920"
FT                   /db_xref="UniParc:UPI000051F172"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P6"
FT                   /transl_table=1
FT                   /translation="MAIYNPFARRETHGRYALSTYRVLVPITWLLVVIFGVYYTLHSPD
FT                   DVKHGRKIFKQGHVYTTPFSLNTTITEIYWVLLLLTQLSYVYHLFSNDGAIANAAANVG
FT                   SHFILNNLFTLAWILLWTRGHFWASEVMLAANYLNQHAAYWRHRTLPTFVHLSAIAGPY
FT                   AWTLMALFWNGAVAVGSNSFPARIAANIFIWLIFAFGSTHIMATQDDLLGYCLTFLTLA
FT                   LAIEQLAIKVIALQWIFAFVIFAVFLVESIYLSSTKYSGRDSLFRRITEPEPTDREREP
FT                   LLNSAANP"
FT   CDS_pept        complement(1177951..1179024)
FT                   /codon_start=1
FT                   /gene_family="HOG000170673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259048"
FT                   /orf_name="AFUA_4G04200"
FT                   /product="Myo-inositol-1(Or 4)-monophosphatase "
FT                   /EC_number="3.1.3.7"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="EAL84568.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG599916"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniParc:UPI000051EEF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P5"
FT                   /transl_table=1
FT                   /translation="MDSSCLYSKELQLACLTVQRAALLTKKLLEAVDKGSFDKSDSTPV
FT                   TIADFAAQALIIGAIHKAFPEDEFVGEEDSKALRADPELLERTWELASTTHLDDKDSEA
FT                   LLYAPKSKEEMLDLIDLGARGRCSLENRAWVLDPVDGTATFMQGQQYAVCLALVENGCQ
FT                   KVGVLGCPNLNLATGRLREDVVDRDGYGSQVFAVAGQGAWIRKMGRGGLLAAESIPQRP
FT                   QITDPKDLDFVDCGSATSSNTSLHARVASKLGAPWPYSTDLWAAQLRYIAIAVGGCNAL
FT                   IKIPHKALYRSKIWDHAGGMLIAEEVGVKVTDLAGNPVDCSLGRTLAGCYGMIVAPPSI
FT                   HERIVEAVKEVMQEQTK"
FT   CDS_pept        join(complement(1180219..1180872),
FT                   complement(1179920..1180153))
FT                   /codon_start=1
FT                   /gene_family="HOG000217592" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259049"
FT                   /orf_name="AFUA_4G04210"
FT                   /product="Aminopeptidase, putative "
FT                   /EC_number="3.4.11.10"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL84569.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG054432"
FT                   /db_xref="HOGENOM:HBG328999"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI000051E80C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P4"
FT                   /transl_table=1
FT                   /translation="MQYAEEVAALNKNLSKENMKANLERFTSFHTRYYKSQTGIRSATW
FT                   LFDQVQRVVSESGAAEYGATVERFSHPWGQFSIIARIPGRTNKTVVLGAHQDSINLFLP
FT                   SILAAPGADDDGSGTVTILEALRGLLQSDAIAKGNASNTVEFHWYSAEEGGMLGSQAIF
FT                   SNYKRNRREIKAMLQQDMTGYVQGALNAGVEEAIGIMVDYVDQGLTQFLKDVVTAYCSV
FT                   GYLETKCGYACSDHTSASKYGYPAAMATEAEMENTNKKIHTTDDKIKYLSFDHMLEHAK
FT                   LSLGFAFELAFAPF"
FT   CDS_pept        join(1182850..1183261,1183377..1183893,1183970..1184165)
FT                   /codon_start=1
FT                   /gene_family="HOG000170652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259050"
FT                   /orf_name="AFUA_4G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84570.1"
FT                   /db_xref="HOGENOM:HBG054433"
FT                   /db_xref="UniParc:UPI00005201F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P3"
FT                   /transl_table=1
FT                   /translation="MAIHPTLPSQANSQGRLTPQQTRAISAWSEQAAASLRNLTLSESV
FT                   SASDRNVEFISTRDSPLRGSSVPLSIPLDDPAPVVHTGAVPRVKLVTRESETQPVASVS
FT                   FRRREPIRRDSLKRREALLKGKDGSRRRQRWENDRLLHNPWVEPPAPSDWAVQPTYPRH
FT                   DPMPYYLAPLWDMKYAHLDRTSSQQTQKGTRHEKHRVPKELRMRLKHARAARGMLQDLE
FT                   EDIRQFIQTWSEKQLMLRKEGLEDAPLSSEDESEDEVVFVGRNGQMHDSPEHKTRLREL
FT                   RANLSQHNERDGEKMVFESPVDDRAAGFGYYGLHTWSITVGEPARREAYVGFHMPAPGS
FT                   RPGLTTHVSVPSNAQQGAMMKPGDDLPKPLWAQI"
FT   CDS_pept        join(1188106..1189178,1189468..1189492,1189628..1189876)
FT                   /codon_start=1
FT                   /gene_family="HOG000170641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259051"
FT                   /orf_name="AFUA_4G04230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84571.1"
FT                   /db_xref="HOGENOM:HBG054434"
FT                   /db_xref="HOGENOM:HBG327704"
FT                   /db_xref="UniParc:UPI00005201F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P2"
FT                   /transl_table=1
FT                   /translation="MESYSASSCQDRCARTRRSSGSTNSEASDRSKSTVPTVYSYRPTS
FT                   KRQPETDRFTMDPRDSTSTYASTIPSTDGLPEDPQYEVIDRKPEIYATDAIPSSPTTFA
FT                   ELFPSSRRLLIRHDDSTLDGNMNLRVDTLVPRRGGYQQDVILFHLRMYDLFSRKFSFRR
FT                   YCRESGREICHSERRPRSSSIDKRPILQRSWSSVLASLRPGSSGNGTIAGAEHKRHNSG
FT                   HHSIKQEGANLDDATADAKEYPSRPVALADTTVLEFSNYAHVEVKRRGAGIPKRYEFEY
FT                   WSTKYYWKKECRKEGDLREVSYHLINTRTSKIIAHIVPEILTPVEAVEEESKGGWVPSS
FT                   SMWISDSSVYEKMHEVAENLGKFAATAGSLACPCIWFAGDEDPSWTCLLVVVVVVVVVV
FT                   VVVVVVVVVVVVVVVVIVPRMCNRNSAASSYRCVDTCRSTESDDLLSGV"
FT   CDS_pept        join(complement(1195966..1196028),
FT                   complement(1195774..1195933),complement(1195649..1195742),
FT                   complement(1195515..1195596),complement(1195363..1195465),
FT                   complement(1194897..1195300),complement(1194693..1194841),
FT                   complement(1194527..1194611),complement(1194152..1194472))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259052"
FT                   /orf_name="AFUA_4G04250"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84572.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054435"
FT                   /db_xref="HOGENOM:HBG327697"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E5A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P1"
FT                   /transl_table=1
FT                   /translation="MSETKAHPNLEGARDVEIASDLSLLIVNYKDINEQHSDRSCRIQE
FT                   KALVWKQDLRIVPLCAAIYLLCYLDRSNIVLILGIGNAKILNQDTHNDLLSETKMTSYQ
FT                   YTIALMVFLIAYALFEVPSNYFLKKLRPSRWIAFLMLSWGACTMGLGGTHNFAQVTGIR
FT                   FLLGVMEAGLFPGLVYYLTFWYRHSERSIRVALILASATLAGAFGGAIAYGVGHMNQVH
FT                   GLSAWRWLFIIEGAPSCASAVLVWFFLPDYPESARWLTREEKDLAAQRLRTEGSKGEAK
FT                   AMTWEDAKAVLTDWRLYAHYAIYFGISAPFSSLSLFTPAITSGLGYTNLRAQLMTVPPW
FT                   AVAYVVTTAAACRGLHSALFSFIGAMGFLASAVLPPDAYLHRYGCLIVATSGSFACIPP
FT                   LLGWLSSNLHSTAGTGLAIALNVSFGAPGQIVGVWIYKANEAKRGYPTGHWTNAGLLLF
FT                   VCAGCIMLRCYYGWLNRRDRASGRRFAY"
FT   tRNA            complement(1196182..1196269)
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        join(1197406..1197593,1197650..1197733,1197791..1198111,
FT                   1198161..1198350,1198404..1198591,1198642..1198828)
FT                   /codon_start=1
FT                   /gene_family="HOG000223473" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259053"
FT                   /orf_name="AFUA_4G04260"
FT                   /product="Queuine tRNA-ribosyltransferase "
FT                   /EC_number="2.4.2.29"
FT                   /function="queuine tRNA-ribosyltransferase activity "
FT                   /biological_process="queuosine biosynthetic process "
FT                   /protein_id="EAL84573.1"
FT                   /db_xref="GO:0008479"
FT                   /db_xref="GO:0008616"
FT                   /db_xref="HOGENOM:HBG358178"
FT                   /db_xref="HOGENOM:HBG629929"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniParc:UPI000051F661"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P0"
FT                   /transl_table=1
FT                   /translation="MPVATQASLKGLTYDQLKQTGCMLCLNNTYHLGLKPGQEVLDQVG
FT                   GAHKLQGWDRNILTDSGGFQMVSLLKLAKVTEEGVRFLSPHDGTPMLLTPEHSISLQNS
FT                   IGSDIIMQLDDVIATTSPDHARIHEAMERSVRWLDRCIDAHKYPERQNLFCIIQGGLDL
FT                   ELRKQCCAEMVARDTPGIAIGGLSGGEAKEEFCKVVDTCTGLLPEHKPRYVMGVVSTRW
FT                   PIRLAVSFIDAAQGYPEDLVVAVALGADMFDCVWPTRTARFGNAVVPSGNLNLRHKSFA
FT                   EDFRPIQEGCSCSCCRPRDQGGLGITRAYLHHLAAKETVGAHLLTIHNVHYLLNLMGSA
FT                   RQAILEDRYPAFLREFFDNLYGDKAKFPEWAVTALRGVGVDLLAD"
FT   CDS_pept        1199067..1200101
FT                   /codon_start=1
FT                   /gene_family="HOG000257899" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19901732"
FT                   /orf_name="AFUA_4G04270"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /function="thymidylate synthase activity"
FT                   /biological_process="dTMP biosynthetic process "
FT                   /protein_id="EAL84574.1"
FT                   /db_xref="GO:0004799"
FT                   /db_xref="GO:0006231"
FT                   /db_xref="HOGENOM:HBG064619"
FT                   /db_xref="HOGENOM:HBG588098"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="UniParc:UPI0000520907"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N9"
FT                   /transl_table=1
FT                   /translation="MTIQSKDQTSIMSPAAVLPQDTPSQTGTPTPPHNPAHEEHQYLNL
FT                   IRTILAEGEHRPDRTGTGTRSIFAPPQLRFSLSKPGATPSSDPIPILPLLTTKRVFLRA
FT                   VIAELLWFISGCTSSIPLSEAGIKIWDGNGSREFLDKVGLGHREVGDLGPVYGFQWRHF
FT                   GAEYIDAKTDYTGQGVDQLAEVVRKLKETPFDRRIIMSAWNPADLKKMALPPCHMFAQF
FT                   YVSYPNGLDNKGSLSCLLYQRSCDMGLGVPFNIASYALLTHILAHATDLNPGTLIHTMG
FT                   DAHVYLDHVDALNEQLKREPTEFPELRIKRNDRGSGVVDGWKEEEFEVVGYQPHKAIKM
FT                   NMSV"
FT   CDS_pept        complement(1200318..1201256)
FT                   /codon_start=1
FT                   /gene_family="HOG000170619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901733"
FT                   /orf_name="AFUA_4G04280"
FT                   /product="AN1 zinc finger protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84575.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054436"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniParc:UPI000051EEFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N8"
FT                   /transl_table=1
FT                   /translation="MAPITVSKGRTPSPNAQESFTQTADKDLESIGRHCQFEYCHQLDF
FT                   LPFRCESCRGTFCLEHRTETAHRCPKAGEWARRRNGNQNTSTASLPTQKPTIYNSDQCA
FT                   HLDCKTLINTLKDPGVRCPDCNRQYCLRHRLREEHECTKIAPLGARAGSQGPSNAETIR
FT                   SMFARVRTWGKDKGQALAPKPKANSAAARISELNALKKAAKGDAGIPADKRLYLHVVGT
FT                   ADAQAQKAEPPSGDFWFDSRWKVGRVLDDAARRLRIENVNNRAGEEERLRIFHVDSGEF
FT                   LEFSETIGDGKVKQGHTIVLLRGAGVILGKS"
FT   CDS_pept        complement(1201785..1205360)
FT                   /codon_start=1
FT                   /gene_family="HOG000170608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749756"
FT                   /orf_name="AFUA_4G04290"
FT                   /product="Histone deacetylase HosB "
FT                   /EC_number="3.5.1.48"
FT                   /function="acetylspermidine deacetylase activity "
FT                   /protein_id="EAL84576.1"
FT                   /db_xref="GO:0047611"
FT                   /db_xref="HOGENOM:HBG054437"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI00005206C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N7"
FT                   /transl_table=1
FT                   /translation="MDPSIRDEPPQATFTAPPPPPPAPSSNDLTNSLNHLTIASAAATP
FT                   LPTSPSPSSLLSPLDVPARSSADLAHPVPRRTASSNSLSDERDERRKSTSSLKKRSSTA
FT                   SLRSGHNSAGANSPRPSLSRRSSSSNFATPPTSTANMPSKRPQEQAAPTAASVAADFFQ
FT                   REVDLHQSTDLHSKVVVVVHDACYGHRFSRPRTSKTALSYIVERPERIQACVVGVSAAY
FT                   VLMAGRHAGKRFAPHPELDLHQLPAPPFQIRKTSRTMPITSAAVTHVHGTKWMDELKTM
FT                   CDAAESRLALNGKELVRPRSSGKDGDSAKKAPLNDGDLYLCSESLNAFEGALGGVCEGV
FT                   DAVFNSNTTKRAFVCIRPPGHHCSTSHPSGFCWINNVHVGITYAAMTHGLTHAAILDFD
FT                   LHHGDGSQDIAWEQNQKAVSAAWNAANHKKTRIGYFSLHDINSFPCEYGDVEKVRNASV
FT                   CIDKAHGQSIWNVHLETWKSDAEFWEIYAAKYTILLEKARAFLRLHTERLLDSAPGDTP
FT                   PKAAIFISAGFDASEWEGSGMQRHQVNVPTEFYAKFTADVVQMAEEEGLGVDGRVISVL
FT                   EGGYSNRALTSGVLSHLAALGDTTTLSAIVNHEQQVGLASEMFDRLHVSDSNAPAEALR
FT                   TPSDIGYDSQWWAPTRLDELEALVYPPPSTAPKSKSARTYFAPTQSFAAKVVAAPRDRK
FT                   STGSPAGSDVVPLPEVGWATAAHELSKVLIPSHRQTTSYRPEELNAEASRIRRERQTAV
FT                   AAAQASQKAASAASAASEGNRMQLRTRKAKASLPSSPKAETPKKNVTKSTRRTTIDPGD
FT                   LPSSTADSSPGVRTTRRKSTTPIASKPSGAAESGRPNTSSLDVGASETPEQASIAAGSC
FT                   PPESPSRSRSSTPSRSAAPKRSEGPKVPPVPRVPSSFLSKPASSDDQKVVSDQAQAEMT
FT                   EKTDSRPADLDDLAAGVKKLSIKLKVPTPEEHAAREKQRKTTKAAKATEQHQRRAPRPT
FT                   TSKTPTSSKKASSVTAAATAHASTARGTSHPSPSPSTSQMPFGPNIAISNGNMDRVKQE
FT                   SPENAPDDLVVSSPDPLAENETPLLSNVTINRPRWETPKDVLVSGSVSTQEAPSGSATP
FT                   SSWASESLPGRSTVYSPPTTTRQTMNGLPVFTSSCPIPFAAASTAPEGKQALAMQQPNL
FT                   FTHSDNAGTGHPDLMHNQNYKPEQP"
FT   CDS_pept        1208179..1209039
FT                   /codon_start=1
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259054"
FT                   /orf_name="AFUA_4G04300"
FT                   /product="Alanine racemase family protein, putative "
FT                   /protein_id="EAL84577.1"
FT                   /db_xref="HOGENOM:HBG001447"
FT                   /db_xref="HOGENOM:HBG289671"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI00005201FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N6"
FT                   /transl_table=1
FT                   /translation="MTPTEQQEQEQPSPTSTTIMPASPSRTGTLLANLSSVTSRISTAA
FT                   LNANRPATKPIRLIAVSKLKPAADILALHNPPTNHLHFGENYLQELLEKSKLLPPSIRW
FT                   HFIGGLQSNKCVTLARDVRGLWAVESVDSEKKASLLDRGWGERSEEVRGVALEDRLRVF
FT                   VQVNTSGEENKAGVDPVAGAVPLARFIREKCPRLKLQGVMTIGAIARSKATTPETENED
FT                   FVCLRETRDRIVRELGLQGDDAELELSMGMSEDFEGAIKLGSDEVRVGTTIFGERPPKS
FT                   EAKVV"
FT   CDS_pept        join(complement(1211879..1212330),
FT                   complement(1211492..1211826),complement(1209514..1211432),
FT                   complement(1209346..1209459))
FT                   /codon_start=1
FT                   /gene_family="HOG000170596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206318"
FT                   /orf_name="AFUA_4G04310"
FT                   /product="AP-2 adaptor complex subunit alpha, putative "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="EAL84578.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG315674"
FT                   /db_xref="HOGENOM:HBG354594"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI000051F8A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N5"
FT                   /transl_table=1
FT                   /translation="MSSMRGLVQFIADLRNARARELEEKRVNKELANIRQKFKAGNLNG
FT                   YQKKKYVCKLLYVYIQGYDVDFGHLEAVNLISSNKYSEKQIGYLAVTLFLHEQHELLHL
FT                   VVNSIRKDLLDNNELFNCLALHAVANVGGREMGEALSTDVHRLLISPTSKAFVKKKAAL
FT                   TLLRLYRKYPGIVQNEWAERMISLMDDPDMGVTLSVTSLIMALAQDRPEEYKGSYIKAA
FT                   QRLKRIVVDNEIAPDYLYYRVPCPWIQVKLLRLLQYYPPSQDSHVREIIRASLQQIMTT
FT                   AMDTPKNVQQNNAQNAILFEAINLLIHLDTEHNLMMQISSRLGKYIQSRETNVRYLGLE
FT                   AMTHFAARAETLDPIKKHQNIILGSLRDRDISVRRKGLDLIYSMCDTTNAAPIVNELLR
FT                   YLQTADYAIREEMVLKVAILTEKYATDAQWYIDITLKLLSLAGDHVNDEVWQRVIQIVT
FT                   NNEELQAYAAHTLLGYLKTDCHESLVKIGCYVLGEFGHLIADNEGSSPIEQFLALQGKM
FT                   ITSNDNTRAMILSSFIKFVNLFPEIKPQLLHIFRLYSHSPDTELQQRAFEYLTLATLPT
FT                   DDLLRTVCDEMPPFSERTSILLSRLHQKTAGTTEKKTWVVGGKDANADKKEVLLAQNTG
FT                   LKRTFTTIVNGTKTGANGSAATSNASGDLAGLDLSAPPAPPPNMASAAHLTPDWEPGYN
FT                   RLYFADEGVLFEDAQIQVGLRSEYRGHMGVVKIYISNKSSFAIGSLTTTLDNPAAPNLK
FT                   IDSKSLPEPSVPAAGQTQQTLLVEAHGPFSDAPTIRISYLAGALQAYTLQLPVLMHRYM
FT                   EPSTLSAEEFFKRWRQIGGPPLEAQHTFGVTAKAKNVSETFTRRLVEGFHWRILENVDP
FT                   NPNNIVGCAVYQSHGGKTGCLLRLEPNYERKMFRVTIRATQEAVPQALAKQMEQKLAQG
FT                   APDEMFGSR"
FT   tRNA            complement(1213043..1213130)
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        join(complement(1213895..1214054),
FT                   complement(1213734..1213829),complement(1213602..1213681))
FT                   /codon_start=1
FT                   /gene_family="HOG000170574" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259055"
FT                   /orf_name="AFUA_4G04318"
FT                   /product="Copper resistance protein Crd2, putative "
FT                   /protein_id="EBA27193.1"
FT                   /db_xref="HOGENOM:HBG324438"
FT                   /db_xref="UniParc:UPI0000F51AC7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA78"
FT                   /transl_table=1
FT                   /translation="MVHPSSTCCKTSGDGSCVCAAQAKCSCGKENALHCTCSRSAIENT
FT                   ISGPRCSCRARPAGQCTCERAAAENHPVTGDACPCGKRPSTSCTCEKVSAVDAAAEAIE
FT                   TDFTTRA"
FT   CDS_pept        join(complement(1216702..1217279),
FT                   complement(1216485..1216622),complement(1215779..1216422),
FT                   complement(1215352..1215719))
FT                   /codon_start=1
FT                   /gene_family="HOG000170563" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055117"
FT                   /orf_name="AFUA_4G04320"
FT                   /product="Homeobox transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL84579.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG054439"
FT                   /db_xref="HOGENOM:HBG327650"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI0000520923"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N4"
FT                   /transl_table=1
FT                   /translation="MSISGPCVWLSSLSPPATSHLSAITNHLPATSWNSEQVLSRSRVS
FT                   PPRLPYPGEKGGHSVQKLAVDMQPSAVLKAENALSASTVVATSNHVRSSEAEMPPPKEA
FT                   ESRSTEETLSRMRLDQLNHSESHPSGVSTPASPSVSKAASLEAKKRPQEETRGDEKDDG
FT                   EAMGISSDEGGDQKNSSDAKTDKKKMKRFRLTHNQTRFLMSEFTRQAHPDAAHRERLSR
FT                   EIPGLTPRQVQVWFQNRRAKLKRLTSNDRERMLKSRALPDDFDTTQVLRTPFDNKPLSE
FT                   TPVASPRNYMASTTDSNSLKMLLTDGLQRVNDDEYVVSPLSSSSTTGNCFPSTGPDRTP
FT                   DHFSQHGILGPRPVATLPELQRNTRGTFPFPRSSSFSEVSYPTGLHLPGRFSRPGVEPL
FT                   NHPGLPYARRPIDYGIPRPANGMVMGYDHSRAMEGSVSPTGQQEQQLPYNVDNNNQQIP
FT                   SYQTTLTMPAPKGFGSIEMNSHMQPRHMPALHSIPVSDAPDYRPYSYEHHPYSMQTALP
FT                   YSQANASSMSLPASFPPDTTHIPQVAVSTEDRINQSPQILDPMRGKFGNPSYDYTSYM"
FT   CDS_pept        join(complement(1227212..1227451),
FT                   complement(1227063..1227141),complement(1226891..1227009),
FT                   complement(1226143..1226832),complement(1225940..1226089),
FT                   complement(1225530..1225843),complement(1225045..1225474))
FT                   /codon_start=1
FT                   /gene_family="HOG000170552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259056"
FT                   /orf_name="AFUA_4G04330"
FT                   /product="THO complex subunit Tho1, putative "
FT                   /protein_id="EAL84580.2"
FT                   /db_xref="HOGENOM:HBG054440"
FT                   /db_xref="HOGENOM:HBG324439"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniParc:UPI0000F51ABC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N3"
FT                   /transl_table=1
FT                   /translation="MSLAEHDAMHIYRKLVDDLLNRAEQIKKDAQIEPPLTEAHLGESI
FT                   WAIQGEEKQMVEQLSQQTRFAAVELAFREKFYNLLANTTIDEPSFIRMWNLLDIISIFS
FT                   DNEQCEPGLIFWLIEELLDSQTIDGCRKVFDYLESRRERNTKKHFKQKSLIILRSCNEL
FT                   LRRLSRAEDTVFCGRVFIFLFQSFPLGDKSAVNLRGEYHTENVTTFDEITKSGAKESDD
FT                   MDVEMPDAKETLTATEALGHDHDGQPPPSASASQTLVQEQAKIPKLIVSKTEDKDSEKA
FT                   VDLNALYPVFWGLQAYFSAPTKVFDSHHFSSFMTGLENTLIAFKNIRTDLENQSASKTA
FT                   EEIRKSTKRKRSVDGQEIASSFNPKYLTSRDLFDLEVNDTAFRRHVLVQALILLDFVLS
FT                   LTPKAKAKLADLTNKSVLYGFVLNEEDAKWATKMRKAIEEYLQEGAGGKFYYRMVDTVL
FT                   SRDKNWVRWKAEGCPLIERPAVSVAEYLRARENATKTYANKRLRPSPMGALNLNFLAEG
FT                   ESLSSIEKLKEPERYSVPSADSFMMGIMDDELDIDTAHTKEDKDTAIRAKASKTWRILR
FT                   LSAKGKLAAFDKIDDGKNLKALFEAPQPLESTTPAHEPASQASEPAAKASGDAGPEANA
FT                   SGQEEQPVDRNTTAVSEQTPGDLNDNNQEAVTGAPQAT"
FT   CDS_pept        join(1227682..1227917,1227977..1228077,1228132..1231611,
FT                   1231664..1232103)
FT                   /codon_start=1
FT                   /gene_family="HOG000170551" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749757"
FT                   /orf_name="AFUA_4G04350"
FT                   /product="DEAD helicases superfamily protein (Aquarius),
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="EAL84582.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG020950"
FT                   /db_xref="HOGENOM:HBG319395"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="UniParc:UPI000051EC82"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N1"
FT                   /transl_table=1
FT                   /translation="MGLQTRQAMAQGLDSRPTVADFREDSSWVQLAKTHWLGASTVRKA
FT                   KQDVIRQGLWEPLEAENFSLRSLLTLENLNILEKYLWPTYSEDASNHHVLLIALIVSIK
FT                   QRDHLPIWETFSDRPGDFSNLFHRILSMSVDNSLSTFSRQSILSFIISAFQSLENVLIR
FT                   KECAPLVSISIWHNLSSEELRDRIFAKVPSLKKAWRAAGKRYEAGDETAKARMRFERSW
FT                   LFTMLLDFLRRLNGSEQELSDNLRYCERFLEYLVDLESQLPTRRYVNTLLKDLNLLPVI
FT                   RLSQMYRSPGNALFRDLVELLNHFSGFAIDDYTGEPLDPQAIYESHSRELAHLQRTAMK
FT                   HFKDKLMILALSNYGSIEQRSELEGQLSALNDSELQSLCMHLGFRTDYPKQSGVIPTRH
FT                   LYLEILLSFYERKVPFQETASRLSIVPTEKDLYDPSFLRNETYDGSRPLAIPKLNLQYL
FT                   SLGDFLWRSFLLYRSEAFFQVRKDMEAIIKRMQPRSSRDGKTLTFDGFSRMAIPISKPA
FT                   IIEVAPPKVGSSDPAFVRAEIAIEVGRLADHIRKEWDSLRPDDVVFLLAVQPGTANNSV
FT                   FRDSSVETPSLMHLRTATVVQVLDEQGRPLREPVVGHTNGYQSRPRLRRLLLNLDPSAF
FT                   KADKDRTSQGKQDIYPLINVIARRKGRENNFRSILENMQRLIVSDVTLPSWIQDIFLGY
FT                   GDPAGARYTELPNRLKSVDFRDTFLDWQHLVESFPGCTIEPSGNEASSFGPPYVIEYVE
FT                   NTSKAPSETSLKKRRRDPVEKEGTSARVIRVSTYKQPNPGPYPVDAPKLNTIRFTPAQV
FT                   EAIASGTQPGLTVIVGPPGTGKTDVATQIINNIYHDFPKERTLLIAHSNQALNQLFQKI
FT                   VALDIDERHLLRLGHGEEELETETSYSKYGRVESFLENRNYFLAEVTRLAASIGAEGAH
FT                   GNSCETAGYFNTVYIQPAWAKFFDHARAESTTTEDIIASFPFHAYFSTAPQPVFDPAAS
FT                   KETLLDVAEGCQRHIDKIFSELEDIRPFEILRQSRDKANYLLVKEARIIAMTSTHAAMR
FT                   RQEIADLGFHYDNVVMEEAAQITEIESFIPSALQHMKNGELPLKRVVLCGDHLQNSPII
FT                   QNLAFRQYAHFEQSLFLRLVRLGVPVINLDQQGRARPSLAELFRWRYHQLGDLPIVHTA
FT                   QEYKHANAGFQYDYQFINVPDYQGSGEREPTPHFIQNLGEAEYAVAIYQYMRLLGYPAS
FT                   KISILATYAGQTALIKDVLAHRCAKNALFGMPKIVTTVDKYQGEQNDYVILSLTRTRTV
FT                   GYLRDVRRLTVALSRSRLGLYILGRREVFESCYELKPAFDLLLQRPDKLMLTTGEMFPT
FT                   TRSLDDEVQGTPMEGVEHLGQYVFEMTQAKVRAMGDQDLIVDDALPDGENELLDEDEVM
FT                   LGAGDEPEDDPLHEQT"
FT   CDS_pept        join(complement(1233631..1233657),
FT                   complement(1233534..1233574),complement(1233449..1233461),
FT                   complement(1233275..1233382),complement(1233179..1233221),
FT                   complement(1233048..1233119),complement(1232926..1232976),
FT                   complement(1232674..1232752),complement(1232544..1232613))
FT                   /codon_start=1
FT                   /gene_family="HOG000170540" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259057"
FT                   /orf_name="AFUA_4G04355"
FT                   /product="PaaI_thioesterase family protein, putative "
FT                   /protein_id="EBA27194.1"
FT                   /db_xref="HOGENOM:HBG749290"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI0000F51A76"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA79"
FT                   /transl_table=1
FT                   /translation="MTTLRFVRSVWESFRATSGLEPRLLDNYRTSVSGYTNSRSQLRVT
FT                   AARPGTVNFELDIQKEHTNRLSILHGGTIASMVDLGGSLAVASRGLFATGVSTDLNVTY
FT                   LSSGGKVGDKIQAVLGKTLAYTNIKFMNSKGEVFARGSHTKYIALAWKDPKNIVEELDG
FT                   RKES"
FT   CDS_pept        join(1233958..1234081,1234139..1234226,1234290..1235517)
FT                   /codon_start=1
FT                   /gene_family="HOG000170529" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206587"
FT                   /orf_name="AFUA_4G04360"
FT                   /product="TFIIH and nucleotide excision repair factor 3
FT                   complexes subunit (Tfb2), putative "
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84583.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG146258"
FT                   /db_xref="HOGENOM:HBG318428"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniParc:UPI0000520908"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N0"
FT                   /transl_table=1
FT                   /translation="MAAAPPRPFDYLESLPGTVFNKLYQQPSTALAIFRRMLPDLAKCF
FT                   VMALLYLKDPLPAADLEAWVRPGSLKERDNALSILGRLHIMTSTTTSDNIKAYTVTDPF
FT                   ASSLRQALTGAEQTQSFGVLSQISDKEAVSIADLDEYSRRQWEGVLGYMVGTSGLGMQR
FT                   DVSLSKGVKELLQAGHLVEIRDRRVEITQDGFAFALQDVGTQVWHILVLYVESAAAIGM
FT                   DSVEVLSFVFFLSSLELGKSYEKKQLTSNQLRTLTDLADFGIVYQETPDATHFYPTRLA
FT                   TTLTSDSSTLSNPLAGSLSGPTGTSSSKAGSGFIIIETNYRLYAYTSSPLQISLIALFT
FT                   TLKYRFPNLITGKITRQSVRRAVEMGITADQIISYLSTHAHPQMRKHNVSRSTSNQAGM
FT                   PVSVLPPTVVDQIRLWQLERDRVKATHGFLFRDFNTLAEYEAPCRYAEEIGVLVWKSDR
FT                   KRMFFVTRHHQVAAFLKSRRK"
FT   CDS_pept        complement(1236004..1237893)
FT                   /codon_start=1
FT                   /gene_family="HOG000170508" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055335"
FT                   /orf_name="AFUA_4G04370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84584.1"
FT                   /db_xref="HOGENOM:HBG054442"
FT                   /db_xref="UniParc:UPI000051F18D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M9"
FT                   /transl_table=1
FT                   /translation="MSETRSRRASLLGSIQVLRSKTREGKHTYQRLGSERDSGPKDNDK
FT                   AGRIFSFGSFIPIKDESSILYSLRVKGRNSQIHEAWDSHRQVSMPLPTKSSSFGSQDSN
FT                   ETTASSEKSYRKIKISIRRLTARAGPSSSPSSSQTSSRSTSFTSSTSTSSSEHKYSKIP
FT                   VPTAHPVNGIHSRETYQKEGKRSLLSSLNKRYINLRRNASNDENKSISNIGTQETEDGD
FT                   LDIPTPPRLVKIAQNVRYVRPTEPVRVYRISRPVQAVQVNQPTLPTQPIQPVVPIELAK
FT                   SAENVQPTAESASVCEKCLEHQSKQTEMIEQRTEVVLDSSSKKFRSSITRTTSSSSSKA
FT                   ALIHLTSPRSSIPVPAKVRSPAKPCAPALQDGRKASEEQGINNNTRGSAIPVPNNATGL
FT                   NVKKVRFSEPLPQRQQTFTHHQLSDNQSAFICKITNRTLRSTSDMQPKKLRMSRGFANL
FT                   KALQTEEEVISQPASDDNQDQSVSKTSQQEQSANVPTTRNKAGTQRMVLPRDDNHTSRI
FT                   PGNKQRTLTTTIPAGFQVSEAQPRQYWLGRFMTLTNAFHYEDSFNEPDIATGFGMLSSY
FT                   SRPLGHPDANLANYRVKRAFMVLENVCVTEEASASLREFRDEYIAIHGDRWML"
FT   CDS_pept        complement(1238344..1239306)
FT                   /codon_start=1
FT                   /gene_family="HOG000251511" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750015"
FT                   /orf_name="AFUA_4G04380"
FT                   /product="Phenazine biosynthesis-like protein, putative "
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL84585.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG437425"
FT                   /db_xref="HOGENOM:HBG563743"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniParc:UPI000052041C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M8"
FT                   /transl_table=1
FT                   /translation="MTEQVRFVTLDVFTSRPYAGNPLAVVFLPDSNKPAVTQQQKQSIA
FT                   REFNLSETIFVHSEKGEKRIIDIFTPDSELPFAGHPTIGAACWFLYLSPDEGDKGVVKT
FT                   LTTKSGDIPISLQLGQPWPAVTARIAHNTRLHQSRFPLQQLLRLHPFLSGFFRITGTVE
FT                   PAFPIFSIVNGMSQVHVELPSLEALAAVTTASGGEVISGGSGYLDEGWDAGLCVTYFYV
FT                   RNVKDPQTGANTIRTRAIFGNLEDPATGSAASGLAAYLSLMERKPGQYKYNIVQGVEIG
FT                   RRSEIGVEVVVNQDNKIDTVELQGGAVKVSEGNILLPPK"
FT   CDS_pept        join(complement(1243497..1243583),
FT                   complement(1243205..1243442),complement(1241035..1243143),
FT                   complement(1239886..1240982))
FT                   /codon_start=1
FT                   /gene_family="HOG000048676" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206588"
FT                   /gene_name="tof1"
FT                   /orf_name="AFUA_4G04390"
FT                   /product="Topoisomerase 1-associated factor 1 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="negative regulation of DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84586.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0008156"
FT                   /db_xref="HOGENOM:HBG054443"
FT                   /db_xref="HOGENOM:HBG324441"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="InterPro:IPR007725"
FT                   /db_xref="UniParc:UPI0000F51A5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9M7"
FT                   /transl_table=1
FT                   /translation="MDEEGAPLSEGVQVVDPDVRAHVYSLVTALGGFNGESADRYVLGD
FT                   DALACLRDIKRWLKLYDEKHNRMDVARCLGEANLVNGDLLPILTLWSTSGQKSKHMSRI
FT                   ALACLELLVPLTWPLEVHSEMTVNHHRHTPYLQQAQVLYKRGILSHGSGSILRTIIRIG
FT                   LPSMAVPRSERTTRDEGILKLMLYFLRNIAVISPNARLAAEGDEEETSRSATINAFQNQ
FT                   DAFALLLTMCSNVGEDFSLQDVVLLEILFHIVKGVNVEKLFMNDAQRKAKRTDELGELL
FT                   QKESSLRREYAKNAPTRHGRFGTMIWVKRDDAKVSTVSGQDVLKDSQTTLHKMDQSKKW
FT                   NKPQIRRRAAEVTANNDFNTPVNINSTATKNLRMFVEEFLDSGFNPLFTHVRKAIEREA
FT                   DRVMDINTRQFFYTVAWFLEAERVRRAHQREKRHLGDTPLKEIEPDSFALVASVLNQET
FT                   FVFLNRSMQYSYDNKDVEDLTAEMRCFTQILLTVQEMAQSPLEEDQEIADNIQNRIFYE
FT                   ETTHDRIVAIVRGYKDQGFGYLDACTELAHVFLRMLEHYSKENVDMHVRSRRRAKRKAK
FT                   QAKQADIEGDDEEEASEEEDLMDVERISKERKFDFRRFAAKFCNQSCVDTFIAFTKYYR
FT                   ELNVDQLKRAHRYFYRIAFKQEMSVLLFRLDIINLFYRMIKGPGALDSNKPIFKEWEEL
FT                   VRQIIRRMIKKIDQRPALITELLFSKINSTVFYLEYGHEKQTISASKRPPAELEVEPRE
FT                   AKTIDEKIRIVVHVMVKDEHTDLVKWVSDVLNSAADEREAWESQEQHSGGQKAPNPMIP
FT                   VKSDNESCQKAMFSNAKLRLLMSLVRFERLGMEDVPGASWVVPSSLNSQELRHTRSIIE
FT                   QCLTEPVTENSDRDLSQLIRRKSGNNTRRDRDDQMANVDFGSDSEGDDNVPDGPLFPPN
FT                   PRSRANALEQLKKQRKKRRKQAGEEEEPDEEDLEARRRARLENALARQAKIKSDLYIHA
FT                   SDEETDEEADQEFFRLEEQRRKEQAERIRKALLHGVVEEVSENSRKKSSGRKRQSDQYT
FT                   ASTADSQSKRQRRLQQTEGLDGNDDLVVAGTEARSPDSLGQGSPSLKGANDVEDTLVTS
FT                   EENELDFDDDLAFSRNRTRDKVLSAENDDSDTEPPAPDTIDEDGEEAAAVAAPPRRRVR
FT                   AGFVIESDSE"
FT   CDS_pept        join(1243951..1244236,1244318..1245048)
FT                   /codon_start=1
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260027"
FT                   /orf_name="AFUA_4G04410"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase, putative "
FT                   /EC_number="1.1.1.157"
FT                   /function="3-hydroxybutyryl-CoA dehydrogenase activity "
FT                   /function="coenzyme binding"
FT                   /biological_process="fatty acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84588.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0008691"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG419704"
FT                   /db_xref="HOGENOM:HBG691737"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniParc:UPI000051EC83"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M5"
FT                   /transl_table=1
FT                   /translation="MFSASVRGVARVGSSITSRTFSTSTAAYAAEVKSLGVIGAGQMVS
FT                   MLPYCNFLSSQMLSDLQGLGIALVAASKAQVPVTLIDNTQAALDKGLSFADKLLQKDVS
FT                   KERLTQEAADAVRARITPSLNMDDLSSVDFVIEAVPEIPDLKTSIFSKLAQIAPKHAIL
FT                   ATNTSSIPITKIAAATSTDPTDLQAPSRVISTHFMNPVPVQKGVEIIAGLQTSKETMDT
FT                   AIAFVQRMGKIAAVSADSPGFLANRILMPYINEAIICLETGVGAREDIDSIMKNGTNVP
FT                   MGPLTLADFIGLDTCLAIMNVLHQETGDSKYRPSGLLKRMVDAGWLGKKSGKGFYDY"
FT   CDS_pept        join(complement(1246136..1246440),
FT                   complement(1245557..1246081),complement(1245330..1245501))
FT                   /codon_start=1
FT                   /gene_family="HOG000170497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260028"
FT                   /orf_name="AFUA_4G04415"
FT                   /product="IBR domain protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84589.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054446"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000051F187"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M4"
FT                   /transl_table=1
FT                   /translation="MPSITLSSFISGLIHSRAEEERLHASDVEKIAPLGAASDKKAIST
FT                   GARRAASRRNMDVRPAPGKSDLHLQAHIAGLKNLCVFPRLGVIDNMARLYQGIRKKERC
FT                   TVCFNSESIKNVEILPCQHIYCDYCFSRLALTAMANEQLFPPRCCSQMIPTEQVLSKLT
FT                   EKEKALFKLKAREYATSARERRYCPAMKCGKWIPLEKLEGQSTTQLCPYCGTAICPGCK
FT                   DKAHAPGKCSFDPGLTEFLELARTQGWQRCFHCGAMVELNEGCPRITCRCGADLCYNCG
FT                   GPWLICHHNALGNVIAECQTGAPLGDGMGTHDAVELAAIVAAMKFAERELEE"
FT   CDS_pept        join(complement(1248412..1248907),
FT                   complement(1247647..1248355),complement(1247532..1247594),
FT                   complement(1247338..1247476))
FT                   /codon_start=1
FT                   /gene_family="HOG000170496" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260029"
FT                   /gene_name="arp6"
FT                   /orf_name="AFUA_4G04420"
FT                   /product="Actin-like protein arp6 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="cytoskeleton"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84590.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0000520428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9M3"
FT                   /transl_table=1
FT                   /translation="MGSTKPRTSAQASAPKVQSLPEKTFIIDNGAYTLKAGYAPGFPPP
FT                   EDLGQALSACSTIPNAIAKTRGNRIYIGAQLNSQVTDWNEMVFRRPVEKGYIVNWEAQK
FT                   EIWDNAFFDEKTVRSKDLRIESPEDTTLVLTEAPNALPTLQKNADEIVMEEWGFGGYVR
FT                   FVGPVLNAWNEVQSLFGDPIGQDSSSPISPKQCLLVVDSGYSHTTVTPVYKGQPIQRAI
FT                   RRLDIGGKHLTNYLKEMVSMRQYNMVDETYIMNEVKEAVCFVSNNFAGDLEQTWQGNRK
FT                   RGLTDAAEGITVDYVLPDPNTGKKGFMRPHDPLSNAKKRKSILSGGNAEALSEDVLILG
FT                   NERFTVPEILFTPSDIGMKQAGIPDIILQSLSVLPTGLHPSFLANVLVVGGNTLIPGFL
FT                   ERLESELRQIASAECVVRVRRPHDPIRSTWLGASRLAANRAELRKFAITRQEYQEYGSS
FT                   WAGRKFSGIL"
FT   CDS_pept        1249279..1250391
FT                   /codon_start=1
FT                   /gene_family="HOG000170475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902007"
FT                   /orf_name="AFUA_4G04430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84591.1"
FT                   /db_xref="HOGENOM:HBG054447"
FT                   /db_xref="HOGENOM:HBG327558"
FT                   /db_xref="UniParc:UPI000052020B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M2"
FT                   /transl_table=1
FT                   /translation="MAKQLRVSLTTTLTLLEQLQAALSAPAEDPKPAELSGKDALPLLS
FT                   TSATALKSQVTKLSLLTITSPFTHSAVGTVLSALNSSVLPSLVTGALLVTPADHTKAFH
FT                   AEVHALTKTTLRELTSLVTEVQAVAEKADKAKEGQRKGGKLLQAEKDPVTVATGRVWDS
FT                   CDALIDVAAKGVVGFVIRRVEEWRDLVRDAVEEIEEWDPEEDGDEFFDDLLSDDGEKDT
FT                   QDEEDEDTEESSATLHAQKKSTLRILKPIAQIYPAIVANRLKGAGDVPCSSPSGIGRLE
FT                   RLMTNLQHIPEHIDEVAGALYEEDLGKCAQYLDKAKHCAMNAVDSVKPTWDTVDATDGQ
FT                   QKEDKFAIWSKTWMNVLDEVSKSVEADNQE"
FT   CDS_pept        complement(1250690..1253686)
FT                   /codon_start=1
FT                   /gene_family="HOG000170464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206589"
FT                   /orf_name="AFUA_4G04440"
FT                   /product="Conserved leucine-rich repeat protein "
FT                   /protein_id="EAL84592.1"
FT                   /db_xref="HOGENOM:HBG054448"
FT                   /db_xref="HOGENOM:HBG327549"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000051E5A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M1"
FT                   /transl_table=1
FT                   /translation="MDQQQKTPTRPSGIPRLAASRLPLPTSSTSRSVKPSPSREKLRAD
FT                   PGLDATRLRRPSEQPVLKKPPPKHPLSYRTPEKPRQKRDTSNGGLSNGGRSENAGDASE
FT                   EAPMLGTDAAVGDAERRGRPRPSLSERTIETLSRIPPSPGPPSRQSSFFNGNSPVRSPS
FT                   RTPSVMTSRSPSRASTTRQPSENDFLSQQASAIQLPSRSRISPAPTLSSNDASTGQRTS
FT                   SAGTDISSTLKKPSVRASLYNGVNDTTRKSPDPRPALGKTSANATFSDMGPPPPPLHVK
FT                   KTRKSLANNSSPINNSRKPSTPLNAPDLSIEQQSEIEMRKASKSSSALRESIAKAKAAR
FT                   KASARQNNTQNGSVDIFDNLNVEDPFNQQPKDSKSGLLRKRVEAGRTSGHLNIAAMSLT
FT                   EIPKEVMAMYDFDPNSTTDWYESVDLVKFIAADNEFVELSEAAFPDIDPFDIDSDKDER
FT                   GNQFAGLEIMDLHGNQLRTLPMGFRRLQRLHTLNLSNNKLDAESIQIVMQMEALKDLKL
FT                   ANNLLEGSFSSDVKNLTRLEVLDLRGNSLTELPKSLEYLACLRILDVGDNQLTSLPFQS
FT                   LGMLPLKDLRAPRNKLAGTLIPASLSKLDSLQSLDVTGNALTAISEREDLEMPSLQTLS
FT                   ISMNRIKHLPNICTWTALLTLSAEDNSLSAIPQGFVELQNLRNVDFTGNNISKLDERIG
FT                   LMEGLSTLRLANNPLRERKFLTMNTDDIKRDLRNRCEPEPQDTDDDEGSVATQFTLAPE
FT                   TPAQMTSWQVKPGGILDRSYSELSEVDVKQLERINFNDIRCVYLQHNSLTCIPVPAFSM
FT                   LAHCLTDLDLSNNPLDSLSVLSTSLTLPNLHILNLSAAKLTTIEPILANLTAPCLTTLD
FT                   ISYNRLSGPLPAVRQVYPNLMTFLAADNGFQSLDFEAVQGLQVLDVSNNNISSLPPKLG
FT                   LLRAEGCSKNWGTGSPLRRFEVAGNSFRVPRWQVVAKGTDAILDWLKDRIRSEDLAEWE
FT                   PDEESTVHV"
FT   CDS_pept        1255576..1257000
FT                   /codon_start=1
FT                   /gene_family="HOG000170453" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206590"
FT                   /orf_name="AFUA_4G04450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84593.1"
FT                   /db_xref="HOGENOM:HBG054449"
FT                   /db_xref="HOGENOM:HBG327543"
FT                   /db_xref="UniParc:UPI000051F173"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M0"
FT                   /transl_table=1
FT                   /translation="MSQESQLSQTSLAPPLELPGPATPDRRPSLSASPELDEKVQVQVS
FT                   QADQRKLVSPPSLASSDMTPPPSSQVPGAPLRRSRSRSTTYLASPPDIEKTLCAAYGAS
FT                   ENLPSVGDIDTAGEPELRIIAKELLSVAQEARMSALHFKLQNSLLSFTSNEAIKRAEVE
FT                   HQLARREVEILQSSEYRNRHGPTEVKPLQPMSNAELEAALRRNQELERVNATLDRRLRR
FT                   AKKLIEQEKEKSELLMEENNLLKKRIRENREHFSRMIERGSMSPSPQIQSGTPQRKPVP
FT                   HFHDSPSPHMSRGESHPFDALLAADRVLNRGSSDFQSSPQRFSQRQHSNGHVRGTHSLS
FT                   SLPMTPSQPRTTPREHLFFTPTRNTQYEQRDRDSTISASDIEEAETEEDIPASQPDSPA
FT                   TSMVRPDPVISQQQTRSAAIAPKTSTLLQTKLFGQVRKAGVDRPPSGLKRKASIDESAA
FT                   SKKSKAAEGVGLGIEA"
FT   CDS_pept        join(1258062..1258098,1258152..1258198,1258334..1258492,
FT                   1258632..1259069)
FT                   /codon_start=1
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260030"
FT                   /orf_name="AFUA_4G04460"
FT                   /product="60S ribosomal protein L13 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL84594.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211060"
FT                   /db_xref="HOGENOM:HBG601563"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniParc:UPI0000F51AA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L9"
FT                   /transl_table=1
FT                   /translation="MNRLFTRHGNPDYFHKDWQRRVRVHFDQPGRKHRRREARLAKAAA
FT                   VAPRPVDKLRPVVRCPTVKYNRRVRVGRGFTLAELKEAGIPKKLARTVGIAVDHRRVNY
FT                   SKESLVANVARLKDYKARLILFPRKSGQFKKLDSSADEVNAAKAAFAAEGKTEGYATKL
FT                   GATFPVKNISAAEAVTEVKRDELPKGEEAAYRRLREARSEARYKGIREKRAKAKAEEES
FT                   AAKK"
FT   CDS_pept        join(complement(1260825..1261723),
FT                   complement(1259787..1260768))
FT                   /codon_start=1
FT                   /gene_family="HOG000170431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260031"
FT                   /orf_name="AFUA_4G04465"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27195.1"
FT                   /db_xref="HOGENOM:HBG324442"
FT                   /db_xref="UniParc:UPI0000F51A98"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA80"
FT                   /transl_table=1
FT                   /translation="MSSQPLRGDARTRPSRIPTFQAPTKASLARSHPELLERAHNKSPG
FT                   KDRNQDDQQKQAEAGVFGLRDRKAFRPSLASTASPVRTARQVGDARSPFSTRRSSGIQA
FT                   FAAPPRRVPRKITPADFVFGSPANLPNTVANPEPINTPEDQLASELGSATGEVNVSINS
FT                   EQPPLHEEFEEPDLPPTPTQLGLENPPERPRGLLSSSPSTQLEKFRTRRTGELLEKSPS
FT                   KLRKVDYGRQTGDQSGLGVIVSKEFLPEPVVKKQKLKKELSADLRKLKEDIAELESWSE
FT                   RFGQQHETMESDHDLDKLISILVTEDPVSKNVKRPAANPSISSLLSALLPFSTKFAPSI
FT                   QQSPTPTNPFALAASARAKPYLTVFAPLNLTAHSNTTSDSKNDTLLEKHHLTLTAPAPF
FT                   PSNVYSIPVVYETNTELLCLTSISVPTSPGTSLTKIPIPLRRWIDSRLSNPLLKLDITG
FT                   LCQGISQYWEAMLSRALVWSEIENRHANLLGRPALVGAPGKSNTQQGQDDRSNSRRLLP
FT                   HLKRSTMLFESKENRMKLLLSCDLSMDEWSSEPKLTTDISIASRSTSNGTSCRKIELET
FT                   KKLFREVLRDFRRQQGANETEADAIIRAVECVLNALFGVEAGGELSKVHA"
FT   CDS_pept        1262040..1262852
FT                   /codon_start=1
FT                   /gene_family="HOG000170420" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750016"
FT                   /orf_name="AFUA_4G04470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84595.1"
FT                   /db_xref="HOGENOM:HBG054450"
FT                   /db_xref="HOGENOM:HBG327524"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI000051F174"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L8"
FT                   /transl_table=1
FT                   /translation="MECFSMHITQSILRCRIRPLIFGHSRATTKPSLPLGPISSLTRQY
FT                   AFTAPSHRRTLHDDSLASLEDSTRSQAHPLSGYYYDILSSKSPYRSHAPTSHPAAEKPT
FT                   PATTVKPQSPEEKMSIVFGSRLAGPGRASRYNPGTLPPESQWKTINGVAIPPRPEEPDN
FT                   CCMSGCVHCVWDDYRDEMEEWASRVEKAKAKGTTQKATADMRQTPRAEVDSASRSMDDD
FT                   GGGSETNWPVSYEADDLFANIPVGIREFMKTEKKLKEKHQHEKNKASS"
FT   CDS_pept        join(1263305..1263486,1263555..1264071)
FT                   /codon_start=1
FT                   /gene_family="HOG000170409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260032"
FT                   /orf_name="AFUA_4G04480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84596.1"
FT                   /db_xref="HOGENOM:HBG054451"
FT                   /db_xref="HOGENOM:HBG327517"
FT                   /db_xref="InterPro:IPR021641"
FT                   /db_xref="UniParc:UPI000051F3EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L7"
FT                   /transl_table=1
FT                   /translation="MSISKTETDIILNKANVALARSQRLVASWLPPPTDEEKARVKTEE
FT                   ELQQEEDEIFTAVPETLGVGAPLPEKAADGSWNRTELDSNDKLRKQLLGKNYKKVMAAS
FT                   AAVKSGKPVGQNGVPAGNATASSAGGTGDADDDDDDEEGRTAVVGKKGDLRKRAVDSAR
FT                   KRKATADIAEDDGIGPSGAGEIKGGDSEDTTAKHEGPLSRPAPGPRGRKKATSFLDEIL
FT                   ADRSKKRKKR"
FT   CDS_pept        join(complement(1266706..1267058),
FT                   complement(1266489..1266587),complement(1266356..1266423),
FT                   complement(1265948..1266291),complement(1265819..1265888),
FT                   complement(1264941..1265758))
FT                   /codon_start=1
FT                   /gene_family="HOG000170398" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260033"
FT                   /orf_name="AFUA_4G04502"
FT                   /product="Flocculation suppression protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27196.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG324444"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000F51A5A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA69"
FT                   /transl_table=1
FT                   /translation="MSSLADPPSQNTFTAGPADAAGKTRKLPVLPSSIPSSVQSTGDSM
FT                   EVTPPASTTTGPAPPAHSSPDSDRAGANTANSNGSVETGNMNNTSMANQAIGAAAAAQQ
FT                   PKVVQTAFIHKLYNMLEDPSIQHLISWSSTNDSFVMSPTSEFSKVLAQYFKHTNISSFV
FT                   RQLNMYGFHKVSDVFHTGSPDSALWEFKHGNGNFKRGDLVGLREIKRRASRHALIHRDS
FT                   FPGHKTAVSQPGTPAEPVPDATEARLLNLEHSLYDMHTRLSRAEEAHTALNLRCQAMAE
FT                   SLARCHHWAYSISQFLQGTIPDRDSPLYRDVSSMQKEIEKHLDVVRTLENPPDPYLSVR
FT                   PPFFANVSVDPGPPLSPRQVPQDDSRRPSMMDPSRQNIIRPPVPPHLAVSPRRYGSIGG
FT                   GNSSPNYNRPQVPSVVPPQQPVPHPLSSVSSPPGPNLARRHTSADIRQHGWPPPNVSQF
FT                   PPANAPGAPATPWPPSPHRTPTSSEQQVRDVLAQYEMGVSRRFQSSSRHATPPLNSDQP
FT                   SSTLTVDNTWTYGGSKYARHESSLPATRRSSMASNVHSLLNPADTAERPEEDQHNNLED
FT                   RKRKRLE"
FT   CDS_pept        join(complement(1270710..1270795),
FT                   complement(1270457..1270622),complement(1270030..1270400),
FT                   complement(1269087..1269966))
FT                   /codon_start=1
FT                   /gene_family="HOG000217275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260034"
FT                   /orf_name="AFUA_4G04510"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84599.1"
FT                   /db_xref="HOGENOM:HBG054455"
FT                   /db_xref="HOGENOM:HBG327508"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051EA5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L4"
FT                   /transl_table=1
FT                   /translation="MEFVDPNSDEQEIITRLQNLRAKPARRRLFRQLVHQLASDEWRDL
FT                   RDLLNKRTFKCDILGLLPPEIAVQVAQYLDLAEIHVLQRVSRTWHKLLSSNPVCSAVYR
FT                   RYSGRTLDLFHQASRHIYNQYAKQRIRLERGEPSSALRRREPSHISPACLDYSNGRYAW
FT                   TGEMTTVVVQDMCSHAMQMFCTENRERIGHIRLSDMIVAAVTLRGYCHVWNLQTEESAY
FT                   FRLPSRLFHLFAVRGTKVAFGFKDPAAGNTVVMQWDFNSRVSRTVVVADHLVFIDLHPT
FT                   LDCLISIHLQRNDGVDGPWDLEGVPCNATQLQVVKHYPDDSVGAPQTASKSIALPRLED
FT                   NDWVVRPNAWLSDQFNDRVGILIARPKGSKDHHPHYIIAITYYIETEEVFLHLLPPEHT
FT                   FSSHLHLAPVDRNLLYYIRVEGAMPTIWISQPGAQVPYRPAKSMPSPWAVDPGQHDADE
FT                   YVLKGDHDCVLLLNRGGVSAWCFDEAAQPLRAIPFQLPENRR"
FT   CDS_pept        join(complement(1273294..1273350),
FT                   complement(1273118..1273201),complement(1272983..1273055),
FT                   complement(1272822..1272921),complement(1272204..1272749),
FT                   complement(1272096..1272142),complement(1271752..1272044),
FT                   complement(1271548..1271682))
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206591"
FT                   /orf_name="AFUA_4G04520"
FT                   /product="Succinyl-CoA synthetase beta subunit, putative "
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="EAL84600.1"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG130207"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI000051F64D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L3"
FT                   /transl_table=1
FT                   /translation="MFKLARSSRPVAAAIRAATESSVQFRLAQQQRNLSIHEYLSARLL
FT                   KSYGVGVPKGEVAHSAEEAEAVAKSIGNDDMVIKAQVLAGGRGKGSFDNGLKGGVRVIY
FT                   SPTEAKMFASQMIGHKLITKQTGAAGRLCNAVYICERKFARREFYLAVLMDRATQTPVI
FT                   VASSQGGMDIEAVAKEHPEAIMTTPIDIKVGVTDDIARKIATDLGFSEQCIEDAKTTIQ
FT                   NLYKVFMEKDATQIEINPLSETSDHQVLAMDAKLNFDDNAEFRQKEVFSWRDTTQEDAD
FT                   EVKAAEYGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPAAIKS
FT                   AFELITSDPKVTAIFVNIFGGIVRCDAIARGLINVVEDMGLRIPIVARLQGTNMEQAQK
FT                   LINESGLKIFSIEDLQSAAEKSVQFSKVVKMAREIDVGVEFTLGI"
FT   CDS_pept        join(complement(1275060..1275103),
FT                   complement(1274757..1274981),complement(1274685..1274692),
FT                   complement(1274461..1274612),complement(1274302..1274396),
FT                   complement(1273875..1274244))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750017"
FT                   /orf_name="AFUA_4G04530"
FT                   /product="Short chain dehydrogenase/reductase (Ayr1),
FT                   putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84601.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051F8AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L2"
FT                   /transl_table=1
FT                   /translation="MTTERDDRKSVLITGCSPGGIGNALAREFHRNGLRVFATARDAKN
FT                   IDDLAALGIETLDLVVDDEESVKFCCSEVERRLGSKGLDFLVNNAGRNYTVPATEIDLA
FT                   EARKTFETNFFAVISICQAFLPLLIKAKGTIVMIGSVAGIIPYVFGSVYNASKAALHSF
FT                   SDTLRVELAPFGVNVTTVITGGVQSRIARTKRTLQPNSLFTPIKDEYARRVTHSQDGAM
FT                   PHAAYARSVVTQVLYGSAPWRWLWPWAQGRKSWIWEGNKSWLIWLLCGGWAWTGLFHGA
FT                   MTRMFKLYKLKNAVGK"
FT   CDS_pept        join(1276853..1277556,1277612..1277960)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260035"
FT                   /orf_name="AFUA_4G04540"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84602.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054456"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI0000520429"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L1"
FT                   /transl_table=1
FT                   /translation="MVYSAAAILPISIYLQIITHASNRVIVCACVYRLIRNNVDQYFSV
FT                   RSRGYRTLAKSCRRCVILDRCGSCSDPLCRYLPATVCDILLAHYMMECSPCLRWSTQTF
FT                   TIAQMTPIWIFPAYPMLIIGPHAGILSAKLEPSRALPIIIGGTTIQGIGLLVTLTVYSA
FT                   YVYRLFSQKLPRENLRPGMFVSVGPSAFTVSGLVTMAAHAKRCFPDDFMGNGALAANIL
FT                   EVVVNFACLWLWGLAIFFFFIATFAHWSTIGPGRMNFSMAWFSFVFPNTALITATFAIG
FT                   NAFSCKPILIIGCAMIFPLILMYIFVFYMMIRAIVLRQIMWPQKGEDKDEGGFEINRTK
FT                   PETPGEQTPV"
FT   CDS_pept        join(1278965..1279011,1279072..1279384,1279453..1279565,
FT                   1279633..1279681)
FT                   /codon_start=1
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260036"
FT                   /orf_name="AFUA_4G04550"
FT                   /product="Xanthine-guanine phosphoribosyl transferase Xpt1,
FT                   putative"
FT                   /function="transferase activity"
FT                   /protein_id="EAL84603.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG327482"
FT                   /db_xref="HOGENOM:HBG507301"
FT                   /db_xref="UniParc:UPI000052020C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L0"
FT                   /transl_table=1
FT                   /translation="MIAIGGGGYVPARILRSFLKRPGEPNIPIQAIGLSLYEDLGRGDP
FT                   EEVPGTKVTRTQWLDLSSLEMANLIGKNILIVDEVDDTRTTLEYAVRELQKDVEMAQKQ
FT                   LGREAEKTNFFVFVLHNKNKLKKGELPADMMESGRYLAAVTTEDVWICYPWEATDIEEH
FT                   DRLAMETPLV"
FT   CDS_pept        join(1281588..1281939,1282186..1282302,1282535..1283763)
FT                   /codon_start=1
FT                   /gene_family="HOG000170376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206592"
FT                   /orf_name="AFUA_4G04560"
FT                   /product="GTP binding protein, putative "
FT                   /function="binding"
FT                   /protein_id="EAL84604.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054457"
FT                   /db_xref="HOGENOM:HBG327466"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F889"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K9"
FT                   /transl_table=1
FT                   /translation="MISDNEPDMVHTTGPDTEDQLAKETSSKAQNDIDCPSLGQILSQL
FT                   SPPPSTLPVQTLSLVPVDEQEVLLRRLEDVLAEATGGAESFEEVQTILNELWKCQSSYL
FT                   AQAADALANGSRNDENRALVVKGNYTAAILNRLSPELVHVVIPVIYNISIDYEQGIRES
FT                   PGGTILLLLDLLSEEGVALSQFVGLANCLMSYLDKERFQDICISQCMVDRVLSVLKQSL
FT                   YIKADPSSNGDTKALAQLQLKINQTLSEVSASPKFSEVYPLGSPLVQTLKDWLASTEDQ
FT                   LQICSCVMLGNLARSDAVCEIMVRKMNIHTMLISILRSDARGAVLHSALGILKNLAIAG
FT                   ENRQSLGDARIIPAVSRLWGYETVPQVQFAATSIVRQVIISSTANISCLLGLAPIDEDS
FT                   SASGQTYLSSLLSLCEKTDSTPIKTEVGRIVASICRTIVPKSREADSEASTLLERLFTM
FT                   HQSVALPLGAMIAQSQWPVVRSEGWFALALMASSKHGTGAVIDCLQKLDLYPLLEETMS
FT                   TPVSDSADDADKLKAAKDRDNIVVLIQELLKNDVSQKQFSSPISAGVY"
FT   CDS_pept        join(complement(1285282..1285440),
FT                   complement(1284145..1285011))
FT                   /codon_start=1
FT                   /gene_family="HOG000170365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750018"
FT                   /orf_name="AFUA_4G04570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84605.1"
FT                   /db_xref="HOGENOM:HBG054458"
FT                   /db_xref="UniParc:UPI000051EED2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K8"
FT                   /transl_table=1
FT                   /translation="MSRLEKLGDVESQNEDVSTDLTWSTILKWGIITYTSMLIVFISIC
FT                   SCCPSLIETNDTASLEWLASIVQKTSAYSVWTSPADAYGKMNSRTLFVWLDGDVVFLED
FT                   HTIPTIVRTMLDNPDSLMVSANVINHAALEALHSHPGVALPYLPELHQASGAAQLPPAR
FT                   VLDWSTSHLPPWAGPEDFRVLKGFAPPGSKHRWLLSDDEHVDRTPISTSMYTTVGPGFS
FT                   DWTVKAQQHYSFLHHLELGELHRYKFPKWSNPADISPNLLCFWDADANVVQSSILHGSS
FT                   YVPIRFIEDANKPTKRTVIIDGKGLAAHYSADAGAEDLDSTDILQRYEAYAKEIICPNV
FT                   Y"
FT   CDS_pept        join(1285670..1285763,1285869..1285954)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260037"
FT                   /orf_name="AFUA_4G04580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84606.1"
FT                   /db_xref="HOGENOM:HBG054459"
FT                   /db_xref="UniParc:UPI000051F3EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K7"
FT                   /transl_table=1
FT                   /translation="MYRNSEMTARAGSGNNGGNLEVGGWKRQGVEYYLWFYLINHHDEG
FT                   RGGLVPDPVLPMTS"
FT   CDS_pept        join(1286112..1286654,1286723..1288065,1288149..1288326)
FT                   /codon_start=1
FT                   /gene_family="HOG000170353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260038"
FT                   /orf_name="AFUA_4G04590"
FT                   /product="Ubiquinone biosynthesis protein, putative "
FT                   /protein_id="EAL84607.1"
FT                   /db_xref="HOGENOM:HBG142612"
FT                   /db_xref="HOGENOM:HBG327456"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00005206B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K6"
FT                   /transl_table=1
FT                   /translation="MRTATLFGRFFWCRGGGSPQLLTRFATPFRFRSKHTPWPPSPWRS
FT                   FQRKAPVGRTVLFAALTPGAFLELAEKGDGHNKTGEMQMLEISRQEIRKSVSEDAQGLM
FT                   KLCEELFVFWYCYIYDPIATGFRFVHLAIVFVPVIITAPAIWFGRRLDDGKGERAGAVW
FT                   WYGFLVRSMERAGPAFIKLGQWAASRTDIFPPEMCNIMSSLHSHAPAHSLHQTKKTISK
FT                   AFNGLPFEEIFEEFYEEPLGVGAIAQVYRAKLKPSLAVMDDQALTLEDRSFRGKVRKNV
FT                   DVLVKSSPRRVPSSYVAIKVLHPKVERVIRRDLRIMSFFASLINAIPTMHWLSLPDEVQ
FT                   QFGEMMKLQLDLRIEASNLVIFRQKFKSRTTAWFPYPYLEYTTREVLVEEFAQGIPLET
FT                   FLDVGGGVYQQEIANEGLDAFLHMLLIDNFVHADLHPGNIMVRFYQPAELDLSLGKRSR
FT                   VSDAPTAAEADVTETVLARLRPHAHNREAWHAALSQLNAEGYRPQLIFIDTGLVTQLNE
FT                   TNRRNFLDLFRAVAEFDGFRAGQLMVERCRQPEEVIDADIFALKMEHLVYNIKSRTFAL
FT                   GNVKIGDVLSEVLSMVRTHHVRLEGDFVNVVISILLLEGIGRSLDPGLDLFKSALPILR
FT                   QLGSGATLLSSVRSGDTSMLRVWVGLEARGLLQASVESVEQCVKYDLLSPNI"
FT   CDS_pept        join(complement(1290167..1290250),
FT                   complement(1289450..1290108),complement(1289142..1289391))
FT                   /codon_start=1
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902008"
FT                   /orf_name="AFUA_4G04600"
FT                   /product="Cytochrome c heme lyase, putative "
FT                   /function="holocytochrome-c synthase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EBA27197.1"
FT                   /db_xref="GO:0004408"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG627179"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniParc:UPI0000F51A81"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA81"
FT                   /transl_table=1
FT                   /translation="MGWFWADPQAKPTPVAPNPLASSDASPPPGCPMHASNAPPALSSL
FT                   SARSDTSSSCPVRSPDSPFYVRPKTTVTDSPQPPAPETKSALSKLNPLNYMFSSISQER
FT                   APNQTVDLPVEREPSSIPRGDADGNWEYPSPQQMYNAMLRKGYTDTPQDAVEAMVAVHN
FT                   FLNEGAWAEIVGWERLFAKGLGQAWEKCRKGEQGIAREAMKQEMTGNVDPACEPRLLRF
FT                   KGRPQELTPKAQILQALGWLYPAKFGTNPPFDRHDWFVLRQTPSGPKEVRYVIDYYSGP
FT                   PEPTGEPVFYLDIRPALDSPTAAIERLMRWGGDVWYRASGGAVRENNNS"
FT   CDS_pept        join(complement(1292354..1292822),
FT                   complement(1291880..1292208),complement(1291665..1291789),
FT                   complement(1290819..1291611))
FT                   /codon_start=1
FT                   /gene_family="HOG000170331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902009"
FT                   /orf_name="AFUA_4G04605"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27198.1"
FT                   /db_xref="UniParc:UPI0000F51A5C"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA82"
FT                   /transl_table=1
FT                   /translation="MYTFIDHDDDLSSKRIRDANARKAIRSHVMRDVRRRERLAGLKRI
FT                   TKRESRLKHPLPLSASISTQAESSTSECLLEAGVASPLPASSSFVDSNPPRSLLRSPQE
FT                   RRRPLVWRAGYSVPPTPAPNPLAFPSSWLLDPFGSLMGAGEAPSRVARLVCYWKSVFVP
FT                   MTFPEEHKINEQAETGLMVKSSFSDPGSFFGLMAMCAAHRAVLAGYHIDCSRAPDSSRS
FT                   TGHDTDYYFMKARCMQEMNAKMCDSERALSDESFDTMVNLLTSTLIIGMFDETRIHLAG
FT                   LKRMVELRGGLMADSIRQPSMLAAIITSDVKAASGLMTKPLFPLPWDPRPVPSSVQQRI
FT                   RPPAASVLARLGAAFFDNNIFSLPLLRILDVMRDIVLYSQAYRERPASLCPEDHELFRV
FT                   VNCETEHRLLSYIYTDGHQGSPSETQLDISPIEAVTRVACICFLNQFLILSPPSSGLGR
FT                   ALTKHLKASMSSWSLSLGPKSTKAINGLLAWVLFIGAQSSAGQAEHSWFIGRLARLAML
FT                   RGWQKWEQVADTLANYFYLPDFHGAIWESAWKEAVTGLVSQRCIGECSNSSLRD"
FT   CDS_pept        join(complement(1295609..1295635),
FT                   complement(1295474..1295553),complement(1294744..1295408),
FT                   complement(1294555..1294706))
FT                   /codon_start=1
FT                   /gene_family="HOG000170329" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260039"
FT                   /orf_name="AFUA_4G04612"
FT                   /product="Ubiquitin-conjugating enzyme Ubc6, putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="EBA27199.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000F51AB5"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA83"
FT                   /transl_table=1
FT                   /translation="MATKAAYKRLTREYQNIQKNPPPYIVAHPSESNILEWHYILTGPP
FT                   GTPYENGQYWGTLMFPPEYPFAPPAIRMHTPSGRFQPSSRLCLSISDFHPKSFNPAWEV
FT                   STILIGLLSFMTSEEMTTGSVSASEAERRVLAARSRWWNSTGGGSHISATPGVTPTARG
FT                   INNVKAGDGGLKFRSEWPELDQENWQWMRENRIDTNTGQLIPDPNSSVTKCSPETSALR
FT                   RRPNASAPGLGAVMEGGQVAREAGQSWARRNKIWIGWSTMSKVEFSEICFLFTPIRRYF
FT                   FFFLSSGPEGPSYVFEIGSAKETARD"
FT   CDS_pept        join(1295892..1296008,1296089..1296205,1296301..1296487,
FT                   1296542..1297755)
FT                   /codon_start=1
FT                   /gene_family="HOG000170308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260040"
FT                   /orf_name="AFUA_4G04620"
FT                   /product="Mitochondrial outer membrane protein (Sam50),
FT                   putative"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="EAL84610.2"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG060099"
FT                   /db_xref="HOGENOM:HBG756550"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI0000F51AA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K3"
FT                   /transl_table=1
FT                   /translation="MASFSPPGASRGQPKRTVRGLLAIAAAEMSSPLSAEDEDIFERLQ
FT                   QRADPKVLEEQQQAINERVHAIYQKAQMRLGELIDQNSTLPCAISSVQVLNATHTRRSF
FT                   LQSIFDPLLSVNQSRPYTLSEALREISSRADKLGKFDIFQQPISVYIDQSQDAKSQNGI
FT                   PNIDVFFSVKEKSRVLLKTGTDLGNTEGSAYGNLLWRNVFGGAETLNLNAAMGTRTRSA
FT                   YQAAFETPILSDPDFRFELGGIASSTQKSWANHEEVLKGGWSKLRWLSQSGHRHEIGYN
FT                   GFWRQVTGLAENASPTVRADAGDSVKSSIFHSWVADRRDNPLLPSRGYYAKAFNELAGW
FT                   GPLKGDVSFWKSEVEAQGAIPIPIPGIKGDSGISFTTGFRAGLLYPLGLDSDSRPQLSR
FT                   INDRFVLGGPTDVRGFRLCGLGPHDGADAVGGDVYAAGSANLFLPLPRVGADKPLRLQA
FT                   FVNGGRLLPLRTLQKEAPTNSTEVKDAMTATISELGNGLPSVAAGIGLVYAHPVARFEL
FT                   NFSLPLVLRKGEEGRKGLQLGIGINFL"
FT   CDS_pept        join(1298065..1298415,1298510..1299112)
FT                   /codon_start=1
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750019"
FT                   /orf_name="AFUA_4G04630"
FT                   /product="Golgi membrane protein, putative "
FT                   /protein_id="EAL84611.1"
FT                   /db_xref="HOGENOM:HBG191785"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="UniParc:UPI000051FFD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K2"
FT                   /transl_table=1
FT                   /translation="MAQYYPQQQPYGSQASPQNLQFYPSSYTSVSGHTTPSQATYGGFG
FT                   GPSGSTAQAYPVGGVGSGYGGFGSPAAGVSGRMGEQGGLRTGWLAAFGTEGYEGEPPLL
FT                   EELGVNFEHIRTKTLTVLNPFARIDQHLMDDSDLYGALLYIVLYGTFLLLSGKVFYGYI
FT                   YGVAVFGTVVLHLILSLMSPALDTASAPNAADPSNYDPHHKPTMSDASSVGHFSATLTF
FT                   PRSASVLGYCFLPLVLTSLVGILIPMDTLFGYLLTTAAVGWCTYSSSGMFCAVARMRGM
FT                   RGLVAYPLALFYVVFGIMGIFSSRGSGTLAAKTGAA"
FT   CDS_pept        complement(1299450..1301837)
FT                   /codon_start=1
FT                   /gene_family="HOG000170297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260041"
FT                   /orf_name="AFUA_4G04640"
FT                   /product="Ubiquitin fusion degradation protein (Ufd1),
FT                   putative"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL84612.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG054463"
FT                   /db_xref="HOGENOM:HBG327424"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI0000520924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K1"
FT                   /transl_table=1
FT                   /translation="MAREQDLLQWSSQFFVAAPQRTPKLPGDKITLPQSALEQLLAAAP
FT                   LSDVSPQGSLRQYTSTFDPFNPHTFAAESRARAQQLDRQKQLPHPLTFRLVNPNNERAI
FT                   YAGIREFSAAEGEVGLSGFLRQALDIEDEPFQLQTGEHGTETAHSPDLNNREGSGSVRS
FT                   TRHSTPTITVHAKQLPKGTYVRLRPLEAGYDPEDWKALLERYLRDNFTTLTIGELLSVS
FT                   GNRNERFRFLVDKVEPEGDGICVVDTDLEVDIVALTEDQARETLQRRLEKASRAPGTKG
FT                   GSSIGGVLALGETVTGQVIPGEYVDYELSRWDGEETIEVEVEGIDDAVVYLFASPFSSH
FT                   QRNRPRLDEHVFADFSSQPSKKLRIRPTNIELDGAEALYLSVHAYSQTEAGAGMASSQT
FT                   LPLRYSMRVVQSSSAIQREQTAAQLDTHEPGDVQCKNCHQWVPQRTLVLHENFCLRNNV
FT                   LCPQCGNVFQKRSPEWDNHWHCPHDSSHGNDIPSKDRHDGIFHTRRLCPDCGFEADSLP
FT                   SLAQHRTTVCPEKPILCQFCHLVVPQRGETDPDMLDPEVLLSGLTPHELVDGGRTTECH
FT                   LCNKIIRLRDMKTHLRHHDLERLSRPAPRICLNQNCGRTLDARAAQSTITPGTDTLGLC
FT                   SICFGPLYVDTYDPEGKLLRRRIERRYLSQLMSGCGKPWCQNEYCKTGKQHRLSINTSD
FT                   GGTTSMSVAQILTLVRPLIDAINLRRDAPNTAPFYLCTDQVSQQRRIQAEMIAAEGAMT
FT                   GGKAYDLPWCVAAVEATAGDLDKAREWLTNWAPARDEEQTFC"
FT   CDS_pept        complement(1302864..1304483)
FT                   /codon_start=1
FT                   /gene_family="HOG000170286" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750020"
FT                   /orf_name="AFUA_4G04650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84613.1"
FT                   /db_xref="HOGENOM:HBG054464"
FT                   /db_xref="HOGENOM:HBG327417"
FT                   /db_xref="UniParc:UPI000052020D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K0"
FT                   /transl_table=1
FT                   /translation="MMAEGELWYSLVTAIDPVNIKAMPAVLQSTINLLENELAKARAAL
FT                   KEIQPNAAPRFTVGDELATGAIAAYRQNLIGRAPDFYYGTQRLTPKELGLVPVVREVQV
FT                   TSEEEEAPQEESQCSVTVIPSKPASLTDVLSNSLILDHMAPYLSISGLLSLASTCRALR
FT                   SVVMETPYVFRHLDLSRCRGAQLQRSSADNGRAQALGNEPMDESLTEDEFYSAPLKKIF
FT                   AKLEHKSLLQDVRTLILDGLPVPADLIADILLNDRFNVNILSIRGCQHLNERKLMQVLQ
FT                   YAVRPTRPAGTPRVKGIYFFTPLNLAQAAARSRYRKWWSSRCAGQTPVEARPSSRQHDQ
FT                   GRETDRQNVWYSPSGKLLTASIEEGWAQTIQKCHGIIAFDAVLCRGPRHDPNAMLVGQD
FT                   GSQREGRLLGPAIATIALGSRGCDGCHSSPEGPAIWGQSPEETFPLLTPPPFHSSSVVA
FT                   AKRPSLFPGADHPALIARCADCLTDRWCHRCNKWFCADCLPNPQRVSSNLSPHQTALRA
FT                   SLGTNDSSQVCKLECSYSEPRR"
FT   CDS_pept        join(complement(1308694..1308928),
FT                   complement(1307935..1308610),complement(1307578..1307836))
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750021"
FT                   /orf_name="AFUA_4G04660"
FT                   /product="Proteasome regulatory particle subunit Rpt6,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="EAL84614.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000051FFBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J9"
FT                   /transl_table=1
FT                   /translation="MALDNYYRNKIESMKLEIIQGQAVLRRLEAQRNDYNSRVRLLREE
FT                   LGLLQQPGSYVGEVVKVMSTKKVLVKVHPEGKYVVDIADGVDITKLTVGKRVALLSDSY
FT                   KLEKMLPSSVDPLVSLMMVEKVPDSTYDMIGGLDQQIKEIKEVIELGLKHPELFESLGI
FT                   AQPKGVLLYGPPGTGKTLLARAVAHHTDCRFIRVSGSELVQKYIGEGSRMVRELFVMAR
FT                   EHAPSIIFMDEIDSIGSSRIDSAGSGDSEVQRTMLELLNQLDGFEPTKNIKIIMATNRL
FT                   DILDPALLRPGRIDRKIEFPPPSVEARADILRIHSRSMNLTRGINLTKIAEKMNGCSGA
FT                   ELKGVCTEAGMYALRERRVHVTQEDFDLATAKILNKHDDKEVAVSKLFK"
FT   CDS_pept        join(1309914..1310061,1310133..1311979,1312034..1312963,
FT                   1313017..1313180,1313244..1313508)
FT                   /codon_start=1
FT                   /gene_family="HOG000170275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260042"
FT                   /orf_name="AFUA_4G04670"
FT                   /product="Calcium permease family membrane transporter "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84615.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058591"
FT                   /db_xref="HOGENOM:HBG398302"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniParc:UPI000051F17F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J8"
FT                   /transl_table=1
FT                   /translation="MDNSQRVPDISRFSQAETTSRLSSTVSTGSTSSDTIRPTRPMANS
FT                   RRSYGTISSSDLADFDTLPNDGQADNSSRIPSSQSPSVAALPSDRPRKPSVTRRISSRR
FT                   QVPHKGQEFSTDDDVQEVEEDIAMQQQGSNPQPSPRLRPLRKQSSTLRRRLNARPSPLA
FT                   RADSDNDSGEESLLPESCMEAIGTRPPSQQSEASSHHGINHGDGDNDETSDAESFTLKD
FT                   RQQAINETHPFGIRLWKPALYKKSRSVEKTAEGDIHSSPGGRVGNILFLANLLWTAFFG
FT                   WWLALAALFGAIACFIFAYSPSAVEYGKVFWGLSWYLLYPFGSFVRLETDEHYAEEDEG
FT                   EGRSISEYEQWQNGDLEHGRLFFGPRSSRSLVGRRRNSIDSVSEQDSLLGRTQRISPRE
FT                   SNLHSKRRLFGRGEWTLGRVVFFVFFYFLIGPLMLFVSMVCWLLVFWIPMGRVTLILFD
FT                   HLRRHPLALSFHSDTSYTRLSPGSPSSILLCTYRAAGLSYWKYTVDGTNIFLINLLGVV
FT                   LFVIIDYFLLAETLGLHNWMTHPGFVFTLALVSIIPLAYFIGQAVASISAQSSMGLGAA
FT                   VNAFFSTVVEVYLYCVALTEGKGQLVEGSIIGSIFAGILFLPGLSMCFGAIRRKTQRFN
FT                   VKSAGVTSTMLMFAVIAAFGPTLFYQIYGSHELNCYSCAETTDSGIKDCRRCYFAQVPA
FT                   VDDNFFRKVVQPYSWFAALFLFLSYIIGLWFTLRTHAALIWATEVEEKKAAVLQQEQSA
FT                   YEPRHLLSPAGTANATSSNAKGSIRDSQLYKRILGQSLKQVGLSENANEDASHQPESSS
FT                   ARDKGAMPYIVPPRTEDEDGYSSFKGFRGYTGEENEDLVRQVTEVAATAAAVAARDVAR
FT                   TRKPSVQQGTARHSNKITGDLSKSVLEDQEDVGIEHTHASGGHDAPNWSKAKSSIILLV
FT                   ATILYAIIAEILVNTVDVVLESVDIDEKFLGITLFALVPNTTEFLNAISFAMNGNIALS
FT                   MEIGSAYALQVCLLQIPALVLFSALYSRILDPSDLLTHSFNLIFPQWDMVSVILCVFLL
FT                   SYVYGEGKSNYFKGSILVLTYLVVVIGFYLAGYSNVDTMGVDRFDTLALGPIRSENFHT
FT                   IGQPTRGMAF"
FT   CDS_pept        join(complement(1315708..1315956),
FT                   complement(1313942..1315597))
FT                   /codon_start=1
FT                   /gene_family="HOG000222136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206593"
FT                   /orf_name="AFUA_4G04680"
FT                   /product="FGGY-family carbohydrate kinase, putative "
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84616.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG252634"
FT                   /db_xref="HOGENOM:HBG294587"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000051F409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J7"
FT                   /transl_table=1
FT                   /translation="MPSGDIPPSMASLPYRSSRQPSRQSSRQASMDTRDDIQIHQDHYI
FT                   GIDVGTGSARACIIDAKGNIVGLASENIGLWQPQQGYYRAISQHNIDPTTIRGIGFDAT
FT                   CSLAVFSTVTDEPVSVTGPNFDSDRNVILWLDHRPVKETEKINATKHNLLRYVGGKMSI
FT                   EMEIPKVLWLKNNMPKELFDQCKFYDLADALTHIATGNEKRSFCSVVCKQGYVPVGVDG
FT                   SVKGWQEDFLTAIGLEDLMEDNFKRMGGVDGVVSLFFLSSNPETNDLFSAFLKADSFQN
FT                   GDYLSAGELVGTLCEKAASELGLPPGIAIGSGVIDAYAGWIGTVGAKVELEDEQLSSEV
FT                   AKNDKAQAFSRLAAVAGTSTCHIAMSPNPVFVPGVWGPYRDTIQPGYWMAEGGQSATGE
FT                   LLKYVIETHPAFNQAISIAESYNTNIYEYLNEHLKEMAQEQKAPSVSYLGRHVFFYGDL
FT                   WGNRSPIAEPNMKGSIIGMANDKTVDGLAIYYYATLEFIALQTRQIVETMNKAGHSITS
FT                   IFMSGSQCQNDVLVRLIASACDMPVLIPRYIHAAVCHGAAMLGAKAASADAEGKTEDLW
FT                   EIMDRMSKPGKKVVPTEDKNEKALLNVKYKVFLEQCYKQLEYRKLVDETVSSWKTGDT"
FT   CDS_pept        join(1317092..1317657,1317744..1317807)
FT                   /codon_start=1
FT                   /gene_family="HOG000170264" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260043"
FT                   /orf_name="AFUA_4G04690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84617.1"
FT                   /db_xref="HOGENOM:HBG054466"
FT                   /db_xref="HOGENOM:HBG327395"
FT                   /db_xref="UniParc:UPI000051EA5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J6"
FT                   /transl_table=1
FT                   /translation="MHFSQVILPFLSLFSSRAFAASPSSAQAQSADILYWPVASSQPSV
FT                   LARISYDPASLASDVVVYSPPRITDLEGGRNLEADAQDLVRVGLFTFTPNNPKHWVGSL
FT                   TSLSLLAENEDQKPTLRLHLGPSGEVYHVSLAASPPSAATSSSKGLNIELLSSEVGPRP
FT                   HLNRPVDVGPDGKSPEEVIEKTFFQKYWWVFLIITFLAMSGSAEGQ"
FT   CDS_pept        complement(1319287..1320123)
FT                   /codon_start=1
FT                   /gene_family="HOG000048675" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206594"
FT                   /orf_name="AFUA_4G04700"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84618.1"
FT                   /db_xref="HOGENOM:HBG054467"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000052043E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J5"
FT                   /transl_table=1
FT                   /translation="MLLNLPPELIQLVLQSSTTPSFLQVAFSCRTLYEIASSSREVILH
FT                   HLHKTPGLKVDTHSLKTRQLFQLLMKRSFQQLYGAQFSAKCTTFCFEHFALDARASSLA
FT                   SHGDRDIALALKGRQDVYVLQAKDGKLHLKAQLRSSEDQQGRIEVLKTAFDREGGVNVL
FT                   YRLVPAMDEDGFGATHPFVRHAIQSGPRVTVYMARHSLQTPNEPIRVCAFPDHAEYEPL
FT                   ALAAAGESTFAISWQHFRESDDYEVVLYNSPKQSSSNTPGVIGTLRFSAVLVHPVL"
FT   CDS_pept        join(complement(1321674..1322696),
FT                   complement(1321070..1321582),complement(1320830..1321030))
FT                   /codon_start=1
FT                   /gene_family="HOG000170253" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260044"
FT                   /orf_name="AFUA_4G04710"
FT                   /product="Protein tyrosine phosphatase (Pyp1), putative "
FT                   /EC_number="3.1.3.48"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="EAL84619.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG054468"
FT                   /db_xref="HOGENOM:HBG327383"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI000051EA4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J4"
FT                   /transl_table=1
FT                   /translation="MATYDNTLSGNLAPTTINTMSCEQCAELLETCGNDVLLLDVRPYA
FT                   HYARGHIKGSLNLCIPTTLLKRTSFDTRKLANTFTSDIDRRSFSRWKQCRYIIVYDAAT
FT                   LDMKDAVPMINMLNKFTAEGWNGEGSILRGGFKVFCNQFNALVQQPESSNPGISSNKPN
FT                   SMQISLPPFAPIAGGCALPESSSAAIPFFGNIRQHMDLMGGVGQIPLQLPQNLTDSKRR
FT                   LLPRWLRDASDVEDGGQKVSEKFLELEKKELDRMKQALSYEMTGVSTSAQAPSKKYRVA
FT                   GIEKGNKNRYNNIYPFDHSRVRLQDVPSGGCDYVNANYMKAEYSNKRYIATQAPVPETF
FT                   DDFWRVIWEQDVRIVVSLTAEIERGQVKCHRYWESGNYGPFRVNNFSERRIPMKASGSR
FT                   QNQGQSTTSLSDSSEEPSEPCIIVRHFGLSHSAFPFQPLREVTQLQYPYWPDFGTTSQP
FT                   SHLLQLVDECNAIIRATSNTCFDTRKAMPTEHRPVLVHCSAGCGRTGTFCTVDSTEPRE
FT                   ISERPDTGWIYNDNVDLIAKAVADFRTQRPSMIQNLSQFVLCYESVLEWMVVQMDEGCE
FT                   NP"
FT   CDS_pept        join(1325857..1326299,1326368..1327019,1327070..1328051,
FT                   1328105..1328847,1328917..1329243)
FT                   /codon_start=1
FT                   /gene_family="HOG000170229" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260045"
FT                   /orf_name="AFUA_4G04720"
FT                   /product="Nuclear pore protein (Nic96), putative "
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="EAL84620.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG054469"
FT                   /db_xref="HOGENOM:HBG327363"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniParc:UPI000051F189"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J3"
FT                   /transl_table=1
FT                   /translation="MSATNPSSLFGAGGLGTAAQPASSTSAANSTNIFGTPSTTQAASN
FT                   ASLFGNQPPTQQQPLQSSIFGHDQAQMSSGQSSRPSGQTTQPAFFNSLLERGKKRPIAS
FT                   VGQGSNFEELPSLQLGLDDIRRKARELGSRGLNDPLHPASTSKAHYLLAASGVSPGHAL
FT                   RDLKALDPQASIGLPPKEQEVFDPDNQKFLRSIQQRGRKVMIAESLARAQRDFDTFLEE
FT                   KMDLDWEDQRQKIFQHFGLAHKDGTVGDMRNSFGRSTRPSRLTSSLPSYEAAGVSRRSV
FT                   FGRSGLGKSVIGNPGTGRASHQLFEDPLERSDASGINSPDLRFLREKMGHYADKVQLLN
FT                   SARIQGRVFPLLHEFSEVERHAGGDVPCQLFDAYRALISIVKEPPNTTSPSDPSMVRER
FT                   QFSEDYLDETPNSRRTTNLKKRILEGSRSFLEKAFYSEIENMIVKNPREAQLGGIPTVI
FT                   NKIRAYIRLRAARKDLAPDGTELQMVGQDYCWILIFYLLRCGFITEAAEYVSQDPGFRS
FT                   LDHKFVTYMTTYAQSRRLPRDLQQKINGEYQQRSRNAPDNTVDPYRMACYKIIGRCDLA
FT                   RRRLEGINQSVEDWMWLQFSLAREDDRAEEIAGDVFGLEDIQTDIAEIGQRIFGKGQEA
FT                   SGGYGIFFLLQILGGMFEQAVSYLGSYAPVSAVHFAIALAYYGLLRVSDFYTSAEEILS
FT                   FTVKQYPQINFGHLITQYTREFRTGYVEAAIDYFCLLCLNADLPGSLGKSQASVCHEAL
FT                   REFVLETRDFAKLLGDIRSDGTRIKGLIEQRMSLIKLVDQEEFLKTITIQAAAIADDKG
FT                   LVTDAVLLYHLAEDYDRVIDIINRALSDAVALELGSPGMKLQPLRPRTDLQQHANDEHE
FT                   EAVEPGSSLSLTAVDDPVVLAKNMIGLYNTNALYYQRIRQINRDACGLLLRMMEAKGEV
FT                   EAGQWTPALDAINELNILPLRARGSVSFIRSAAQAFSSFPPIIARNVGHVIMWSITCIG
FT                   HERARLSSGVYENETRQGLADELLVMAKDLMIFSGMVKYKLPPRVYETLARAGADIGAY
FT                   "
FT   CDS_pept        1329892..1331760
FT                   /codon_start=1
FT                   /gene_family="HOG000170218" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260046"
FT                   /orf_name="AFUA_4G04730"
FT                   /product="Riboflavin-specific deaminase "
FT                   /EC_number="3.5.4.26"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /function="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="EAL84621.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0008835"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG054470"
FT                   /db_xref="HOGENOM:HBG327808"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="UniParc:UPI000051F18A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J2"
FT                   /transl_table=1
FT                   /translation="MDHDHSDASDSSSKRIQSDQETAVLHNTENVSQPILRLGPGLIGS
FT                   VEGEGHSSTAHHDTAAGSQPQHYHAGVRGLTGFGNTETGVAPQSDVVEQVNNNDVSISS
FT                   STNQDTSSSYSLIDNPPNLARIRQVMFECKEPIEISLEEFETYWPFIDNVWVKQRSNSS
FT                   KEGHCTTDYYMCRLRRPTHRTSETRPLPEGKRPRKKRVREGGMCNFQIKVVRFEGAYST
FT                   VTIARTPGSSHVHSHDLDYIDKVKRNSGLMEFARKEAVKGYLPSSIYTKFQEEPEKLIE
FT                   AGGKFCTVTDVRNVSAKWRIQNPEVKLVPHEGYTYQKGHGIVRARSTSDTSQPKTARKP
FT                   PSLTGPPPLPPDTLSFPQFPLEFLDSYLPRPGEKRELPHVTLSYASSMDSKISLLPGMQ
FT                   TVLSGPEAKLMTHYLRSRHDAILIGVGTVLADNPGLNCRLEGAGGFGGLGRMWQPRPVV
FT                   IDPTGRWPVHPECRMLRTAVEGKGKAPWVIVSPGAQIHPQKLMMLKGYGGDFLRIVEYN
FT                   QNWRLRWEAILRALASEGIKSVMIEGGGTVLSELLNPEYTEFIDSIIVTVAPTYLGRGG
FT                   VGVSPESKRDEQGKPNAALNPREIKWVPLGQNVIMCGKLRAAPSDS"
FT   CDS_pept        join(1332586..1333395,1333502..1334326)
FT                   /codon_start=1
FT                   /gene_family="HOG000170207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260047"
FT                   /orf_name="AFUA_4G04740"
FT                   /product="Ran exchange factor Prp20/Pim1, putative "
FT                   /protein_id="EAL84622.1"
FT                   /db_xref="HOGENOM:HBG352103"
FT                   /db_xref="HOGENOM:HBG593714"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000051EC90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J1"
FT                   /transl_table=1
FT                   /translation="MPPKKSASKAAAKPSTSTTKTTTTKKTTVAKTANKGQPAKTTAAS
FT                   QLKATSKKQSQATDASAKSRKSKATSASAAAATKKRKAEEVDKEPDVKTKKARVTQPPV
FT                   KKPKPKVVINHAPTTRLNVYVCGEGSSGELGLGTAKNAVDVKRPRLNPHLPADRVGVVQ
FT                   VAVGGMHCVALTYDNKILTWGVNDQGALGRDTTWEGGYKDIDDNKSDADSDSDSDDDSG
FT                   LNPYEATPTAISSDAFPPETVFVEVAAGDSSSFALTDDGQVYGWGTFRSNDGILGFDVG
FT                   HKVQPTPTLIPSLKKIKHLACGDNHVLALDEKGAVFSWGSGQQNQLGRRIIERNRLNGL
FT                   QPREFGLPKNIVHVSCGAFHSFAVDATGKVYAWGLNSFGETGIREGAGDDEAAIIHPTV
FT                   VDSLSGKNIVQLCGGAHHSLAVSKDGQCLVWGRLDGFQTGLKVDTLPDDAVVKDERGRP
FT                   RILIEPTPLPGIKASVVAAGSDHSIAIDVDGRAWSWGFSATYQTGQGTQDDIEVATVVE
FT                   NTAVRGKKLNWAGAGGQFSVFTEPATV"
FT   CDS_pept        join(complement(1335506..1335741),
FT                   complement(1335371..1335449),complement(1334809..1335306))
FT                   /codon_start=1
FT                   /gene_family="HOG000234964" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260048"
FT                   /gene_name="csm3"
FT                   /orf_name="AFUA_4G04745"
FT                   /product="Chromosome segregation in meiosis protein 3 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="replication fork protection "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27200.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0048478"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="UniParc:UPI0000F51AC0"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4DA84"
FT                   /transl_table=1
FT                   /translation="MENEGTLQDDRPASPKHAGDLFDYDFALDELWQETPNMPNNGAPM
FT                   QASARDESGLGLGLDEEVKVTKKRQPVAKLDESRLLSQPGIPKLRRTAKKKLRFKGKGH
FT                   EFSDAARLLNFYQLWLDDLFPRAKFADGLAIIERLGHSKRLQAMRKEWIDEEKPKDASE
FT                   NHNDVLKASESSGSQSDDPVVAFGGLNMADTKRSKGDIAGDYTSDAERMRVEVNLNPSG
FT                   QRKLDEGLFMTDNDDVAQQPDNLGAPDDDELDALLKEQELLLMNNASA"
FT   CDS_pept        join(1336681..1336828,1336879..1337081,1337154..1337237)
FT                   /codon_start=1
FT                   /gene_family="HOG000170196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902010"
FT                   /orf_name="AFUA_4G04750"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   putative"
FT                   /protein_id="EAL84623.1"
FT                   /db_xref="HOGENOM:HBG177444"
FT                   /db_xref="HOGENOM:HBG398231"
FT                   /db_xref="InterPro:IPR019721"
FT                   /db_xref="UniParc:UPI00005206A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J0"
FT                   /transl_table=1
FT                   /translation="MAAASPLAFWAMERVSPSHVGRGGFAPVMRLATAIGLIGGLHILY
FT                   QRSCNRFYGFTENAREVEMDMREMVDKVKKGEPLYGTSQVSSYLQGVAARNSRYSQLFI
FT                   HVLPWFNIVNHDQHGVDTAKYYQQAERELEAERLTTAGSH"
FT   CDS_pept        join(1338940..1339534,1339588..1340246,1340305..1340558,
FT                   1340615..1341013,1341126..1341278,1341335..1341431,
FT                   1341543..1341944,1341988..1342026,1342080..1342322,
FT                   1342381..1343605,1343672..1344217,1344273..1344744,
FT                   1344800..1345085,1345142..1345239,1345290..1345382,
FT                   1345434..1345595,1345661..1345761,1345834..1346006,
FT                   1346057..1346342,1346396..1346593,1346641..1346765,
FT                   1346826..1346908,1346961..1347083,1347147..1347234,
FT                   1347284..1347541,1347589..1347780)
FT                   /codon_start=1
FT                   /gene_family="HOG000170185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260049"
FT                   /orf_name="AFUA_4G04760"
FT                   /product="Inositol kinase kinase (UvsB), putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /protein_id="EAL84624.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054471"
FT                   /db_xref="HOGENOM:HBG324449"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0000F51AC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I9"
FT                   /transl_table=1
FT                   /translation="MATNESWVPYQFTTTNSVSRSAEPASSILAAQLAPHLVSQGNSAH
FT                   GYLTRETFSQLRQELVDGKCSQLGLDDSIADASKLICIVLQAGIEPCVKGDRSRQGDFE
FT                   GQILDCLDIIQTILEKSPQVLGEICDPTILGENTSISLYAWLTLRLLNLLSWEANNIGK
FT                   RITSIFSSIIRPHYKHTTLLPFCYSALALLRACTNEIFLSLESHHNLLRQHMSEVRLSI
FT                   PAVKSAIFLTLDNLNLPRALLSKKITLGTFPQTITLALRLLDSFVPKRAFHSHTSIKDP
FT                   TLHQDLAWILNGIERLWRITHRWARTSMDDIEIKSRICMQFTSSLHIYRSLEPDISGLL
FT                   SPQSGLARPWVQICNDLVTLSLIQMPHLQAELGRLLDELIDASQPRLEVVTQFRAALLP
FT                   TMIDFKSKGTIQSFEPGFQAVLQILMGPMSGAESRSLVNLQEPNTAGQTGQQDEMLQHG
FT                   TTHDIPRPQEGSARLDTAHKLISKIFELLGCGEPVNVECLSHAISESFVDLPDQKKSDL
FT                   LYMLGRVACAMAGSLSSPSKAAPEISLSCSVCETEKRALGPEPASKPRDVHELCEIFTF
FT                   ILPRLTRASSLRVTAMDALRRLLVHAPPESCYLQLKSSVFGDFCLHSLRSSIRELRIVT
FT                   GRLVISFVRKDINADTRRSNFVVILEWLRSLSEKQELPLHETCILTLCHIAEVSDDEEM
FT                   NIILLRLLEYLGHPNPFICAVAYAELSKLAQRLSVTPAGLFRPFWRTLSITVVKNFQSR
FT                   PHMAEQLCDLLGMNVDDFLRLTEVHILPYLVLTRKRDVITRVGAAYKHIKTPFDICSEK
FT                   NNLAAILAFLMSQPWSDPEGMIMSVLSDIDSAFGGRTLAELALVIREVRKAHGHFHRAL
FT                   HLLAALVPRKSTATSKKANLLCHFIEEHVLGIITQFAHAINDFQIRQPLIEKRRNILAI
FT                   GEMIKVARGHISSALPQICACLRSALSIEELSDHAFSAWSVLVSSLHEEELEPLIDQTF
FT                   SIVIRYWDAFNYQSKKTAEELIGYILRSHSGLVHTNFSTIPSLASIPALSALESEISKM
FT                   KEKMDVRSQLSAFGRRCQSENAAVVEQALRELLPCLSRHEEFLHESVLSEQPDPVVAQL
FT                   TRSLLDCCVKFNAGSDSITLLSAQCLGLVGCLDPNRVDPVKDKKDILVLSNFDRMEETF
FT                   DFVLFFLQHVLVQAFLSASNTRAQGFLAYAMQNLLRLCNLDSAVTQRSRDVQADEKYRR
FT                   WSELPETVRNTLTPFLTSKYTVTVGAIRSRCKFPIFSTELTHGDWLRSFVQDLLQRGSG
FT                   DNAQLIFSVCSRIVKGQDISIASFLLPFAVLNRIVGGTQEERLDLQSELTTILSHPLPE
FT                   ASNRVHEAIILCRQSVFEILDYLSRWLQGKKKLLHGLKNHASHTGRSHKDSHQDSLSET
FT                   YSSQVKAVETFLGSIPPEVISKRAVECKSFSRALFHWEQYIRRFKSQSDKNDHTSTELL
FT                   YQHLQVIYSQIDEPDGIEGISSHLHVLNIDQQVLQHRKAGRWVTAQSWYELQVEKEPDN
FT                   IDAQWNLLTCLRESGQQDAIIARVDTLNSAGSTSRFLPFAVEASWITGNWDKLRSYLQM
FT                   RSPENTGDFNIGVGSALCALRLGNKTEFRNIIHDLQLSVAKSLTVNSVTSLQSCHDSIL
FT                   KLHALTEMELISDCEGTENSSLTSIHDVLNRRLDVLGGYIADKQYLLGLRRATMELTHG
FT                   FMESDIAGSWLTSARLSRKGNYTNQAYHSMLRAARLKDRSATIEHARLLWKDGHHRKAI
FT                   QTLEGAIAANEFASDTSSSGGLKNEKQQNLIAARAHLLLAKWTDRAGQTQSDVIVQRYR
FT                   EAIKLHSRWEKAHYYLGKHYDKILESEKAKPLGKEAQIYLSGEASKLVIDNYLRSLAHG
FT                   NKYVFQSLPRILTLWLEHAATVDKPFDPKRGDNEEFQTHTLNQRKKTLDDMHSQLKKYL
FT                   NRMPAALVMVARICHPHATVYELLTRIVAKVANAFPQQGLWTVLAVVKSSSKDRASRGI
FT                   NCLHKITEANKKSRTEFPLDMRGMINQGQKFTEEMLKLCTARVEEKASRIHLARHLGFS
FT                   HKVAPCRLVVPFQAMLTPSLPASHETEYLKGFRAFPRDPTTIDAVLDDAQVLSSLQKPR
FT                   KISIRGSDGKIYNVLCKPKDDLRKDQRLMEFNNTINRFLKKDVESSKRRMYIKTYAVTP
FT                   LNEECGLIEWVDNLRTLREIIIKLLKERGIMPNYNEIRHYLNEACSEASKLHLFTTKVL
FT                   MKFPPVLHEWFVEMFPETGAWFAARLRYTRSCAVMSMVGYVLGLGDRHGENILFEEGTG
FT                   GVIHVDFNCLFDKGLTFEKPELVPFRLTQNMIDAFGAYGYNGLFPKSLKDEAFAQLLFT
FT                   GPFRRTCEISLRLLRQNEDALMTVLETFLHDPTTDFIGKKRRTHANVPETPAGVLENVR
FT                   NKLRGLLPGESVPLSVDGHVDELITQATDKRNLAAMYIGWCAFF"
FT   CDS_pept        join(complement(1350327..1351859),
FT                   complement(1349532..1350278))
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260050"
FT                   /orf_name="AFUA_4G04800"
FT                   /product="AAA family ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="EAL84628.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000051FD84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I5"
FT                   /transl_table=1
FT                   /translation="MSDARLFTVRPSKQARSDHKDAFRIYLSSSSLAALKLRAGDICSV
FT                   NTPDGSPKTAVAWTAAESIQSTVVQTSRTFQDCYEITVGEKIFISRAEGLLEGIDRVYI
FT                   TECSDVDRLTRYGGPIPPKEKDHWAFALRFPLSRCELVAVGLTFDVELIGQRRSFKVAN
FT                   IKTATRNPANTLFRFADSSEIRIDDEIDGVPEEAPSAIQVKPSGLGGLSRQIDSINESL
FT                   ADFSLGQKFRMPSFYEHSRGILLYGPKGTGKSALLHQIQAAGWKKTFSLGSSMFSRNIS
FT                   DSETKVRNVFQEAVRCQPSAIIIDQLDFIAPKRASLDSQSLTSVLCECLDMAKSALVLV
FT                   VAATRHPNDVDDALRTPHRLAIEIEMQVPTAQDRAEILRAICGSSTRQLSEELIETIAE
FT                   KTHGYVGADLFALLQLVCRKARQRQLCQSHSPTRLCDVTSSPDLVAGVEHIEENMVVDL
FT                   DIEESDVMSALQETRPTAMREVFLETPKVRWTDIGGQHDIKKRLQKAVERPLKFPERMK
FT                   RLNVKSKKGILLYGPPGCSKTLMVKALATEAGLNFLAVKGAEILSMYVGESERALREIF
FT                   RKARSARPSIIFFDEIDAIASRRNSSHGGVNVLTTLLNEMDGIEELKNVLVIAATNKPD
FT                   VIDPALMRPGRLDNILYIGLPDFDARKEILNIWFRKSVVHPEVDLEELAELTHGYSGAE
FT                   IVSICETAGDAALDEEEETGQEQDVRWEHFKYALEQVQRQITDAVREEYERWGKSVKSE
FT                   CHASIK"
FT   CDS_pept        join(complement(1353437..1353466),
FT                   complement(1353105..1353372),complement(1352722..1353044))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206595"
FT                   /orf_name="AFUA_4G04810"
FT                   /product="Rab GTPase SrgA, putative "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL84629.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000051E81B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I4"
FT                   /transl_table=1
FT                   /translation="MAGTRNYDFLIKLLLIGDSGVGKSCCLLRFSEDSFTPSFITTIGI
FT                   DFKIRTIELDGKRVKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDERSFQNIRTW
FT                   FSNVEQHASEGVHKILIGNKCDWEEKRAVSTEQGQQLADELGIPFLEVSAKNNINIEKA
FT                   FYSLASAIKKGMDTSKSEQVGSQGVNIDHHGSGTSGSTGGKCC"
FT   CDS_pept        join(1357887..1357888,1357947..1358193,1358247..1358332,
FT                   1358389..1358944)
FT                   /codon_start=1
FT                   /gene_family="HOG000162289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902011"
FT                   /orf_name="AFUA_4G04820"
FT                   /product="C-4 methyl sterol oxidase Erg25, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84630.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG069422"
FT                   /db_xref="HOGENOM:HBG325679"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0000520925"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I3"
FT                   /transl_table=1
FT                   /translation="MNSTLYSTSPGTYWEQYEEVSQHSAHLNVVERLWSAWYAWMQNDV
FT                   LATGIMSFVMHEIVYFGRSVPWILIDTLGLFKNYKIQNNKIPSLREQWDCAKFVLLSHF
FT                   TVELPQIWLFHPMAQFFGLSTSVPFPSVWTMMYQIAIFFVLEDTWHYFSHRALHWGPLY
FT                   KAIHKIHHQYSAPFGMAAEYASPIEVMILGFGTVGCPILWCALTGDLHIFTMYVWIVLR
FT                   LFQAIDAHSGYEFPWSLHHFLPFWAGADHHDLHHEKFVGNYSSSFRWWDYLLDTEYTPE
FT                   ALKRRREGKLTKKAQ"
FT   mobile_element  1362504..1364726
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   gap             1369521..1451420
FT                   /estimated_length="81900"
FT   mobile_element  1456706..1459036
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1461842..1462291
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(1468526..1469095)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(1471559..1472281)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(1472636..1474015)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(1476084..1476686)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1477996..1479126
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1479865..1480314
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(1482794..1483326,1483381..1484011)
FT                   /codon_start=1
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206596"
FT                   /gene_name="mri1"
FT                   /orf_name="AFUA_4G05830"
FT                   /product="Methylthioribose-1-phosphate isomerase "
FT                   /EC_number="5.3.1.23"
FT                   /function="S-methyl-5-thioribose-1-phosphate isomerase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90203.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046523"
FT                   /db_xref="HOGENOM:HBG054293"
FT                   /db_xref="HOGENOM:HBG682649"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniParc:UPI000051F792"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNI1"
FT                   /transl_table=1
FT                   /translation="MASILQAIRYSHGKLAIIDQLQLPYVEKFITIRTSEDAWHAIKEM
FT                   RVRGAPAIAIVAALALASELNTLIIHDKLSSRAEEVKLFIREKLDYLVSSRPTAVNLSD
FT                   AARKLESTISGHADTPGATGRTVAEAFIRAAEEMMTKDLDDNMKIGQNGAEWIIKHALA
FT                   RHKSTATVLTHCNTGSLATSGYGTALGVIRSLASKKALEHAYCTETRPYNQGSRLTAFE
FT                   LVHDRLPATLITDSMVAALLASTKAEVDAIVVGADRVAANGDTANKIGTYGLAVLAKYH
FT                   GVKFLVAAPLTTIDLGTKSGEDIVIEERPSAEVTKIRGPVDGDHPADIVKLETVHIAAK
FT                   GIDVWNPAFDVTPSTLIDGIITEVGVIEKEADGQFHLERLFIDNSAS"
FT   CDS_pept        join(complement(1486970..1490036),
FT                   complement(1486571..1486914))
FT                   /codon_start=1
FT                   /gene_family="HOG000187531" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055336"
FT                   /orf_name="AFUA_4G05840"
FT                   /product="Nuclear pore complex subunit Nup133, putative "
FT                   /protein_id="EAL90202.1"
FT                   /db_xref="HOGENOM:HBG054291"
FT                   /db_xref="HOGENOM:HBG324392"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="UniParc:UPI000051E902"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI2"
FT                   /transl_table=1
FT                   /translation="MPYTGRIIYWETISHAGSLGLPRQKQSGLQGHVPGLLPSEYVTDV
FT                   INCEPSGVIVTFSSGRVAHITFRDSQGRPTVMANFLRNSSSSSGLLNGIKSVFSGGCWR
FT                   KDVAAVKAARSHQRGQRDIIVGTTTGVFEIWDTHWSNGSIMKKQFDIRQDLCRSLGRKH
FT                   TEVASDTDLKILDFALLSCGDNAQDLQHSGAESWRLCLVVAPSRETGRRCISVVQLLLS
FT                   EEVHVLAASSIDLSFSTLSNAPQPNIKLHVATVSQTAFIVIDQSVLLLSLGSYGDSPTS
FT                   QLLLDSGRLPSPFNDHITFRSGADYKLLGSGCEDETGEGSSSACLVMVRNFGVIRIAVR
FT                   PRQSAGNEIEDAQITAKTKIEQAVFYGARPGNPLDLTDKGGFDFSPQEIEEAALEICGE
FT                   LLRSTSHYIPATSVTLEQNLKLRAKALDDLASLLLQHKKPLHRQTWYELLWGAEKLAAQ
FT                   RALWKSEDKARRAMGQGNTFLAHVIGSMNEKFKTKSEDYEDKDNVRDWFLFDTFRMEHI
FT                   IPWIFKALKLQKGISTKQGRRVLEEIVQASELSLAVLETAFRFRDEHARQYGLEDEHIE
FT                   DGVLSSGYDGLSEFWTSRDIVFLETGHLLDLELDTCRAWTQQATTSLDLREQKLVRQIA
FT                   ENSARQLRVLSLMHYERVRWLSSQDNPKSVDEGIELEQTYTKQRRWQLFKLAGIGQLED
FT                   AISLAEKFRDMSALVELIIELQDQTLADSEHAENVTNYESEQLGRRISTYFEKFGEPWA
FT                   DAFFTRQISMGQSEILFTMRRFQPFINRFLHKNPTYARLCWINDAIGEDNYEAAARSLE
FT                   TLALERESDLWCHRVELSLSKLATLAAWEESSAAAKPIFGNEIKRLEDLAELDAVQEVV
FT                   YAYMMPALQGAIDQKAETELAIDQFGRFVNDTPSLHEVLSALLTKVISRQILRVDQLVD
FT                   LLTLIDGGQVSEETQNEFIGKEFYLALRVIRLNSSTQEGPLYCIPLQKLVWRRCMIRDD
FT                   WQLEKNADNTDHEPGDHMHCVSLLRTLTLCLRDKHCADADPCPLYVPSSPLDVVLNESD
FT                   LDFILSSYPQEQRNRICRDLSKENDILLQRIEEGKLEFWYRKLLISAEEAVSSSASHST
FT                   GALVQFSDGLQAHHSETGSPSTRAQLSWL"
FT   CDS_pept        join(1491975..1492365,1492477..1493000)
FT                   /codon_start=1
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260051"
FT                   /orf_name="AFUA_4G05850"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase,
FT                   putative"
FT                   /EC_number="2.3.1.39"
FT                   /function="[acyl-carrier-protein] S-malonyltransferase
FT                   activity"
FT                   /protein_id="EAL90201.1"
FT                   /db_xref="GO:0004314"
FT                   /db_xref="HOGENOM:HBG054290"
FT                   /db_xref="HOGENOM:HBG687898"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000051F2A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI3"
FT                   /transl_table=1
FT                   /translation="MANSWVDNFPGTARPFLDEMDDTLGFNLSRTIANGPNCELNKTEN
FT                   SQPAIMATSILILRILEKEFGFDTKSRVNVTLGHSLGEFSALVAGGYLKFRDALRLVRR
FT                   RAEIMAECTRQASKQSGEDYGMVALIFMIANINSKNQIVLSGSIHRITTLLIQLRQFGG
FT                   HDPRAVRLKSESPFHNPIMAPAAGYMRHELEHIDIEFPSQLPCISNVSGLPFESRDDLK
FT                   NLLSRQCVETVKWWDSIRYLDQDRGVKRWIGIGPGKVGRNLVGKEVGKINTKGGGVWAL
FT                   SDPRELENVLMALQNTEIDVLTQ"
FT   CDS_pept        join(complement(1494431..1494475),
FT                   complement(1494024..1494383))
FT                   /codon_start=1
FT                   /gene_family="HOG000234633" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260052"
FT                   /orf_name="AFUA_4G05855"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EBA27399.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0000F51C11"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N8"
FT                   /transl_table=1
FT                   /translation="MSGPRIACICVIGKADNPLHISMFPPYQDSIVNFSFYLNACLDIF
FT                   EIRQKKTSVGQDLGLLHAIDERLAAYGWLTTTGVKFLIVVDTIGQPTHVGAESLGIGAM
FT                   ATLRESDLKPARFYHFSLQRSRGLQGSRKH"
FT   CDS_pept        join(1495270..1495312,1495376..1495553,1495621..1495976,
FT                   1496048..1496142)
FT                   /codon_start=1
FT                   /gene_family="HOG000228249" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902012"
FT                   /orf_name="AFUA_4G05860"
FT                   /product="NADH-ubiquinone oxidoreductase subunit B,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="iron ion binding"
FT                   /function="quinone binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis, light reaction "
FT                   /protein_id="EAL90200.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0019684"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054289"
FT                   /db_xref="HOGENOM:HBG553221"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="InterPro:IPR014406"
FT                   /db_xref="UniParc:UPI000051F526"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI4"
FT                   /transl_table=1
FT                   /translation="MLSTSRRAVLGALRVPFPFRAQQLALLSTSPVKSATALEHQAQSG
FT                   QPLTASGKVRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFGLACCAVEMM
FT                   HLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSC
FT                   ANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMRHTRITRMWYR
FT                   R"
FT   CDS_pept        join(complement(1497539..1497593),
FT                   complement(1497050..1497488),complement(1496690..1496934),
FT                   complement(1496450..1496637))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260053"
FT                   /orf_name="AFUA_4G05870"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL90199.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054288"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000052055F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI5"
FT                   /transl_table=1
FT                   /translation="MQEYTEKPASGAESQFQPGHRIPIQHQKKPGLQAELEDPKPASTR
FT                   IPTDDYGYQTYKAAGKLAGKRAIITGGDSGIGRAVAILFAMEGASSLIVYLPEEEIDAQ
FT                   ETKRRVQETGKECHCLAVDIRKRENCQKVVDVALRCLGGIDILVNNAAFQNMVQDISEL
FT                   DEDQWHRTFDTNIHPYYYLSKYSLPHMRSGATIINCSSVNHYIGRGDLLDYTSTKGAII
FT                   AFTRGLSNQQIGKGIRVNCVCPGPIWTPLIPSTMDTSAMEQFSSVPMGRPGQPSEVATC
FT                   FVFLASHDSSYISGQSLHPNGGVMVNG"
FT   CDS_pept        1498728..1500881
FT                   /codon_start=1
FT                   /gene_family="HOG000187542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902013"
FT                   /orf_name="AFUA_4G05880"
FT                   /product="U3 small nucleolar ribonucleoprotein protein
FT                   Mpp10"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL90198.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG054287"
FT                   /db_xref="HOGENOM:HBG324389"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniParc:UPI0000520575"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI6"
FT                   /transl_table=1
FT                   /translation="MDQTVMQDQSETIIQCPASRSTRDGYNMPIESALSTPWVFLSPTT
FT                   SLHANTVDCAKYFLDSLALSVSNAQLARQRVMRKRKRSDYEQETLHHVLQLKELFVQGF
FT                   TSDQIWEQATRILDSAKQEIEQDSALIAQHVEPAFLDARASPFLSQEANSEDISNFSDI
FT                   SDSAADRSDRDSASDDEREDMGSVPESPSMAEGRSDGDSRTDVEESDNDNHNSRGTYVQ
FT                   DPFGLNDGFFSIDEFNKQSEFLERQDAKGEIDDDLESDEEEIDWHVDPLAGGVSVPSQT
FT                   TRPTAQRSKRSFENGSESSSDEEGPTFDNVAIENDIDSEDDDAYAISADTTNWMNTSDI
FT                   KYSDFFEPPPRRATSTKTRPLPKTQPHGAPVETDIDRAIADVRRDLLEDDESLDGNDSS
FT                   DNELAGSKQQHSAHEKQRARIADEIRRLEAANVAKKDWMLAGEARGAERPMNSLIEEDL
FT                   DFERVGKPVPVVTTELSGYIEELVKRRILAKEFDEVIRRRPGIPEAQTAKKVRFELEDT
FT                   KPQQSLAELFESDHLRATDPNYVDPKNHKLLREHTEISNLWREISDRLDTLSNWHYRPK
FT                   APQANINVITDVPTIMMEDAQPAASSAVGGSATLAPQEIYAPGDNGKVAGEVTLKSGES
FT                   IAKDEMTRDEKSKLRRRQKKQRKSDSDPAKQQSGKAAEKQQIVSTLKKGGVKVIGREGH
FT                   LTDVYGARDREGIAKTGADILKL"
FT   CDS_pept        join(complement(1501614..1501891),
FT                   complement(1501042..1501534))
FT                   /codon_start=1
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206597"
FT                   /orf_name="AFUA_4G05890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90197.1"
FT                   /db_xref="HOGENOM:HBG054286"
FT                   /db_xref="HOGENOM:HBG324388"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000052056D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI7"
FT                   /transl_table=1
FT                   /translation="MGAKILPMEATIPDKPSSPNLVAAFDVSEHLVPVRELKPAGNTLV
FT                   SFDGLLEEPLILKEDLKEGCGGQLWPAGIVLAKYLLRQHRNNLSNKTIVELGAGGGLVG
FT                   LAVARGCDVGPCPIYITDQEPMLHLMKTNIELNNLSTAVAATVLNWGERLPDCIPTHPE
FT                   IVLAADCVYFEPAFPLLISTLQDLLGPESVCYFCFKRRRRADLRFMKAAKRVFDIKEVR
FT                   DDPEADTYRRENIFLYSLRLRFRPENGSLRAIKE"
FT   CDS_pept        join(1503158..1503173,1503241..1503545,1503611..1503745)
FT                   /codon_start=1
FT                   /gene_family="HOG000187564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260054"
FT                   /orf_name="AFUA_4G05900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90196.2"
FT                   /db_xref="HOGENOM:HBG054285"
FT                   /db_xref="HOGENOM:HBG324387"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniParc:UPI0000F51BFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI8"
FT                   /transl_table=1
FT                   /translation="MTTLHYLPPVKPSAIAMGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLVGSAVQTYGVAALINATGTLSYKGAAYLGSLIFMASS
FT                   APSFISQIFTEKRPLDTVAVGAVSRVFETVGLSLFLTWWGTRTNPFD"
FT   CDS_pept        join(complement(1505044..1505103),
FT                   complement(1504489..1504970),complement(1504414..1504438))
FT                   /codon_start=1
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260055"
FT                   /orf_name="AFUA_4G05910"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27398.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324386"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI0000F51C1B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N7"
FT                   /transl_table=1
FT                   /translation="MTRDVLKAAKSASNAIAVHKSTGIWERLRRLLAIDPNRSTGVPLN
FT                   SQYRLPTPGALPPQSYDDPVTVPAADIADNPYWKRDVRRNYPRLSIVNQADAVGLLTVG
FT                   SRAAPKDDVLQTGQAGEQQLVEVKQQGEERGLAAIFEKDKRGIQGVLGADGLPPTPCNL
FT                   NASAAKYQLGQGQGYPAVYPCRTFV"
FT   CDS_pept        join(complement(1506254..1506560),
FT                   complement(1505739..1506076))
FT                   /codon_start=1
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260056"
FT                   /orf_name="AFUA_4G05915"
FT                   /product="Disrupter of telomere silencing protein Dot5,
FT                   putative"
FT                   /EC_number="1.11.1.15"
FT                   /function="peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27397.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000F51C1C"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N6"
FT                   /transl_table=1
FT                   /translation="MVELRKRKAPSQNPATKNKSKRLKETASEETSPTLVQSSKEDERS
FT                   THVSHKKPPTVGDTIDLDNFGGEVELNDGTKTTLKHLVDTSKSGIVLFTYPRASTPGCT
FT                   KQACLFRDKYDYITSTGLSIYGLSADSIKANSSFKAKQSLPYPLLCDTASTLISSLGFK
FT                   KTPRGTTRGVFAVDKQGKVLLLQPGGPDATVDAVQQLISACNIETHGQIKE"
FT   CDS_pept        join(1507492..1507644,1507718..1508137)
FT                   /codon_start=1
FT                   /gene_family="HOG000187596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902014"
FT                   /orf_name="AFUA_4G05920"
FT                   /product="Mitochondrial protein sorting (Msf1), putative "
FT                   /protein_id="EAL90194.1"
FT                   /db_xref="HOGENOM:HBG054283"
FT                   /db_xref="HOGENOM:HBG602019"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI000051F03E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ0"
FT                   /transl_table=1
FT                   /translation="MKVFSSTCTFDYSWEEVSTANWRKYCPWNDKSTHVVAVDTISRTV
FT                   DPKTGILRTERLITCDQSVPQWVLSLFGGSATSHVYEISYVDPGAKKVTMCSTNLTWSN
FT                   VLNVRETVIYQPSSSKPELVTDFSQEAKITALCGGWQKIKNKVEEASIERFSQNAKRGR
FT                   EGFETVLEMSRRVFGEQREFENKKLQS"
FT   CDS_pept        join(complement(1509472..1509515),
FT                   complement(1508653..1509412))
FT                   /codon_start=1
FT                   /gene_family="HOG000187597" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260057"
FT                   /orf_name="AFUA_4G05930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90193.2"
FT                   /db_xref="HOGENOM:HBG054282"
FT                   /db_xref="HOGENOM:HBG324385"
FT                   /db_xref="UniParc:UPI0000F51BCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ1"
FT                   /transl_table=1
FT                   /translation="MATKRISTLDYLRKAHEGRIYWFNTVHFSRADISRIPYFDPRKLS
FT                   RRAINYLLLGISLPPILDVNSSPSEYLRALNALLIEFEAFQQVHPPDGSSSSTLARARI
FT                   PQMFKRAAHAGTKGRRASSATEIGLPMQSSDPSDLKSMTGNITSSTTAAAAVVSFPTSE
FT                   ASELLPGEEYSYLLTPSLPFEPDYFETFATLCDVLIDCYTRLTALVSTPSVCTVALGEM
FT                   FSKADAKLRKIMVTGVVREFEDASRTSAKNEIAGVSRVVLGGLLG"
FT   CDS_pept        join(1510559..1510682,1510752..1510869,1510936..1511710,
FT                   1511764..1512096)
FT                   /codon_start=1
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260058"
FT                   /orf_name="AFUA_4G05940"
FT                   /product="Phosphoethanolamine"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL90192.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG054280"
FT                   /db_xref="HOGENOM:HBG378440"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00005200D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ2"
FT                   /transl_table=1
FT                   /translation="MSVSPGDFVPAPGQWPVDPQDDVPIREDRIWVDGCFDFSHHGHAG
FT                   AMLQARRLGNELYVGVHSDEAILENKGPTVMTLKERVAAVEACRWATRCIPRAPYVTSL
FT                   SWVSHYGCKYVVHGDDITSDSNGEDCYRFVKAAGRFRVVKRTPGISTTDLVGRMLLCTK
FT                   GHFIKSVKDTLAGVEGSDNQEERKQFGVELMQRIRDYATDESGLRPGPQVWTWTGSRPA
FT                   KVSDTVEEAGTFETLVNGKAIKPGQRVVYVDGGFDLFSSGHIEFLRQVLELEELEGRQR
FT                   GWYDSEQVEKRLHEFGEDYSPAYVVAGIHDDDVINHWKGFNYPIMNIFERGLCVLQCRY
FT                   IHAVIFSAPFSPSQPYLEAMPFGVPDVVYHGPTTFIPLTYDPYTAPKRMGIFRQINDHP
FT                   FQHVNAGEIVDRILRSREAYEERQRAKLQKAIIEEQVKSEEKSLAGELGA"
FT   CDS_pept        join(complement(1513062..1513091),
FT                   complement(1512708..1512987),complement(1512460..1512611))
FT                   /codon_start=1
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260059"
FT                   /orf_name="AFUA_4G05950"
FT                   /product="Glutaredoxin Grx5, putative "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="EAL90191.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG054279"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51BCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ3"
FT                   /transl_table=1
FT                   /translation="MMFQRQAFAPAFRPFSRSPLVLTPRFTAFQLPHALHARFLSEQTR
FT                   SAIDKAIASAPVVLFMKGTPETPQCGFSRASIQILGLQGVDPKKFVAFNVLEDPELRQG
FT                   IKEYSDWPTIPQLYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVAAD"
FT   CDS_pept        join(1513491..1513974,1514032..1514279)
FT                   /codon_start=1
FT                   /gene_family="HOG000187629" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260060"
FT                   /orf_name="AFUA_4G05960"
FT                   /product="Flavoprotein, putative"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL90190.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG054278"
FT                   /db_xref="HOGENOM:HBG523890"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniParc:UPI0000F51BD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ4"
FT                   /transl_table=1
FT                   /translation="MEGMGTLSAEEQFKDKKIHILLAASGSVAAIKLPNIAEALGRHKN
FT                   VCIRIIVTKSAEKFLSGQSSEQPLLNALEQLPGVDAIYRDEDEWKDPWTRGEPILHIEL
FT                   RKWAHVLLVAPLSANTLAKMTMGIADNLLLSVIRAWDTTGKVDSGLKDRKPVVFVAPAM
FT                   NTAMWNHPATKRQLKILTDEWGVSRTNEEGWVTVLHPIEKSLACGDTGNGAMMDWKDIV
FT                   NVVEHHLGISSVKIKDIRCGT"
FT   CDS_pept        complement(1514323..1515582)
FT                   /codon_start=1
FT                   /gene_family="HOG000003697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902015"
FT                   /orf_name="AFUA_4G05970"
FT                   /product="Para-hydroxybenzoate-polyprenyltransferase Coq2,
FT                   putative"
FT                   /EC_number="2.5.1.-"
FT                   /function="prenyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90189.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054277"
FT                   /db_xref="HOGENOM:HBG324383"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="UniParc:UPI0000520556"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ5"
FT                   /transl_table=1
FT                   /translation="MRLQFSYLPPVRLDQLSRRYGSGSSLLNDKRHRLLCNRNSLTTSS
FT                   RVNSTGRQSAYTAKPRSAITKRTSLMRCQPHSSQSPSSTDRPAAITDNNPATHYIPPQK
FT                   GFIASLPGSWIPYAELIRLDKPTGTYYLFFPCVFSTLIAAPMASATPMQILGTTGLFFT
FT                   GALIMRGAGCAINDLWDRNLDPYVERTKFRPIARGALSPKKALVFTCSQLLAGLAVLLQ
FT                   FPSQCLWYGIPSLLLVTTYPLAKRVTYYPQAVLGLTFSWGAIMGFPALGVDLFSNHAAL
FT                   EAAAALYSSCVAWTVLYDMIYAHMDIKDDVAAGIKSIALRHEHNTKTVLSGLAAVQVAL
FT                   LATAGVAAGAGPLFYVGTCGSAAVSLGIMIWKVQLKNVKNCWWWFKNGCLLTGGGITLG
FT                   MFFEYIAQTTGLYKSDNNLH"
FT   CDS_pept        join(1516535..1516802,1516876..1518875)
FT                   /codon_start=1
FT                   /gene_family="HOG000187630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260061"
FT                   /orf_name="AFUA_4G05980"
FT                   /product="JmjC domain protein, putative "
FT                   /protein_id="EAL90188.2"
FT                   /db_xref="HOGENOM:HBG054276"
FT                   /db_xref="HOGENOM:HBG324382"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR018866"
FT                   /db_xref="UniParc:UPI0000F51BB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ6"
FT                   /transl_table=1
FT                   /translation="MPAQRPRAAFEPIPPDLDVAALVESTPNFEYVVRIHCNSIDEHGL
FT                   DNFDKLVRLHVILGGKPLVIEGFHERLDRSVFSERWLRSHHSSRKEIARNLTTKSNLPL
FT                   SIGHYLKNMPMLTNQWNSFNYKNSDKQRIYLKDIDCPQTWHDHLKNLIPPPLFYLNKHP
FT                   EAFQGPGGESVTATEKHQTHAEPRNKVGKPGDLMSCLPASMRAENLMCYIGHEGTYTPA
FT                   HYEMCASLGQNIMVEASDGSVEYGMKTIPGSSIWFMTESKDRRVVSEYWQSTLGHDINI
FT                   EDHFAQINAWKSAPFRTYIVEQRPGDFILIPPLAAHQVWNRGTRTMKVAWNRTTVETLS
FT                   LALSEALPQARTVCRDEQYKNKAIVFYSLEHYSKLLGDIDGKSMDSKQQLLLKDFEHLF
FT                   ALYTQILLSESFSQDEAEEKDIEYIPFDSNITCSYCRCNIFNRFLTCPWCAGGQTADGE
FT                   DPYDICMECYVMGRSCACLSRLKWAEQFPWSELTGNYENWRDQICRLNQGNPNGQIFRP
FT                   LAEERARYGKKTLAEMCQGELKRRPWVDITKPVTRKIEDNLSDPESPARKRRKTRLSHE
FT                   SEKGGRCHICKYIEPKWKLASCDYCNQNYCYGSLFRAFNIQPHETMEVYRWMCPKCQKV
FT                   CSCAACRRDPSMKPFEPTCTLLGHDTRKIADPRSVESLVDFRQSNLRWLKKAGDNEIER
FT                   LKKHQKEADEKRQQAMIEYSIQLEDSPRVSAHATKYGDIPVDPVLEELSGSILTPPDSF
FT                   TP"
FT   CDS_pept        join(complement(1519896..1519983),
FT                   complement(1519722..1519843))
FT                   /codon_start=1
FT                   /gene_family="HOG000187641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260062"
FT                   /orf_name="AFUA_4G05985"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27396.1"
FT                   /db_xref="UniParc:UPI0000F51C03"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N5"
FT                   /transl_table=1
FT                   /translation="MSTTRLRKAFRYPDDSGDDEQGREELDEEEQDVVIRQLQAENDQR
FT                   NSEYTVKTPLSSLTLLSTETRAKP"
FT   CDS_pept        join(1520266..1520733,1520797..1520889)
FT                   /codon_start=1
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206598"
FT                   /orf_name="AFUA_4G05990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90187.1"
FT                   /db_xref="HOGENOM:HBG054275"
FT                   /db_xref="HOGENOM:HBG324380"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI000051E6CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ7"
FT                   /transl_table=1
FT                   /translation="MALYTAQRRIGVPRAFLFRRHNMPPHRCLIPAPKANSGPLMERRA
FT                   DRELPSINTEKRRWIKTLPIFVVVVGAAMLGIFNYQKSSSSVVSSTLYALRTSPRAREI
FT                   LGDEIYFAQKIPWISGEMNQLHGRIDISFWVKGTKGQGKMRFRSIRPDRMSFFRTEEWS
FT                   LETEDGQVVQLLDHDSDPFSQSN"
FT   CDS_pept        join(complement(1521306..1522161),
FT                   complement(1521143..1521240))
FT                   /codon_start=1
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206599"
FT                   /orf_name="AFUA_4G06000"
FT                   /product="50S ribosomal protein L3 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL90186.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG054274"
FT                   /db_xref="HOGENOM:HBG734653"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI0000F51C2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ8"
FT                   /transl_table=1
FT                   /translation="MLQGRDCFEYHSIIGQTILTMSPRLSRKLTQLPTLFLGLPSLTIT
FT                   GNVSVRSFGIKSLNPPKPSRFNIGPELPVLKSTSTAALERKANTLPLRTGAIAIKKGMT
FT                   AVYDAETGKRIACTVLQLDRVQVVSHKTRQTHGYNAVQVGAGWKHPSNVTKSLLGHFST
FT                   NGVSPKRHVYEFRVKDESGLLPVGQTINADWFQEGQYVDARSYSKGKGFAGVMKRHGFH
FT                   GQDRSHGVSLTHRSLGSAGPSQGGGSRVYPGKKMAGNMGNEQNTVQNLKVLKVDADNGI
FT                   VVVNGSVSGPKGCVVRIQDAIKKPWPEIAHVSKTAA"
FT   CDS_pept        join(1522634..1523243,1523324..1523475)
FT                   /codon_start=1
FT                   /gene_family="HOG000187663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260063"
FT                   /orf_name="AFUA_4G06010"
FT                   /product="Peptide alpha-N-acetyltransferase Nat2, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL90185.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG054273"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI00005200C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ9"
FT                   /transl_table=1
FT                   /translation="MSLKFITTPRWFSHLIGQAGHAPSLSFVRKNVTSSQGLFTPNIVA
FT                   SFPSRRAFASSPAWKSNPQYRFFPRQSGSTTTFTYNPPSTLQRSIFRRFNSSRANQSAR
FT                   PAESGSLSQRLKKLSREYGWAALGVYLLLSAMDFPFCFIAVRHLGAERIGHYEHVVVET
FT                   VKGLFGAKSAPEEQSQEEVSAPRPVQQTTEAQKKNNGDGPSLWTQLALAYAVHKSLIFI
FT                   RVPLTAAITPKVVKVLRVWGWDLAKRRPRGM"
FT   CDS_pept        join(complement(1527420..1527469),
FT                   complement(1527300..1527363),complement(1527106..1527246),
FT                   complement(1526994..1527041),complement(1524597..1526835),
FT                   complement(1524365..1524534),complement(1524035..1524250))
FT                   /codon_start=1
FT                   /gene_family="HOG000187674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750022"
FT                   /orf_name="AFUA_4G06020"
FT                   /product="Cyclin dependent kinase inhibitor Pho81, putative"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /function="kinase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL90184.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG054272"
FT                   /db_xref="HOGENOM:HBG398725"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051E6CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK0"
FT                   /transl_table=1
FT                   /translation="MRKPPFARIRKCSSSDLSVRLKKSIPFTCRKNPRYECPFSLRLKT
FT                   LLDKKRVVQSRAVSHSKAPANFVALIEGFQQFDGDLNKLQQFVAINETAMSKILKKSRM
FT                   KELYLHRAVEVQPCFNRDVLRDLSDRATTARLELEAWAEGENIQFDTVRPADRVGPPFG
FT                   TDEEDLDAQILQSATTGSLQTLREWTAKLHTAPDARDRATRAFLAAINEYSDEVLAVLL
FT                   ESGLVDINAEDDINERNCLHEAAISGRDFVFKTGISAGVDVSRSDVYGRIPLHYACMHG
FT                   RVDMVRELLAVGPDTVDTADHNNFTPLIHSIVKDQLACAEQLLQHNARIGPASESDHIP
FT                   LNLACQHGSIPIVRMLLERNAQLLPDAEGLYPQHMVARASQPPELLLLLKQHGADMNQR
FT                   DKLYQWTPLFHAASEGCVNCLRTLLELGVDASAVDEKGLSAMYYAAWEGHLECMLLLWS
FT                   HRSESQLPQKPLDILNGLRLQEPNLTTMNHEIVASSDMDTADGIPDLSLPPPIIPLRRY
FT                   GHNFLDKKVFVQILFEPGSSGSLCFDQAGRHPAARLTISSKLSDLIPRTIMLPIQEDSR
FT                   TISFHVDNLESFAVDFEVFPTFGSKVIAKSVALPTVFRADKSSTGSCTLPLFDPRLRSI
FT                   GQLRFGFQVIKPYHGDPLEITHFATYWKATSALDSEHNGLVTGSSLSGDHIQLFVQLTR
FT                   DRVPVLYPRFTIQHHSVEIPICHLSFNEFKSVGAERGVNQAETIQFLKENATNNIGQTH
FT                   RLLAASFFSLREVLRHLPISVGVNLSILYPSPAEERDLNMASLADVNSFADAILTEVFD
FT                   HARVAREHNPDFLRSVVFTSYNHNICTALNWKQPNFPVLLCNDLGQIRDLARDIGFLPD
FT                   VDSSGRASMSIKESARIAQSNNFMGLICRSSLLNVVPALVETIKGLGLVLVADTSDEDE
FT                   EPERKNPLAAADTVGVAEWAYRMPEGVNGVLKANGILRFNDMIDM"
FT   CDS_pept        join(complement(1531738..1531747),
FT                   complement(1530440..1531647))
FT                   /codon_start=1
FT                   /gene_family="HOG000187686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260064"
FT                   /orf_name="AFUA_4G06030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90183.1"
FT                   /db_xref="HOGENOM:HBG054271"
FT                   /db_xref="UniParc:UPI00005207D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK1"
FT                   /transl_table=1
FT                   /translation="MASGTAQAAPTSVNANGGTLAQTTAEQTPIPPTTSEPTSTPSTTS
FT                   STTSTTSTPPEPPTTSSTSSTSTSSTSSTSSTTTAQITEPTTSETSRSPDDVTTTIATA
FT                   SPTNTNTGPTTVYVTSTESTRQTLPTGNSANGVTTTSSGPSATASSTGGSSGGSGLSAG
FT                   GTIAVAVVVPVVSVALIILAALYFWRKWKAKKAAEEERRKEVEEYGFNPNNDPTLPPIM
FT                   GAGAAYEPKEDTSGYRGWGTTSAGRKASTNLSSGAGPGLAISEAGSAPGYHHAATPSDG
FT                   TIQFSEGQMQETEPIGVLGAAPTSSNNRTTDIHRGPSNASSAYSAANRSEASEESHMSG
FT                   THPAAAFYEDNPYYSDMQGQYGAYGDGPYVPNQPVIRDVQARRNTRIENPAVFPRQGNA
FT                   GIAQNF"
FT   CDS_pept        join(complement(1536886..1537154),
FT                   complement(1535161..1536828),complement(1534863..1535109))
FT                   /codon_start=1
FT                   /gene_family="HOG000187697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055337"
FT                   /orf_name="AFUA_4G06040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90182.1"
FT                   /db_xref="HOGENOM:HBG054269"
FT                   /db_xref="HOGENOM:HBG324377"
FT                   /db_xref="UniParc:UPI000051E91D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK2"
FT                   /transl_table=1
FT                   /translation="MHHHHQHLHFPRHGIHLAVRSPPRRPDIVPRDRVPLLVGTEDPTL
FT                   VKRVPSTSTTSTASTRCPEGDTSSACEKYTNSSSTTTLPIVLGAVIPIVCAIIVLFYLH
FT                   RRNVKKLRQEDANDKHKSLDFGLDLEPRAGSKPMTQAEKGSNMHSKGMSLDIGQSPYLL
FT                   PPGLHGSRESLHSLSRSIIGDDDKYRHASSFLGDNASVRSQPRGFHDETSAFSRSQSKA
FT                   SLRGDDMNQGLLQNAQRMSRSSPPLYNAPSDGGSSHSPRGQGNGQDMGLQLNLPRSLSP
FT                   VHIPGVNGSRGTSPAPGGHADGSEDISSSETRNANLPQQPLKNAMDPSLELHLDTREQQ
FT                   GRPIQEDLSTKLGSTSPSKQSPSVPTPRISLPVSDAASDYGDNRNSHAEIPAVNVDGAE
FT                   DAQKRDGAPNHAAAPPIPQEPLQSQNQSLDVRRDTRRFTLGLRPLPPEDPSDNPEQRAN
FT                   RIRSFYKEYFDESKTGRETIYEDYGPEYFQDDGYVYDPATGEYYDAVPAPFAEPVNRRA
FT                   MTPPPRAPPRFQGAARHMATGSVGGGASDRSNYPGPRAFSSASHRLPGPRAPRKPMPPP
FT                   SPLQVLPSPHLLKEDSLMNAAEYAPGMNYKDKREGRAETPLGGLRPYTPVTPARTPLVS
FT                   AFDELAPIPSPHALRKSGTFDNLDFAPPPRFKNVETASDAGSIHSNRTGISAAHLHNIR
FT                   TGAYRVSRLPPETVGTKDDLMSNLRPSWDMRQT"
FT   CDS_pept        join(1540188..1540618,1540669..1541787,1541847..1541925,
FT                   1541994..1542167)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902016"
FT                   /orf_name="AFUA_4G06050"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL90181.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054268"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E47B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK3"
FT                   /transl_table=1
FT                   /translation="MDSLSRNLEKAELEAYRAPSRRQSLNNGGRASRSNSLSPSVTSSS
FT                   SSTQAQEDDYYLSQIQTAQTVRGAGLERHPTALSRIATQRSQHSAIVGALKPVVSKKPL
FT                   PEFGAGKPYPPPLPERDEYVVEFADKDDPLHPQNWSIKKKIAVSAMLAYTTFNATFTSS
FT                   IYSTANSVVSSRFHVSTEVGTLGLSLYVLGFACGPTFFSPLSELQGRRLPILVGMFGFA
FT                   VFQFGVATAENLQTIIICRFFGGFFGSCPIAVVAAVFSDIYDNRHRGLAITVFTMTVFT
FT                   GPLFAPFIGGFIVESYLGWRWTEYLTGIMGASAFVLDLFFLEETYPPVVLVGKAAELRR
FT                   RTRNWGIHAKQEEIEVEFGELIRKNFSRPLRILFTEPIVLLLSIYMAFLYGLLYLFLTA
FT                   YPIVFQRIHGFNKGVGGLPYFGIIIGEFLGGIFIMLLQPWYNRQLSAYKDIPIPEWRLP
FT                   PAIIGGVAFSGGLFWFGWSGYRSDIHWIVPTLSGLLTGFGLFCIFLQCLNYIVDAYLVF
FT                   AASALAANSVLRSIAGAGFPLFSTYMFNALGVNWTGTLLGCVAAIMMPIPLLFYLYGPK
FT                   IREKSKFAMEYIVAAQAHNDERAE"
FT   CDS_pept        complement(1543244..1546048)
FT                   /codon_start=1
FT                   /gene_family="HOG000187708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750023"
FT                   /orf_name="AFUA_4G06060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90180.1"
FT                   /db_xref="HOGENOM:HBG054267"
FT                   /db_xref="HOGENOM:HBG324374"
FT                   /db_xref="UniParc:UPI000051F026"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK4"
FT                   /transl_table=1
FT                   /translation="MTSPPSHLKEENDTPSHSRRPSSSWLRRLSIQPQESRLSNNGPLS
FT                   PSSNDPTSPGLSRPSSQRRVPNKLVKRPPSQHSSGLPLSSHAPSSPWAPSQLRRPATSY
FT                   QRSEVLRHRATHSLNFEPSSITGPASHSVEAGASIDIEEGAWQPYLRPSLEGVTERLAR
FT                   RLSTVTRPKEQTLRRILPSPDALPALLLATSITVKEPAINITSNEFAPASPVQFRDPFK
FT                   LDDPPHARDAPSVVESNSGPSSIVLEADPRSPEKGSSAAASKQSNSGPPVWSRRRAAST
FT                   SFSELPNSKAATSVSRRLHGKRNITDPNIFRRPPDTFKAGYPNFLTAKIMRSRRSVTPS
FT                   YLREYRAELGRCRDYGNRPLTSDAIALSASQNAFFRASDLTFLWSVRQRPRRHSIAASD
FT                   PASSAIGSEDTRIFTSGDEDESDFLTDTAFDSIRTHFTIGSISGSRGLRIETMFDKNSV
FT                   ESLANHEITIEALEPRGPRMPDGLTSAKCDMGIDSDAVSGSTPRTREIAELDDSEDNRI
FT                   SFPSDLSEDEDARSTVAALPGETNSPFIFPRSPLVASNFYPEGNDIRAHVHSNSSHASD
FT                   EAFALDELRSVSQESLGSCRKMNIFDWSEQSRSDRDASRIDERPRTVHGKNGPEFRGSR
FT                   APGRRAPNSLHLRSQSVPVAREPATASESRQTSGKFGTWGLGSKGVSEDWDSDFEFDDA
FT                   EVDNENMRPSRTSSRRGMIVPAAILERQASLHGQFGQVQELTLLVEELKRLRHRASFLN
FT                   IVQGPSSELWQEAEGIVNLATLDDEENNDSPPRSPTSLTFSFDDSEGESSNLADPSKRT
FT                   SGDSWRASLSEKLPPNLNISCDTSAKAKSVLDLIYQQRSQDPALRGPHCSRSKKLPFDT
FT                   QSLRDLVIRAGVVTRALKEVIRKEEGVITTPDDKAQSSDLPFSRIFDQPTDDNHLIYET
FT                   HCVN"
FT   CDS_pept        join(1551382..1551444,1551505..1552230,1552287..1552367,
FT                   1552422..1552725,1552785..1552958,1553007..1553093,
FT                   1553155..1553623,1553694..1554045)
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260065"
FT                   /orf_name="AFUA_4G06070"
FT                   /product="Translation initiation regulator (Gcn20),
FT                   putative"
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="EAL90179.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG054266"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000051F781"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK5"
FT                   /transl_table=1
FT                   /translation="MEAELQAQIPGLDRVISEYSVGYLTHASNAYVEDANAPSPLSEAA
FT                   DMVTELLVSASGDFSEHNEKAIRNLVEKFISSLSSSDGVDAERRQMPFTAKKLDQAIHV
FT                   GSQRNMSSTLGLAGGNVDLESANSRKVESRVDRKKLEKAERKIRAKQEKKQMKTVQYEA
FT                   SRLLNQPESTLSYEEFFMAVNPLQLGSDSQSKSKDIKVDSIDISIGGHRILTDASLTLA
FT                   YGRRYGLVGQNGIGKSTLLRALSRREVAIPSHISILHVEQEITGDDTPAIQAVLDADVW
FT                   RKRLLAEQEKISKQLAAIEAERSSMADTSKDAARLDHEREGLDITLNDIHSKLAEMESD
FT                   KAESRAASILAGLGFSPERQQYPTKTFSGGWRMRLALARALFCEPDLLLLDEPSNMLDV
FT                   PSITFLSNYLQSYPSTILVVSHDRAFLNEVATDIVHQHSERLDYYKGANFDSFYATKEE
FT                   RKKIAKREYEKQMAERAHLQAFIDKFRYNAAKSSEAQSRIKKLERMPVLEPPESDYVVH
FT                   FKFPDVEKLSPPIVQMSDVSFGYSKDKLLLRNVELDVQLDSRIGIVGPNGAGKTTVLKL
FT                   LTGQLQPTSGLISTHARLRIGYFAQHHVDALDLTTSAVSFMAKTYPGKTDEEYRRHLGA
FT                   FGITGTTGLQRMELLSGGQKSRVAFACLSLTNPHILVLDEPSNHLDIEGMDALSEALQR
FT                   FEGGVVMVSHDVTMLRNVCTSLWVCDKGTVHKFDGTVDAYKKMISSQANEAGVVAQH"
FT   CDS_pept        join(1554397..1554593,1554689..1554985,1555094..1556246)
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750024"
FT                   /orf_name="AFUA_4G06080"
FT                   /product="MFS myo-inositol transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90178.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054265"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F9F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK6"
FT                   /transl_table=1
FT                   /translation="MNRGDANDELAPDAPLLSTEQVGVDGTAHFAADSQSLSLDLRDSG
FT                   SLFIWALTFSAGISGLLFGYDTGVISSTLVSIGTDLSNRVLTTLDKSLITSCTSLFALL
FT                   ASPLAGILADKLGRRRVILVADVLFTLGALVQAVTGQVWGMVLGRSVVGLAVGAASLVT
FT                   PLYISELAPSHARGRLVTILCLFITGGQVVAYIVGWLFSTITSGWRWIVGLGTLPAVLQ
FT                   FVIVVALPETPRWLVQAGLEAEALHVLSKVYQGQSDNHQIAKQVVRSIQLEVAEEQEEM
FT                   DRIKPSVDATRIPWLRKVAQRAQDLFLVGGNRRALIIATMLQGLQQLCGFNSLMYFSAT
FT                   IFSMLAFSSPTLTSLSVAVTNFIFTLLAFALIDRIGRRRILLYSIPVMSASLIVCALAF
FT                   GSMELPGFSSEPRSQTQADNGATDKSFLPIAVLLCLTVYTASYAFGLGNVPWQQSELFP
FT                   LNVRSLGSALATATNWASNFIVGLTFLPMMDWLSPGWTFTAYAGVCVVGWFGVWAIYPE
FT                   MSGLSLEEVRGLLANGWGVRESLSRNRYSAS"
FT   CDS_pept        join(1557048..1557185,1557238..1557678,1557740..1558006,
FT                   1558270..1558731)
FT                   /codon_start=1
FT                   /gene_family="HOG000187719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206600"
FT                   /orf_name="AFUA_4G06085"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27395.1"
FT                   /db_xref="HOGENOM:HBG324373"
FT                   /db_xref="UniParc:UPI0000F51BF6"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N4"
FT                   /transl_table=1
FT                   /translation="MPRMRGSHDSAKYIDTHGHHWEMSRQKTDPRARSHNASPLLLLPT
FT                   EILQYIAYLLPSDVDIVNLVSCCVHLARAILPAHSSIWRERFKDLYGTPQRRSSSELKL
FT                   EYQIRSIVLSQKINFRYGQKQEQTLWLEVLRDMLLEAYESAPTDEHTASKLLEQIHKTL
FT                   HNSEFLNRPVSGYGDTNTDAPSELFYAVQLCLTHLVLDPSMAVYCLRNDYDIGAVYSFQ
FT                   VDISEPLVNVEKLDLGKILHIRNFWLRHLLNPNEATFCSSYTLLHQRPNATRSLGDSRC
FT                   CSLRIKLDPDPSNWPTLFDSIIPILGSRTSCSYFRGIETQHGSDDDSTYLVRGFTEVIP
FT                   KAHGGFPYWRRICFAIYDADREQLPLIPNDDGTSGKGKDDLWLPEEAWPPYDLEVEFNW
FT                   VHGYEGVILPSGTIMIGRWIDMVEPTARGPFIFWNV"
FT   CDS_pept        join(complement(1559933..1560087),
FT                   complement(1559835..1559865),complement(1559348..1559757),
FT                   complement(1558962..1559286))
FT                   /codon_start=1
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055338"
FT                   /gene_name="sec13"
FT                   /orf_name="AFUA_4G06090"
FT                   /product="Protein transport protein sec13 "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="EAL90177.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054264"
FT                   /db_xref="HOGENOM:HBG590901"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000520555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNK7"
FT                   /transl_table=1
FT                   /translation="MTRGTNLVGPFLQHDAGLDYYGRRLATCSSDKTIKIFEIEGETHR
FT                   LIETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQHQNATSPVAGSTWTKVFD
FT                   FSLHTASVNMVSWAPHESGCLLACASSDGHVSVLEFRDNSWTHQIFHAHGMGVNSISWA
FT                   PAASPGSLISSNPGPGQQRRFVTGGSDNLLKIWDYNPESKTYNLSQTLEGHSDWVRDVA
FT                   WSPSILSKSYIASASQDKTVRIWTSDASNPGQWTSQQLEFDTVLWRVSWSPSGNILAVS
FT                   GGDNKVSLWKENLKGQWEKVKDIEE"
FT   CDS_pept        join(1560887..1561000,1561078..1561884,1561992..1562115,
FT                   1562138..1562218,1562271..1562362)
FT                   /codon_start=1
FT                   /gene_family="HOG000187730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260066"
FT                   /orf_name="AFUA_4G06100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90176.2"
FT                   /db_xref="HOGENOM:HBG054263"
FT                   /db_xref="HOGENOM:HBG324372"
FT                   /db_xref="UniParc:UPI0000F51C22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK8"
FT                   /transl_table=1
FT                   /translation="MSDTLCGPSNALQNLQKHASVDRTLQQDRLISRRSPSQGFRSQNS
FT                   SDGVLDPEFAAFESDLAGPSLPNLQHAGPFSAHPHRLPVASHAENVTWAADFQRLHISG
FT                   PSHPIQQHHGPSATPASAMSQQGWHSEFLKQQQQRQAPTQQHQQYTGGFQPSFSPHHPI
FT                   HGGVINALPSVHRPATDQQHATETFDESAFEAAFEQARADMALQETNATEEKAEPASET
FT                   IQPDLSTAQEPTEQIKIGSDTIPQIDKNDPLSRVNDADELARTAGQLLDSVSHDQSEKF
FT                   RKSSFLALMRRIRDREVRIEDDEFRETSQSLHPGGKYYPGGQQQAQRQQTSIPTHQDGP
FT                   DGVTFGDISPVYRVRNDNAPIQGLTRCNVPNRSSATPRDIPSASSTGAGLGEDNSLYAS
FT                   WNYGGI"
FT   CDS_pept        join(1563138..1563818,1563891..1563935)
FT                   /codon_start=1
FT                   /gene_family="HOG000187741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750025"
FT                   /orf_name="AFUA_4G06110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90175.2"
FT                   /db_xref="HOGENOM:HBG054262"
FT                   /db_xref="HOGENOM:HBG324371"
FT                   /db_xref="UniParc:UPI0000F51BCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK9"
FT                   /transl_table=1
FT                   /translation="MLLCLYRNMLPPSDSFLHHSHKLREVAANARNRAVRIPPPPYSLA
FT                   VPRGSTHEEGQNALETIDDDTAWETCAGASSTPITISIDASINVVGNGNTIMIPSMAGH
FT                   PQQTPKVSSSMSPESSSSSSSIAPAASEADTLHSIQKQRQARLTEMATAIINTLYDSGR
FT                   LAPPAEDHEHAPLEIKINTGIKVEGSRNVICVGATARAQSNKSAPMGTDKDRQVILNRK
FT                   RRALSEPFEAPNSKKNCVQ"
FT   CDS_pept        join(complement(1566441..1566784),
FT                   complement(1565180..1566352),complement(1565031..1565115),
FT                   complement(1564873..1564971))
FT                   /codon_start=1
FT                   /gene_family="HOG000187752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902017"
FT                   /orf_name="AFUA_4G06120"
FT                   /product="RSC complex subunit Sfh1, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin remodeling"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="EAL90174.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054261"
FT                   /db_xref="HOGENOM:HBG324370"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000051F50A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL0"
FT                   /transl_table=1
FT                   /translation="MSPLRGYITSYPPRIRQYGNALLTPVIPQTQVGPTPRTTKRGTTA
FT                   VNYAEDGFDDDDFEDSEGPRRPTGLRSLRREESATDKTPLAEKLGKEIHAPVEVQGVFR
FT                   DWMIKRMLRPACADQLQIQAQLPLTLIPIRIDLEVPAHQPLEPFPMPRGVVDPGINPTL
FT                   PGYRRPDPLPAFRIKDTFLWNLHEALATPEEFAMGFVRDLDLPNPQAMTLAISNQIRQQ
FT                   LEEYAGVALHPLFQSTQSSKPAPTSQTNPSRDVSATPVPTQAATPDNRAIGVSVTKEAL
FT                   VNDSILNPDDAYRCLINLNINLQNRLYTDKFEWSLLHPPGMAEEFAQVTCADLGLGGEW
FT                   VGAIAHGIYEAVLKLKKEVCESGGMISGMGGYGNEIDNQAANGTEAGWRYDPEGLGDEW
FT                   EPKVETLSKEEIEKREGDRERQIRRLRRETARFSSTAGITPDMSRQGSGYFDVDSETPL
FT                   GRGERSKRKRRFRSLSPSGRGGTPGGRGTPDTGSGAGYGGGGGTLSDWERQSWRCSNCM
FT                   VWGSAVWAVRDGPAGPRTLCHNCGLLYERDKVTPEWSRDLHRHDVPVGR"
FT   CDS_pept        join(complement(1568815..1568893),
FT                   complement(1568673..1568709),complement(1568472..1568607),
FT                   complement(1568054..1568403),complement(1567735..1567999),
FT                   complement(1567665..1567685))
FT                   /codon_start=1
FT                   /gene_family="HOG000187763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260067"
FT                   /orf_name="AFUA_4G06130"
FT                   /product="General stress response protein Whi2, putative "
FT                   /protein_id="EAL90173.2"
FT                   /db_xref="HOGENOM:HBG054260"
FT                   /db_xref="HOGENOM:HBG324369"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI0000F51BB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL1"
FT                   /transl_table=1
FT                   /translation="MAAAGGPSSIITQVQQAGGPPINTLGDIGCDEHITLELRGTRFTL
FT                   SRDELLTLPEFVLLSLFPNGLLPDGHMGSFQEGDIYPVDYDPTSLQYMLDFFRSVAQSI
FT                   PSSSPSASTTPELEMSETVLGSPRDILQDRAGIIVLREDLDFYAIPPRPDIDHTEMMEV
FT                   KRAVGKALLKQDGIFSGLKKSDEPGSTEQHLIEMLTAGGFERDDRWGHRAPEPNKAVIC
FT                   SLALAKLRTDVRGDLSNNNAVGMAQKLLLFWRKPARRCWWEGVELESVEGVEGKVKVWI
FT                   RRVWTLEMSVIGLR"
FT   CDS_pept        join(complement(1572365..1572711),
FT                   complement(1571391..1572270),complement(1570209..1571324))
FT                   /codon_start=1
FT                   /gene_family="HOG000187784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260068"
FT                   /orf_name="AFUA_4G06140"
FT                   /product="Dipeptidyl peptidase, putative "
FT                   /EC_number="3.4.14.4"
FT                   /function="dipeptidyl-peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL90172.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008239"
FT                   /db_xref="HOGENOM:HBG054258"
FT                   /db_xref="HOGENOM:HBG324368"
FT                   /db_xref="InterPro:IPR005317"
FT                   /db_xref="InterPro:IPR016526"
FT                   /db_xref="UniParc:UPI000051EDB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL2"
FT                   /transl_table=1
FT                   /translation="MLPLLAALRRLPSNHRLLSIHRPSTTTITSLLPLSCLPRSSLLTQ
FT                   RFNFSSSTPSFASFIPLSTSSEAASNTIMDDKIKQHYLADSPPTVVRLEIKSHFDALKD
FT                   GKLRKYAHYLSRAAFEGTRITLRQVSPESEPIYDLIIALYNACNGDWVSLARKTKVSDE
FT                   HLRFFLEYAAQFLGNCGNYKGFGDSKFIPRLPVAAFEALASITPDAKAAFEKANRTGGG
FT                   IYETSNQSLMHLGYTEGGHMTTYYPDSPSITKDEITAIGDLMEQKGLPLENTRLKKLPS
FT                   GDFELLIASGVSSPPSRDRDLGDVESLDLDGKLKGKKVQLVFGDHREEMAKIAHSVKQA
FT                   SLYSANENQKRMLNAYALSFGAGSIEAFKEAQRIWVKDQKPILETNLGFVETYRDPHGV
FT                   RGEWEGFVALVNLERTRAFGKLVDSAESMIPKLPWSKDFEKDKFLSPDFTSLEVLSFQS
FT                   SGVPAGINLPNYDDIRQNLGFKNVSLGNVLSAKAPNEPVPFIPEKDLEVYRRYRDPAFE
FT                   VQVGIHELLGHGTGKLLQETAPGKYNFDVSNPPVSPITNKPVTTWYKPGQTWSSVFGAI
FT                   ASSYEECRAECVAMVLSCDFEILKIFGFGDGQVDLNNEAGDVLFVAYLQMARAGLVALE
FT                   FWDPKTQKWGQAHMQARYSILRTFLDAGDDFVRLVYTKEDLSDLEIHLDRSKILTHGRP
FT                   AVERYLQQLHIYKSTADIDAGKKLYSDITFVDEWWGTKVRDIVLKNKIPRKIFVQGNTI
FT                   LNGDEVTLKEYEPTLEGMIQSFVERNV"
FT   CDS_pept        join(complement(1574574..1576020),
FT                   complement(1573206..1574524))
FT                   /codon_start=1
FT                   /gene_family="HOG000187785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055339"
FT                   /orf_name="AFUA_4G06150"
FT                   /product="Protein kinase Scy1, putative "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL90171.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG054257"
FT                   /db_xref="HOGENOM:HBG324367"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F509"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL3"
FT                   /transl_table=1
FT                   /translation="MFSSALKTLSSNISANYQISPHPTVISGPWRIHDGKKKSTGTTAS
FT                   VFIFDRKVLDYRPSGLASRSSSSLKKLHEDVVERLKREASNLARLRHPSILQVLEPVEE
FT                   TRGGGLMFVTEPITTSLASLLREKDEQERTSRIGSSSSHFMVEEADGTRRRRDLEIDEL
FT                   EIQKGLLQVAKGLEFLHESAGLVHGNLNPEAIYINSKSDWKISGLGFAGPPNSTESRSS
FT                   LPPLALSEVLYHDPRLPQSVQLNLDYTSPDFALDSNVTTAADMFSLGLVVIALYNSPHV
FT                   SPLQSHSNLISYKKLLSSPSSTPSQGNNFLCAGAIPKDLSSHLLPKLITRRPAQRLNAR
FT                   EFQQSQYFDNILVSTIRFLESLPAKNANEKSQFMRGLQQVITEFPPTVLEKKVLGALLE
FT                   ELKDRELLPLTLQNVFAILQRVASARRTLSEKVIPRLKEIFFAHQSGKGTVQERDSKKD
FT                   AGLMVVLQNMNIVAENCSGKEFKDDILPLIRLGLDSSAHSLVDAAIKCLPVILPVLDFS
FT                   TVKNEVFPPIASTFSRTSSLAIKVRCLDAFAVLCGGTTGDDAASEDGLSGIATVKTPTT
FT                   VKSSILDKYTIQEKLVPSLKAIKTKEPAVMMAALKVFGQIGTIVDTEFLALEVLPILWT
FT                   FSLGPLLSLRQFEEYMTVIKRLSSKIEREQTKKLRELSSGSEATGFQTGLGSSLSMSND
FT                   LMQSEVDTTRNNFERLVLGRESTTPSSQGLDPWQELASQAPAPQISTQKKAADAFPWSS
FT                   VSRGGPQSNLNTRSVTPDYSMSSFPSLEPVAREKSPIVAQTVPTSQPSSSTAWSLPASS
FT                   NIQHNMQGNGIGSMTGLTMGALTGMKSPNKPVSGGLSQQSSNYSAFSIPPPPSAPNMTA
FT                   SFVTSSGGSTTVGRASLVGNPPAPANSLNPVSTSMQTTQKQGLEKYESLL"
FT   CDS_pept        join(1576836..1577070,1577133..1577430,1577481..1578183)
FT                   /codon_start=1
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750026"
FT                   /orf_name="AFUA_4G06160"
FT                   /product="Branched-chain amino acid aminotransferase,
FT                   cytosolic"
FT                   /EC_number="2.6.1.42"
FT                   /function="L-isoleucine transaminase activity"
FT                   /function="L-leucine transaminase activity"
FT                   /function="L-valine transaminase activity"
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="EAL90170.1"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="GO:0052654"
FT                   /db_xref="GO:0052655"
FT                   /db_xref="GO:0052656"
FT                   /db_xref="HOGENOM:HBG054256"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI000051F787"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL4"
FT                   /transl_table=1
FT                   /translation="MSSLRQLTRHRTLHSFASTRVRVQNPETRQSWQRYFSATSAFASQ
FT                   QAGLDPSKLTVTKTTTPKELVAPKDLVFGKTFTDHMLSIEWSAANGWNAPRIVPYQNLS
FT                   LDPSACVFHYAFECFEGMKAYKDKKGQIRLFRPDKNMARLNKSSERIALPTFDGDALIK
FT                   LIGEFVRLDSRFIPDARGYSLYLRPTMIGTQNTLGVGPPGSALLFVIASPVGPYYPTGF
FT                   KAISLEATDYAVRAWPGGVGDKKLGANYAPCIVPQLKAASRGFQQNLWLFGDEEYVTEV
FT                   GTMNLFIALKNKETGQKELVTAPLDGTILEGVTRDSVLALARERLVPKGWTVSERKIRM
FT                   SEVAEASEEGRLIEVFGAGTAAIVSPVRTISYRGKMVDCGLKKNEEAGEVALQMKNWIE
FT                   GIQYGDEEHPWR"
FT   CDS_pept        join(1585417..1585591,1585658..1586220,1586301..1586432)
FT                   /codon_start=1
FT                   /gene_family="HOG000187797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260069"
FT                   /orf_name="AFUA_4G06170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL90169.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG054255"
FT                   /db_xref="HOGENOM:HBG324366"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI0000F51C32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL5"
FT                   /transl_table=1
FT                   /translation="MHRSSNNSYHQSSSSRSSSAHSSSSAFSPNANPNEDWTKISDLAE
FT                   RRRIQNRIAQRNYRKKLKRRLEDLEKRAASASESPERSHEKPELPKHANPGKSSSRTSR
FT                   SSKSNLETSHGSRERLPLYDCYNSQDDRGAMFSHQCTRQLSASPPPVFSYPSYPHLDPY
FT                   RQSNYGTSPAYSSTYNDLSSFQGEYGNPVPSIMPVAMSSGGPLKRPHTYADEEIISPFS
FT                   MSYATMAGIDLCPTSHHPGESNISIPSLCQLFAEDLSSPPTPAETSILTCPLTPESDPC
FT                   SPHSFPFL"
FT   CDS_pept        complement(1590604..1591698)
FT                   /codon_start=1
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260070"
FT                   /orf_name="AFUA_4G06180"
FT                   /product="Casein kinase II beta subunit CKB1 "
FT                   /EC_number="2.7.1.-"
FT                   /function="kinase activity"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="EAL90168.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG054254"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI0000520314"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL6"
FT                   /transl_table=1
FT                   /translation="MSSSEGAPESWISSFCSLMGHEFFAEVSEDFIEDDFNLTGLQSQV
FT                   PMYKEALEMILDVEPEEDEDEEEEEEEEEEDDDEILGDERPPGYRRAGDRRHARVASDL
FT                   SVIESSAELLYGLIHQRYITSRPGIQQMLEKYEMQHFGVCPRTYCNGSKVLPVGCSDTP
FT                   GQETVKLFCPSCQDLYTPPNSRFHSVDGAFFGTTFGYLFFMTFPDLDIGPRLDPSMLTA
FT                   APTNANNQSRSSSLTSGVNRATPDLPPPPPNQPTEINGVRTSNFCPGLGPGRIYESKIY
FT                   GFRVSERSRVGPRMKWLRMKPADIRELDELAQYEAIHGSANDGGDTEMNIEAQNAAAIA
FT                   ARKKAPMRRRRHHPDQMSINGAEG"
FT   CDS_pept        join(complement(1594050..1594958),
FT                   complement(1593736..1593987),complement(1592712..1593680))
FT                   /codon_start=1
FT                   /gene_family="HOG000161576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750027"
FT                   /orf_name="AFUA_4G06190"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="protein kinase regulator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="EAL90167.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG054253"
FT                   /db_xref="HOGENOM:HBG324365"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051ED90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL7"
FT                   /transl_table=1
FT                   /translation="MTFEFLWRENDCAIGRYAPNCCNNNFKDSEYVLSPLSLIWLTLLS
FT                   VRQLTSVVRDREFRSMKDQITTLQEQVNSLFTSLNDLRNQRSSLDSPNLEDLSRDGSQS
FT                   VFTSMHAATVRPRVRHLRFHGPTSSAFNFDVARSSLQTMGIAPAEEVMNDDMTTAQATP
FT                   AASPPAQQAVFTQSIHPTKDPIWAIKREEALRLCHVYEEEVGIMYPLVDIEKVTNQVNL
FT                   LYTFMEAALRTGFAQRAFPGPDSLLDDNTILLKMILAITLIVEGSGRSDLGQRLFLSVK
FT                   PIIEAKLWGPIDIKTIQLFGMVATYHFHTDDDAMAYRVIGFAARMCLELGLHRREALMK
FT                   SFPNEDQWADVTKVFWTIYSLDRRWSLGTGLPFVIQDEDVDPNLPEPDGSLPYLRCMIS
FT                   YNRISSKIWYSGLGSEGTTDIRRDEIGYLDYQVLQWYKQVPDALKFYPGDSPKHGETVS
FT                   RGLRRLRVLLYLRMNQLRILIYRPVLHSSASIAEDNGHAQTVVDVAKDTVRVLTQLNHT
FT                   SDIYRTQQITFNYFLVAALAVLFLAVCHAPNEFNRQVRDEFYMALDLINGFSTKSYVSK
FT                   RLWKTIKGLRMVGERLGVLARPFGSDSNDPHSTAAVAMAGLAGHSIENLSVYGPMNGVN
FT                   ELGNSPLNGLQMSQELTNLFEAVGGFSSFIASGTAPEGIPGFVNHDRELQNTGEGLSGI
FT                   FGDDGELSRIIRELF"
FT   CDS_pept        join(complement(1597449..1597669),
FT                   complement(1595991..1597385),complement(1595659..1595926))
FT                   /codon_start=1
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750028"
FT                   /orf_name="AFUA_4G06200"
FT                   /product="Flavin-binding monooxygenase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL90166.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054252"
FT                   /db_xref="HOGENOM:HBG326751"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000052030D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL8"
FT                   /transl_table=1
FT                   /translation="MSSSVARIHKRHSYGKDAHTYSPVLVIGAGVSGIATGCRLKEALG
FT                   FDQFRIFERQSGIGGTWWINRYPGAACDVPALLYSFSFAPKKDWTTLHPPGPEIVQYLA
FT                   DVCEKYQIVDKIQLNTAVKEMRWLEDAEEWQVTLLHLVPGTGDLSEGERNARISKEGER
FT                   SVYVKTEIVRAKIVVSGVGVLVEPKKWPETVPGIETFEGEVVHTARWKSDLDLCGKDVV
FT                   IIGSGCSATQVVSELTKPEYKIRSITQLMRSPAWFMPDFLTPKSLKKWEKYTPPLFKNV
FT                   PGLAFAARALLFLLLEWDFLTIFKDNKYSRRNRSRIERKFLEHMRATAPEKYHDILIPN
FT                   YSLGCKRRIVESNYYASIHAPNFELTTKPLIGVQARSVSLGPDRHYPPESQESTDGVRQ
FT                   IAADVIILANGYETNKFLHPLPVFGRRGKTLDEIWEERGGAQAYLGIAMDHMPNLFLSF
FT                   GPNTATGHSSVIFAVENAVNYSLNFIKPILEGRVSWFEVKENAERDWTDKVQRSLQGTV
FT                   FRRGACTSWYQTDEGWNSSTYPFTQIDYYLRCTFPVWHHWTAKYTRKGLMLQRMKTVLR
FT                   RSVLVAIISSLCWLKLHPRDTQRLVELFSGARTTIVSAIREGLLRARRMLS"
FT   CDS_pept        1598390..1599400
FT                   /codon_start=1
FT                   /gene_family="HOG000187808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260071"
FT                   /orf_name="AFUA_4G06210"
FT                   /product="JmjC domain protein, putative "
FT                   /protein_id="EAL90165.1"
FT                   /db_xref="HOGENOM:HBG054251"
FT                   /db_xref="HOGENOM:HBG324364"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051E901"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL9"
FT                   /transl_table=1
FT                   /translation="MKYQRWLLTRNNLWAPKRPSVVASTNQPGSISLISSRDGRSVSTT
FT                   SQSRFHPLKPLREVKIDEFRRSYFHSELPVLLPYRHFRDLPACERWFQVVPSSNGHDRR
FT                   LNTAYLQEHGGDAFVPLELTQSPADTTAPDATVPESNELSFQQFHAPLSLFLDWMRTAE
FT                   LQSQATRLYLAQCQLLDLPPVLRDDFPTPELVLKAGKGDIYDTNVWIGHPPTYTPLHRD
FT                   PNPNLFVQIAGHKVVRLLAPDAGQRVFASVRRRLGRSGDREAAAFRGEEMMQGQERTLL
FT                   EHAVWDDADSDGTNNVLDFGYEAHLETGDGLFIPKGWWHSIKGVGEGVTASVSFV"
FT   CDS_pept        1599731..1600309
FT                   /codon_start=1
FT                   /gene_family="HOG000187819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750029"
FT                   /orf_name="AFUA_4G06220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90164.1"
FT                   /db_xref="HOGENOM:HBG054250"
FT                   /db_xref="UniParc:UPI000051F28B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM0"
FT                   /transl_table=1
FT                   /translation="MYTSLKAISRATVLHISLNPLFLIGARASLATATTTSPNLRSYSA
FT                   LYPICPSFHLYYPTQISSIHNHNQGHPFSTSATMSAESASNESQSQHPRQPENEQEQDP
FT                   NKPILALPEAPSAESGATHIDVSGGGSTVKLDALGPLVVNQDGTLSRIANWEQMTEIER
FT                   RNTLRVLGKRNKLRLDSLKAAEGEKDESN"
FT   CDS_pept        join(complement(1602693..1603023),
FT                   complement(1601898..1602120),complement(1601087..1601822),
FT                   complement(1600632..1601012))
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055340"
FT                   /orf_name="AFUA_4G06230"
FT                   /product="General amino acid permease (Agp2), putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL90163.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054249"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051FE9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM1"
FT                   /transl_table=1
FT                   /translation="MSRPDPDTSVHQTSLPTAISSDRSSHLADDFNLATANLTKRNGCP
FT                   ITYSEKATVVEDGEESIGGTLSKPTFDHTHRKLKPRHIQLIGIGGTIGTALYVQVGKSL
FT                   MKGGPGSLAEMVIYLPISSPFIRFAGRYVDEAFGVAAGYNFFVFEAALVPFEITACNMI
FT                   INYWSDVIPVSGVIVIVLVLYILLNVFAVQWYGESEFWLALSKVLLSIGLILFTFIVML
FT                   GGNPKGDRFGFRYWNEPGAFAEYYKTGDLGRWLGFLACLIQASFTIAGPDYVSMAAGEA
FT                   ANPRGVLPRTYNGIFYRLTAFFVLGVLCIGILVPYNDPTLAEAFAKGLPGAAASPYVVA
FT                   MDRLGIPILPHIVNAMILLAAFSAGNSYVYCASRSLYGLALDGKAPRLFTKCTKRGVPI
FT                   YCVTVVMLIALLAFLQVSNSASVVLDWFVNLVTASQLINFSVVTFTYTRFWKAMIAQGI
FT                   PRESLPYKSWWQPYTAYVALVSTTVMTFVGGYTVFLPGNWDIPTFLFSYTMIGVFPVLY
FT                   FGWKIVHRTQVKKPEEVDLLTGLDEIDEYERHYVPEKPR"
FT   CDS_pept        join(1605771..1605879,1605945..1606040,1606124..1606302)
FT                   /codon_start=1
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750030"
FT                   /orf_name="AFUA_4G06240"
FT                   /product="Progesterone binding protein, putative "
FT                   /function="heme binding"
FT                   /protein_id="EAL90162.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG054247"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI000051E465"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM2"
FT                   /transl_table=1
FT                   /translation="MVEHEQEPKRFEPKVPVQLDPPKDDPITMEELSKCDGTDPSRPTL
FT                   VAIKGIVFDVSKNPAYGPNGQYRVFAGKDPSRALACSSLKPEDCRPDWYDLDDKEKTVL
FT                   SEWFTFFSKRYNIVGKVKDATNY"
FT   CDS_pept        complement(1606535..1608757)
FT                   /codon_start=1
FT                   /gene_family="HOG000187841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206601"
FT                   /orf_name="AFUA_4G06250"
FT                   /product="Ribosome biogenesis (Nop4), putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL90161.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG054246"
FT                   /db_xref="HOGENOM:HBG324361"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FE9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM3"
FT                   /transl_table=1
FT                   /translation="MISTAMTEQHKKGSLDESSGGHQDTQTTMDSPRKDTIQNDKVSTQ
FT                   PKRTLFVRSLPTSATTESLTEYFSQSYVIKHAIVVNDPETKLCKGYGFVTFADLEDAQA
FT                   ALKEFNGSVFEGKTIRVDYAQPRHREIDENLGKSVPAPAALELKKQREQQKTSTQPPKL
FT                   IVRNLPWSIKEPEDLAVHFRSFGKVKYVTLPKKGDKLAGFGFVVLRGKKNAEKALQAVN
FT                   GKEVDGRTLAVDWAVEKEVWENLKKESEKKEDTQEEAGSSDVEMADDAETTSDNEGVES
FT                   DDDDEDEDMDDDDEEDEEDMDEEEDEDEGNEDERQEKEDERNACTIFIRNLPFSCTDEA
FT                   LYEHFTQFGPLRYARIVVDPETERPRGTGFVCFWKVEDAALCVREAPKQQDTLIAEKDK
FT                   GKKSSTALKHSILQNENSDPSGRYTLDGRVLQVARAVSKSQAAKLEEEGVSKRLVRDTD
FT                   KRRLFLLQEGTISPNSPLYHKLSPSEIKMREDSFKQRQNFIRKNPALHFSLTRLSVRNI
FT                   PRHVTSKDLKQLARQAVVGFAKDVKEGQRQPLSKEELTRSADAMKEAEEYRRSKGKGIV
FT                   KQAKIVFETREGSKISEKSGAGRSRGYGFIEYYTHRHALMGLRWLNGHAVEAPKSGSAE
FT                   IKDKKKRLIVEFALENAQVVKRRNEMEARARAKKESQQNNGNTPSKDDSNSKASPKGKK
FT                   RKRSDSRGSGKEQDGDRDVEEENKIAKRNRIISRKRMQRKARKGKA"
FT   CDS_pept        1608936..1609961
FT                   /codon_start=1
FT                   /gene_family="HOG000187852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902018"
FT                   /orf_name="AFUA_4G06260"
FT                   /product="Mating-type switch/DNA repair protein
FT                   Swi10/Rad10, putative"
FT                   /function="damaged DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90160.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG054245"
FT                   /db_xref="HOGENOM:HBG324360"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniParc:UPI000051F780"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM4"
FT                   /transl_table=1
FT                   /translation="MAKDIDTNNADPDHGLPERSATPRAAGGTPNSATAQSTAPKVQQP
FT                   KPQALANRTGPSAILVSTRQKGNPILNHIKLLPWEYADIPADYVVGATTCALFLSLKYH
FT                   RLHPEYIYSRIKALGGKYMLRIILVMVDIENHEDSLKELSKTSIINNYTLMLCWSAPEA
FT                   AHYLELYKSSENAQPTAIRTQQAQSYKESLVEFVTTPRSINKSDAASLISTFGSLQNAI
FT                   NAQPEQISAVPGWGEKKVRQWTNAVREDFRVENAKKAKAPERNIEHDQNPSGLGIVSQT
FT                   GPSNTADEDEAALYLSEAGQRSGVDAKKGAPEVDTPRQSNQEEMSEGISAALARLRENG
FT                   G"
FT   CDS_pept        1610995..1612092
FT                   /codon_start=1
FT                   /gene_family="HOG000048508" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260072"
FT                   /orf_name="AFUA_4G06270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90159.1"
FT                   /db_xref="HOGENOM:HBG054244"
FT                   /db_xref="UniParc:UPI000051F786"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM5"
FT                   /transl_table=1
FT                   /translation="MGDEDSMNSCSERQAYQDVPISNGVSLSGVLPVRRSPGGHAGDMI
FT                   GSSRHPSARSVQQAQIPQSKNFEIVLVTDNESRRQVRRHAMRQYMRQRRLDSIARLETP
FT                   RLPIGGWVNRQVLSEASSSSIPPSPVEIPVKDTSPEEEKSSLVKDGEPCTPVSWTGPLM
FT                   PLASKSSKVKTEEPSSPSFPNVSYTLSDPRSSPGHGAVEDPFSCYPIPVSHSDHELIQH
FT                   CKFFLGSPYSHTDHADLDTSARGASARTILISLSGGLHCKVIVTYPSMMYKFADSVANN
FT                   PMMEIFRQLALHDNLSFQAMLAIASKHRAGVEGKADSVQSLTHKMRALRLINERIHTDS
FT                   QGLQDGTIYAVATMAVIEVITFPMH"
FT   CDS_pept        1612277..1613176
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055341"
FT                   /orf_name="AFUA_4G06280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90158.1"
FT                   /db_xref="HOGENOM:HBG054243"
FT                   /db_xref="UniParc:UPI00005200C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM6"
FT                   /transl_table=1
FT                   /translation="MVWLTLHRVDISCAPKAIYTSCLPWTGTVPDTSPESLDFLAPDVH
FT                   LAIPPTQTAVGSFDSLCDQNRACEDFLRFFRCLHELEKAALGCPGTVSRSSPASRVRRF
FT                   TPGAPLHSILTMLPDYDHGIRDIRFIDEYTCMSCLFFLAVALYDSYRNSTNFDRYLDWL
FT                   DMEVQRLSPSTKPSITSVLWIFLNNGGYPQGEAGDAGERCWVVSRMVRIAKRLEWKRQG
FT                   TIWDRLRQVLINFIFAQQECALGSDSVDEEAFIARQQRRRQSNEYFWDEDEMRVELLGS
FT                   QPSSVLTPYPQLQTTTVA"
FT   CDS_pept        join(complement(1615463..1615615),
FT                   complement(1615009..1615362),complement(1614659..1614946),
FT                   complement(1613988..1614596))
FT                   /codon_start=1
FT                   /gene_family="HOG000187874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260073"
FT                   /orf_name="AFUA_4G06290"
FT                   /product="Longevity-assurance protein (LAC1), putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90157.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054242"
FT                   /db_xref="HOGENOM:HBG324357"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI000051E459"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM7"
FT                   /transl_table=1
FT                   /translation="MAKDESTRSQSVSELNTCVSTSHRTAAKDATFREWMDANQIGMRL
FT                   FSNLPWSWTRWLTVALYAYLGVSLTILGTLLAAHNLYPTLRPYTAPFFELSYYQPSEGV
FT                   YVQGFDDVYFVVSSAITFTAVRAIAIEWIFRPAARYAGLKRKASNRFAEQAWMWMYYAF
FT                   FWTFGMYIWTNSYYWMDFKAIWAQWPARGISANLKWYLLAQLSFWFQQILVINMEERRK
FT                   DHYQMLTHHIITSTLLTSAYIYGFYNVSNVVLCLMDIVDLLLPTAKILKYFKFELCCNI
FT                   TFGLFMVTWLITRHIFYPLLCWSIYKDVPDAMAYGCYSGSTAEMISTDGYPNRFRYLFN
FT                   PFLDINGPICMNRTVKWIFLGFLLALQLLSLIWFVMVVRVAVNVLRTGNAEDTRSDGEE
FT                   EEEEVEVRPVGKDALNNNPVGVDGANADWRRASSGSASVRPRARGRIPLGDQSDRKALL
FT                   GRIGCDKPT"
FT   CDS_pept        join(complement(1618003..1618031),
FT                   complement(1616828..1617947))
FT                   /codon_start=1
FT                   /gene_family="HOG000187885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260074"
FT                   /orf_name="AFUA_4G06300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90156.1"
FT                   /db_xref="HOGENOM:HBG054241"
FT                   /db_xref="HOGENOM:HBG324356"
FT                   /db_xref="UniParc:UPI0000520307"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM8"
FT                   /transl_table=1
FT                   /translation="MVELGISFATIKSLLIFFAPVIIPRAINLYRSLRVAVASRPTPRP
FT                   LPQATRRALNVLFFAILLCFLLSLPFNPHAPSPSIFTLTRSRINTPTDVIFSRLARFRP
FT                   DNTLSETDHLLRSKFTSVVARRVYLRYGPDALTSCEYCSLDNLKTYLLYYLPFNTLIPH
FT                   ILHMVLVGLVTSAPFAGREAASWRNKFTVAGLALAAIDIYIVSTYDPVLSASAAVRAGM
FT                   VPPSSLYHQTTLLRPLVFAVFDGICALLIYVTATNRFFFTPPSQADQVDQLVSTSLTSL
FT                   AGASSKLHAVSVTRNAVVRDKVLKDRDDAYWRTVVAMGAGNTDGDASVAPSSIWEEEEV
FT                   VRAMSRAMAGQGGVDLAKLGVSAAEYVNGVTAGLDDVDPPER"
FT   CDS_pept        join(complement(1619096..1619282),
FT                   complement(1618779..1619035))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055342"
FT                   /orf_name="AFUA_4G06310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90155.1"
FT                   /db_xref="HOGENOM:HBG054240"
FT                   /db_xref="UniParc:UPI000051FA01"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM9"
FT                   /transl_table=1
FT                   /translation="MASLKESLAGPGFVILNAIRVFNIIVFLDIIAASIVMIVKISLLS
FT                   SFFFFQAVSHVMAAGISIFLILSELPFFRGYFDRNWPLLGQDSGFVTLAVAMLILGMGV
FT                   LGDLNTPATSQESLGLAFWRIVVSAGILAMVMSVVNLVSVSRP"
FT   CDS_pept        join(1621215..1621277,1621388..1621472,1621548..1621597)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206602"
FT                   /orf_name="AFUA_4G06320"
FT                   /product="4F5 domain protein"
FT                   /protein_id="EAL90154.1"
FT                   /db_xref="HOGENOM:HBG054239"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniParc:UPI000051F02C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN0"
FT                   /transl_table=1
FT                   /translation="MTRGNQRDRDREKALKAKAKQKTANTLSGSEFQRAKENNAAIMRA
FT                   KQAAADARKAAEAAAARKKK"
FT   CDS_pept        complement(1622107..1623258)
FT                   /codon_start=1
FT                   /gene_family="HOG000187912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902019"
FT                   /orf_name="AFUA_4G06330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90153.1"
FT                   /db_xref="HOGENOM:HBG054238"
FT                   /db_xref="HOGENOM:HBG324353"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniParc:UPI000051F025"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN1"
FT                   /transl_table=1
FT                   /translation="MSTTEDAYQEISRIFRSRDTRILEIEILPPQVGPLLQDGCSIGIT
FT                   KKYLEQAFVTARCIFFKHLGSMADLDAPGMKCPDAITKDEVSIASQIILLFDCEHITAC
FT                   NWRKRRLDALIKGQDLHSTEEAGLESLVHALKTELSLMTTYLCSPLHRHTKSPTLWQHR
FT                   LWILNQMDKLRRPGPTVQLPQTAVLQRQEPSQSMLDTTAEFREMFQAEFAVVLRSGELH
FT                   PKNYYAFNYMRRLHVALTDTLNESEDRAESSAQLALLITEKALDWCLAHPADISGWMFL
FT                   LYLLETISYRETLLAIINKAVKFGVHVRWEGESLWTFVHLATTRFDVVETVWCQLCGLE
FT                   EATQTRLVAVDTLAHTAKSESKESWRTWMARAKACWSSGELAA"
FT   CDS_pept        join(1623645..1623731,1623831..1624017,1624109..1624437)
FT                   /codon_start=1
FT                   /gene_family="HOG000187923" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260075"
FT                   /gene_name="get1"
FT                   /orf_name="AFUA_4G06340"
FT                   /product="Protein get1"
FT                   /biological_process="transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90152.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054236"
FT                   /db_xref="HOGENOM:HBG737110"
FT                   /db_xref="InterPro:IPR007514"
FT                   /db_xref="UniParc:UPI000051F024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNN2"
FT                   /transl_table=1
FT                   /translation="MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSRNA
FT                   RQQSRLKREVVQLKREMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDW
FT                   SVKIARWLSTNGLKIFLQFYYSKTPVFALPAGWFPFYVEWVLSFPRAPRGSVSVQVWNS
FT                   VCATAIAVMAEIVTSMLLQLRSRSASPASTAKAQKAQ"
FT   sig_peptide     1623645..1623713
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNN2 "
FT   mat_peptide     join(1623714..1623731,1623831..1624017,1624109..1624434)
FT                   /product="Protein get1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNN2 "
FT   ncRNA           complement(1624788..1625161)
FT                   /ncRNA_class="RNase_MRP_RNA"
FT                   /gene_name="RNase_MRP"
FT                   /db_xref="Rfam:RF00030"
FT   CDS_pept        join(complement(1627096..1627225),
FT                   complement(1626368..1627037),complement(1625570..1626299))
FT                   /codon_start=1
FT                   /gene_family="HOG000187934" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260076"
FT                   /orf_name="AFUA_4G06350"
FT                   /product="Ribosomal biogenesis protein Gar2 "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL90151.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG054235"
FT                   /db_xref="HOGENOM:HBG324351"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FC51"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN3"
FT                   /transl_table=1
FT                   /translation="MGDQKKSFPHLVFGKGLIAVLQPSIQHTTTRNMAPDKKDKKRKAA
FT                   TTVTADSPAKKTKKVEAKPSEAPKETPKSILKKNKKDGPATEQNSTSKVKVNGEPTRQV
FT                   KPRKRAADFLSDDESEPEVVASEPKADTEEKKQPSKKKSKKEDGTPAPATKAKTSATAA
FT                   KPKATKAKKPEPVVEESDDEDNQQVPVVSDDSSEDEEDDTLDDQTAALIKGFESSGDED
FT                   ESGDEGFDPDQPVPKIPDSKKAKRKILKKQKKHDEPEVPGTVYVGRIPHGFYEHQMRAY
FT                   FSQFGDITRLRLSRNRITGRSKHYAFVEFASSTVAKIVAETMDNYLMYGHILKCKYVPS
FT                   DQLHPEVWKGANRRFKRTPWNRIEKKRLEKGKTREQWSERIEREQKRRLAKAEKLKALG
FT                   YEYELPQLKSVDEVPVQEETKAIEAADTTADEPKKAIEAPSAQESKEETTVDETPKKLK
FT                   KEKKASQSTPKQGTPKQDGEKASTKKGVNGAAASPATKAGTKDKKAKKVKA"
FT   CDS_pept        join(1627348..1627449,1627499..1627693,1627751..1627862,
FT                   1627919..1628025)
FT                   /codon_start=1
FT                   /gene_family="HOG000187945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750031"
FT                   /orf_name="AFUA_4G06360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90150.1"
FT                   /db_xref="HOGENOM:HBG054234"
FT                   /db_xref="InterPro:IPR010304"
FT                   /db_xref="UniParc:UPI000051F01B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN4"
FT                   /transl_table=1
FT                   /translation="MGKAKNANRPLTQEEIWDDSALVQSWDEAVEEYKLYHSIHAKGED
FT                   VEDVLREAEAAERAGLDQDRQQPDEAADAMEDDDAVATTASTAAEQSSSMQVPDAVEEH
FT                   AAATDQQPSGMKHPTQPAPAGAAAMPYAALAQVQDEGLKNLMMAWYFAGYYTGLYQGQQ
FT                   QASQNNNS"
FT   CDS_pept        join(complement(1629189..1629323),
FT                   complement(1628848..1629117))
FT                   /codon_start=1
FT                   /gene_family="HOG000216894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902020"
FT                   /orf_name="AFUA_4G06370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90149.1"
FT                   /db_xref="HOGENOM:HBG054233"
FT                   /db_xref="UniParc:UPI000051FA06"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN5"
FT                   /transl_table=1
FT                   /translation="MARFSLSFLALCFFLALVVSALPAKPGDDDLDAGDAVAAALSALK
FT                   AFEKLDQEKNNTPEKASPSHGATVKEATPTSQPIPSGTRTTVQTPASASSSTAAAPKKK
FT                   QSSTNMLSHIPIIGGVLGGGEGLGSLLPSR"
FT   CDS_pept        join(complement(1631871..1632364),
FT                   complement(1630929..1631811))
FT                   /codon_start=1
FT                   /gene_family="HOG000221741" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260077"
FT                   /orf_name="AFUA_4G06380"
FT                   /product="Sterol carrier protein, putative "
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="EAL90148.1"
FT                   /db_xref="GO:0004315"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="HOGENOM:HBG054232"
FT                   /db_xref="HOGENOM:HBG567272"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000051F77F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN6"
FT                   /transl_table=1
FT                   /translation="MGKKQVAPAYVLGVGMTKFIKPRGKVDYHELGFEAGVKAMLDAHI
FT                   NYDDVDQGIACYVYGDSTCGQRVFYQFGLTNIPIYNVNNNCSTGSTGLAMARTMVSHGA
FT                   ADCVLVIGFEKMSPGSLQSVYNDRANPTGLFGMMMAETRGITNAPGAAQMFGNAGREYM
FT                   EKYGAKNEDFAEIARINHEHSKRNPYSQFQDEYTLEQILKAPMIHEPLTKLQCCPTSDG
FT                   GAAAVIVSQAFLDARPHLKDQAILIAGQQIATDTSTLYNRSSIDLMGFGMTRYACRAAT
FT                   AEAGVNVKDIKVCELHDCFSANEMITIDALELCEPGKAHEMVRKGDITYGGKMVINPSG
FT                   GLISKGHPLGATGLAQCSELVWHLRGWANNRLVQGTDVALQHNLGLGGAVVVTVYKRAD
FT                   GKVAAAVPSDVVAKITGLGYNPAVEAKGFTAEQAKSVLSRKHNDQWALGDTQERVLARF
FT                   "
FT   CDS_pept        join(1634794..1634976,1635219..1635492,1635540..1635877,
FT                   1635929..1636135)
FT                   /codon_start=1
FT                   /gene_family="HOG000187956" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260078"
FT                   /orf_name="AFUA_4G06390"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90147.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054231"
FT                   /db_xref="HOGENOM:HBG324348"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000052056C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN7"
FT                   /transl_table=1
FT                   /translation="MTLDEHTEHAPFVSSPPEPSTVRMRADNTWIMDDATRNRFLKKYK
FT                   TQVASATSTICATLSVVDIALEFYAIDGSNIQNTGALPPLASVTAVRVVNFSTYNVAKH
FT                   RISEFVERITGESPLATYNTPGSSPTVSTLFTFTTAGFIAGLITSPLACPFELAKNVVQ
FT                   TSVLVAHRSQASPDAVRDPSLRTRPRLGTIEAIRQIVRRYGFRGLYTGFHLHAMRDTIG
FT                   SGLYFSVYETVKQLAAKELGPDKSPFGGPMIAGAICSTVPWFCTYPLDTRKTRAQSVLL
FT                   GKSKEVGEASAAVSKSSMYKGLSVILIRTGVNNMILLSMFEYIKMRINQLEG"
FT   CDS_pept        join(1636511..1636774,1636833..1636887,1636947..1637841,
FT                   1637907..1638884,1638933..1639245)
FT                   /codon_start=1
FT                   /gene_family="HOG000187967" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055343"
FT                   /orf_name="AFUA_4G06400"
FT                   /product="PH signal transduction protein PalA, putative "
FT                   /protein_id="EAL90146.1"
FT                   /db_xref="HOGENOM:HBG054230"
FT                   /db_xref="HOGENOM:HBG324347"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI000051ED8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN8"
FT                   /transl_table=1
FT                   /translation="MCLLMFFFRNILQVPFRRSHAVSLSDAITQYISSKYDQRPDMFAD
FT                   DLLIIDRLRNEAINVQEPHVSGISRLVTYAAQLKWLGGKFPVDVGVEFPWYPAFGFNTT
FT                   RPISQNNLRFELANILFNLAALYSQLAFSVNRTTSDGLKQACNYFCQSAGVLLHLRADI
FT                   LPDLRTSPPEDMDEMTLQSLEQLLLAQAQECFWQKAVKDGLKDASIARLAAKVSDFYAE
FT                   AGDCAVKSNAVSPEWIHHMTAKHHHFAAAAQYRQSLDCLEKRKYGEEVARLRDSEACVN
FT                   EALKESRWINRAVLGDLNGLKSRVSEDLKRATKDNDVIYLNPVPPKSELKIIDRACMVA
FT                   AKAPSQVTDAISMLGENGPLGQPLFAKLVPYAVHIAASIYSDRRDRLVNERVIGELETM
FT                   TDKLRDLLSSLNLPGSLQALEKPLGLPPTLVAHAEEMRQQDGLHRLRRSLEDIAKVKAN
FT                   DKAVYNEGVELLAAEKAEDEASRRKYGTDRWTRQTSEAAAPKLYTTSSEISGYFTSAQS
FT                   SDNLVEQKLRDSEAVFRVLTGTNRDLEMYVPSSRRAAIPPEVERELIRLRGCLSEVSRL
FT                   ESRRKRRAQALKEKARADDVTQALLKETARLEREFPMQPIQASQFEDLFEDQLHLYDSD
FT                   LEMVAQEQHDQDQIAAQVREANRAFTRAHKGDASTKEREKALQELENGYLKYKEIISNI
FT                   EVGRKFYNDLAKIVGRFRDDCKAFVHQRRMEASQLESDIASAAAMASLNISQPRLRQSQ
FT                   QPPHQPQLSSPPAAVQPPVQVQPSRPPEEPLTAPQPTRAPVAPPAVPTPGMWSPEMGIR
FT                   FGGGNNRGQPGQWDPSDGIRFG"
FT   CDS_pept        complement(1639323..1640120)
FT                   /codon_start=1
FT                   /gene_family="HOG000187978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260079"
FT                   /orf_name="AFUA_4G06410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90145.1"
FT                   /db_xref="HOGENOM:HBG054229"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI000051F012"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN9"
FT                   /transl_table=1
FT                   /translation="MTSPSDSWPAILTTAKHTPRTSTPKPDLPSPQQQSLIDSLRTLPR
FT                   MNQDVEADAAQSQAELKSAIADILSEYEDEDEDEDDKSCTSTSNENKTTIEEWENLHAF
FT                   LAFITKERIVRLEDVGIHVLRVALERGEPHQHQHQHHYSHRRYPETGTKMEMKTEQGGN
FT                   RKKMAVFVSCAAIWAVVMGEELWERRHETDECPVGLSLSPAQRASAAAAPTAAGEAAAA
FT                   TTVSKSRWQMWIDRFQFLSLAEDLDIKTRELAAEAAAVMRRVT"
FT   CDS_pept        join(complement(1643022..1643073),
FT                   complement(1642527..1642956),complement(1642291..1642469),
FT                   complement(1641201..1642230),complement(1640402..1641107))
FT                   /codon_start=1
FT                   /gene_family="HOG000187989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260080"
FT                   /orf_name="AFUA_4G06420"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90144.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054228"
FT                   /db_xref="HOGENOM:HBG324345"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EB5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP0"
FT                   /transl_table=1
FT                   /translation="MRPSCEACKVFQCPCIYDAVPKKRGPKTDVLEALLKRVDGLEKRL
FT                   QDENKNPMSPTSPVEPNKEPPDPSASMHALARPSTSSTSTTSVPPSEPFPRPFSFPSQP
FT                   SPPVHYFALPDSVLDAYFARIHGKPYFILDESVTRQSHQMGQLPVALSMAIYAITLRYT
FT                   SSPNPSEQSLRMALDYALQARRMVDVDQPTMDGLQVLLLLSQTFLAHGLGKKAYMTFTN
FT                   CASMAIALDLYREPPKSLPAGEREIRRRLFWAVYIMDRFLTCGSKRPGLIADHSIVLRL
FT                   PAWSPHTAGLNVEGELFNNVGPNIQYSSDPRRKPAATALLIDITRILGITNRYLAAGGV
FT                   KGDSHFPWHSLSNLSKIRQELDIWATGTQDVFASVEALFGHPESSILLLSKLIYHLVHC
FT                   LIYRPFLPIDLVELRGTGQHQSWQIEATNLCFSHSNAIAELVELARNSPLIEWPAFVGY
FT                   CVCTAGTVHVHGVHYKGREGEVFSSSAEFLTREMHQLTWLGSYWAGVQHQREMLQTIYT
FT                   CHAELVRTLATSPMRFSPVFHLEDFLDRYPGLTADGSHVRLVDMDDTPQLDPYYRSMPA
FT                   YPMYHNQPLRAPVTLPSNHNPSPRRDSHSTASTATKPPGVSSPSLTFPPSQHPQPSPQQ
FT                   LHSTFPLGNADLTHPSSSDASNHHNHNHNHSFSPPPPSAMFGFSPPAFLTESLPVAPTP
FT                   PSHPQYATFPFDSSSSNNNNNNNSNHQTHTGQTIMTPGAQSQASSSHTAGAGGGSSGSE
FT                   AGSIEKDPFLSLLEQLAENEQNSAGGPSELDFFLGGVDVEVGEKE"
FT   CDS_pept        join(complement(1644035..1644201),
FT                   complement(1643738..1643957))
FT                   /codon_start=1
FT                   /gene_family="HOG000048509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055344"
FT                   /orf_name="AFUA_4G06430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90143.1"
FT                   /db_xref="HOGENOM:HBG054227"
FT                   /db_xref="UniParc:UPI000051F77E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP1"
FT                   /transl_table=1
FT                   /translation="MMDKGYLLRSEDASQGAEESGQGMMTCTCALQKTRSRRSVSNGVK
FT                   GQWATGRQFGPADEEMIDFPGFCGLFFGCTSGGDGYSGLAWRLRLTLTLTLTLTLTLGL
FT                   GLGLGLGLGLGLDPYNPPHSGGTE"
FT   mobile_element  1644740..1645336
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  1645414..1646250
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        complement(1646627..1648819)
FT                   /codon_start=1
FT                   /gene_family="HOG000188000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902021"
FT                   /orf_name="AFUA_4G06460"
FT                   /product="Pentafunctional AROM polypeptide, putative "
FT                   /EC_number="4.2.1.10"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /protein_id="EAL90141.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="HOGENOM:HBG054224"
FT                   /db_xref="HOGENOM:HBG324343"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051F01A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP3"
FT                   /transl_table=1
FT                   /translation="MMQTAIHQPMAMTILADTAPSVTNNSASAPSPANGAHPPLATAVS
FT                   ANSAVAAAPPSVPADPPRTVVVVYRSGQDSIVHLVAEVLGKPWTTETSLSTLVTGSNAV
FT                   VVGILAAELARSLDECDPSTLIVINTHCVDDGSSPDEALTDRCDYEFLYSHSPFLRRDL
FT                   TRFLSLILGQTRPHEDLKTKTRTNFISTTFPDVHAALPNLDILSVGSDAVEIRVDLLVE
FT                   PSPQGVVSPVPSLRYVGQQVMLLRQHTELPIIFTTRCTKENGKFPMDDPMLFYRYLRRA
FT                   IQWGCEYIDVELWLPEEIRRRLAEQKGHSVIMSAFHDFSGTWKWTSPEAARIFAESARY
FT                   ADIVKMIAMVHTIEANYELEYFRSTVKARGAGDSSPLLSAVNMGQMGQLSRALNTVFSP
FT                   ITHPLLPMIAAPGQLTAAEINEAMHIMGALPKRDLYVIGSFRATPQSMFMEKCFNELSL
FT                   PHTLTSIDRGPKGTIEGVIMQPSFGGASVNPPISAATPYIPAVSEAARAIGLVDTIVVG
FT                   ESQSQSQSQSQSQSQSQSQSQPHGPPTARTLIGENATWKGIRATLTRDYVPSAYRGRAA
FT                   IILAGSESDASAAIYALRSLGVGSIYTVGFRATGPLAAGLEPFTSIQSVKLVEQPFVMV
FT                   SALPPEKSLLVQPLLRHYRSNGRTSPRSTRGKVYLDLTASSGERKGDPVGVAVNAGWTA
FT                   YGIDEVTAWTTVETMRLLVGQNVPFDFVRMASGRIY"
FT   CDS_pept        join(complement(1654195..1654825),
FT                   complement(1651798..1654113),complement(1651487..1651741),
FT                   complement(1651283..1651422))
FT                   /codon_start=1
FT                   /gene_family="HOG000188011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750032"
FT                   /orf_name="AFUA_4G06480"
FT                   /product="DDENN domain protein"
FT                   /protein_id="EAL90140.1"
FT                   /db_xref="HOGENOM:HBG054223"
FT                   /db_xref="HOGENOM:HBG324342"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR005112"
FT                   /db_xref="InterPro:IPR005113"
FT                   /db_xref="UniParc:UPI000051FC6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP4"
FT                   /transl_table=1
FT                   /translation="MPYSSTPEASTTPLADYFWIAGVDGTEVLETFRRLGDEYRANSAT
FT                   SPGPALTDTIEEDADAEEAHDSRFDGLSRPNSTLPGWNSFQRFSMRSENAAEGNANGSN
FT                   SNRSSLTIKGAQSPRGSSFLEDFDFDKALFKFASERDSFLSDLSLSAGAITPASRPRSR
FT                   LRTQKITAEETPSQPSSLLRSGIGSVRRHMAFRDMNSMKRQPSVARQASIRTSRRLSNY
FT                   NSVIPAPQPLEFSPTMHPLKRRFEPVLLDRYPTKGMTEELKQRGTFPDYVPMFAFPNDI
FT                   NIVSSDQRPRSTWHGFTMTTDNGSRLHAICVIIWIPLNQRAAEELEKRCEEWRKENMTD
FT                   EERELAASLGERLASERAKLSRLLAKLPTVVSGSESREQLEDEISAVEEKIGLMTDLLR
FT                   PVRHGAASKIEGLTDGETGFWIPRAYGILGREENMTSFWKEWLKAIIVPMTDGGVQRVP
FT                   PSSPRMGVWQPLERYVMNLCTEAFSPNSSKTQVELAVRELRLFARKEAVNELPGSRNTD
FT                   LYALFRTLSLSNIIILFEYALTESRIIFLSSHTSMLYLATRALVDLLFPLQWTGVLIPV
FT                   LPARLIQALEAPCPYIVGIERRYEKVELPSDDFVLVDLDADVIESTVQPTPLPRHQRRK
FT                   LLSLLQLAAPHHSRCAVPTGPPAYAIETFPFDAFMSENPSIFNARAQSTQLAKYVSLNS
FT                   SAFGQQSVLPTTFQPLIFNAYLYARNEQAASRGFSSKGSDRPSTGSTSKTGSPPSPRDH
FT                   SPTSGHFPPSSRNDSGMALQASLREKRSGHFDASSRRSSSFGMEMRPGVPRRPSAPFLG
FT                   HAPNLSVTTLNTEYNSGSTYAPSVYAQSTVAASTIVPQSVAQPIHNAEGTCWVEGHCLQ
FT                   VVPADDKAVCAVCDERAEDGMYRCSACKTLVHNRCALQICLVCPAAFHPEQVRAAFVRC
FT                   FASLFYTYKKFLQPATGDKKKAGLTYSFNMEAFLKSLPSEHAEYIAVLQHTQGFNEFIG
FT                   ERERVNPKSKDPRLALFDEIVLSKRNRGRSSLFSSRTTTDFLSDTSNHLWRTASATSFP
FT                   PSSRGQQTLSGDYTRIVTRAPAKLDTSLMKEPRMINGAPRVSKTANNARRKPLPNLMNG
FT                   LAISPP"
FT   CDS_pept        join(complement(1660622..1660868),
FT                   complement(1658235..1660570),complement(1658031..1658198))
FT                   /codon_start=1
FT                   /gene_family="HOG000188023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206603"
FT                   /orf_name="AFUA_4G06490"
FT                   /product="DNA mismatch repair protein (Mlh3), putative "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="EAL90139.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG054222"
FT                   /db_xref="HOGENOM:HBG324341"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="UniParc:UPI000051E479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP5"
FT                   /transl_table=1
FT                   /translation="MPSEDSRIEPLPPEVVAKIKSSTSIINLNRVVVELVKNALDANAR
FT                   TVSVTVDFHRGGCVVEDDGDGIPPAEFESDGGLGKAHHTSKLYSARAVYGRRGLFLASL
FT                   ASLSLLTVISHHVRYNSTNSVIFHHSTPIARFIPAPSSHQLSCSSHGTRVIVNDLFGNM
FT                   PVRVKSRALALQKPDEFERQWDDLRRLLVSLILANDHLTKLVVSTAGKERKLMIRPHVG
FT                   RPGIRGDLDLKRIASILMQAGLIESQNSDSWNYVSASVPGISLRAAVSLVPSPTRKVQF
FT                   ISIGIDPVYPRNSTDLLYSEINRLFALSDFGAVEAAPVSSDGHPGPRFTSKAVNKWPMF
FT                   YIRIDVDDPRELFEEGHEVVPESNQSVQRLIDVLVAMMSEFLKQHGLRPRAGRQTKDVS
FT                   RSASVESPGAGRSNFAKSVSSRDRSSIAEEALAGQLKLPTFRRLTSTNTTSDFATWSRV
FT                   KCAREPPASKHELAGGLKKAHSGPAWESGDRESLSLCLETDDSSVGNNLDLEVTENDGS
FT                   DADASIPWTDPHTGYSHLINARTGQAINVRSPSTEITVDERPRSAGTIQTLRALDRSRP
FT                   RSAISSTSHNIWVESLLRRWENPAFRRPERPITAISDGESHRNMSDNGLIRPFDCSRGS
FT                   YGLDDFGLAKFRGRLSKSHLATANVIAQVDRKFILVKLADGRSSRSALVLIDQHAADER
FT                   CRIESLFGAMFADGHRQVQSIRIDPITFDIPLMEAALFGKHADSFASWGVGYTVERKSS
FT                   ARAALVVVTSLPTLIAERCRLEPDLVSDMIRGEIWKHEENGQGALALSDQRAQRSKVHR
FT                   DELGVETEGNWVDRLTSCPQGIIDLLNSRACRTAIMFNDMLTAEECKSLCAHGRPSMVP
FT                   ILDVRESEEFLGKSIECEYEYEREDGRRQLDFLEAFRSWQGLGGN"
FT   CDS_pept        join(complement(1663466..1663648),
FT                   complement(1662405..1663364))
FT                   /codon_start=1
FT                   /gene_family="HOG000188056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260081"
FT                   /orf_name="AFUA_4G06500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90138.2"
FT                   /db_xref="HOGENOM:HBG054221"
FT                   /db_xref="UniParc:UPI0000F51C46"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP6"
FT                   /transl_table=1
FT                   /translation="MGNFISLFLKGLIFPLKIIVKITARVIDLLEGKELYGLDHAILSV
FT                   EVPPAKGMWMNMGYWKHTSSFPEACEALLEQVLITAKLLNEDRTPITFDADNDFQSEPF
FT                   IHEMKLVDVGIGCGDQSLYLTRRLSRKAGIPTASAGGMREASSVRPLFDSYVGLTVVKS
FT                   QAEFARERLSQVRSTTDLAGASEETTDVKIFAANAADPSSWESSLHRAVFGQSVKGEPI
FT                   QECPKKTQTWLLALDTLYHFQPSRDRLFKCAYQDMQASIMAFDLLLSEHATLWEKFVLR
FT                   LMCLVAGMPYGNFVTKTGYKQILKHAGYESTLIEMRDISEHVFPGIARFLRKQDAELSK
FT                   YGMTIGRYKGAANAFDWWGQTGVVRGVIVVARRSENLGAE"
FT   CDS_pept        join(complement(1665777..1665896),
FT                   complement(1664459..1665712))
FT                   /codon_start=1
FT                   /gene_family="HOG000188045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055345"
FT                   /orf_name="AFUA_4G06510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90137.1"
FT                   /db_xref="HOGENOM:HBG054220"
FT                   /db_xref="UniParc:UPI00005207E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP7"
FT                   /transl_table=1
FT                   /translation="MREASKQTVAVIGSGMAGLVAAFLLHRDSKGRYRVEVFEKQDQLS
FT                   LDSASYTLEAATDELPHRVDIPMRAFDDNYHINLKRMYDFLGIDYVSPKFLYSLSRICP
FT                   SSGKREPPYFIHSSSNHQVPPIRPRSRSRMDWIAETLYLTVCYFWFIVCCFVIGPKGKS
FT                   VSCGDESFRRYLERIRLPQYFSRRYLLPLLSSMTTCSHAELLDFPAIDVVDYATRTYRQ
FT                   PHYTVVGGVHRVQARISDGLAIRLHSTVTAVEAAGTRCRITWIDSQNDKVSSAEYDHVI
FT                   MAVTPDVVAAIFKPLEKPLRSIPTVKGDCIVHCDTSILPDGGLLCTEAKKALEPPEIMY
FT                   MVSDNNSTESVHIHRSSVMVTNFPIEPINSNKIIHRARLTRVLRTVRSREVVNRIFSAS
FT                   QSQNTLSEKEQLWRNGDGNVWLVGAWCWDGMVLLEGCIVSAMRVAACLGVDIPWSKEE"
FT   CDS_pept        join(1669026..1669059,1669118..1670427)
FT                   /codon_start=1
FT                   /gene_family="HOG000188034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750033"
FT                   /orf_name="AFUA_4G06520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90136.2"
FT                   /db_xref="HOGENOM:HBG054219"
FT                   /db_xref="HOGENOM:HBG324338"
FT                   /db_xref="UniParc:UPI0000F51C34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP8"
FT                   /transl_table=1
FT                   /translation="MATADVPARTHVRSGRRHPFSSWMKRLTGLKGSSTDSGTIRWSHK
FT                   RHDAHKNKRNNKNNPYPLSGTTNVVREYSSDFVPSVSDTNAANGPRSCSYSEPSIACSG
FT                   HDNQVPATSAKSTAPTISTNGDTAISEAAYSKSGTMATAGGGISSQGGGEGSTFSSPAP
FT                   SVRSLTTTLTTVQSAAPSIHFYNVQSTHQGLAHANSTHSNASQQVQFSQPFPSSPATAV
FT                   PPHLVPHGHSHTYSTATANNILTDNASILTLASSSKRRRRNSLDTNASVRALAPSSVFG
FT                   GSRESLPLSVLSANVGEPSNTSTFSTPGVLNRPSMVGLASAERISVYSASGAIASGERG
FT                   SYHNKPNPGAGDGASVKSAAYSHSRNDSYAASISGGMGVAIASGSVNQPMTGRVSRRSS
FT                   GWGEITGDECDREKEDKEERPAELKEEDSFDDVPEGTTETTTTVTTKN"
FT   CDS_pept        join(complement(1674221..1674518),
FT                   complement(1673002..1673621))
FT                   /codon_start=1
FT                   /gene_family="HOG000188067" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260082"
FT                   /orf_name="AFUA_4G06530"
FT                   /product="BZIP transcription factor (MetR), putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90135.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG054218"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000051FEB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP9"
FT                   /transl_table=1
FT                   /translation="MSGYNGRRAPNFSQYLEDLNAIPSPYDQALQQQQRQDTFNLDAEL
FT                   SLFTNTEFFDFDNLGDLNLPSFDAVNEDSAKTTDQQHGGPAAHNPDMEFLDLLGDGFGN
FT                   MPDFSAANLNSINSQFPAQDTQFSTIPSIPSGLSNAPFNANPTPSQSSSSAASPAGPAT
FT                   SPIAAQAPSATTAAGPKRKNTQKPAPMSVEEAARIAAEEDKRRRNTAASARFRVKKKLR
FT                   EQALEKTVKETTEKNAALEARVTALELENQWLKNLITEKNGKSAEETKKSETDIANMFK
FT                   KFLSSQKADAERSSSESKIGVGTA"
FT   CDS_pept        1677281..1678693
FT                   /codon_start=1
FT                   /gene_family="HOG000188100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902022"
FT                   /orf_name="AFUA_4G06540"
FT                   /product="CHL4 family chromosome segregation protein,
FT                   putative"
FT                   /protein_id="EAL90134.1"
FT                   /db_xref="HOGENOM:HBG054217"
FT                   /db_xref="HOGENOM:HBG324336"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniParc:UPI000051E464"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ0"
FT                   /transl_table=1
FT                   /translation="MARPKAIRAPTAASLPNTLRLPSSTSSLIKSFSRLSRHALLDLVF
FT                   QWLDDRNAQLFPPYLQKDEIENPADDKLSPYPAAETIEDVRNAYQDLQDRKGGKREVID
FT                   RILEGDWRHGITLRQLAMVDIRYMEDHPASLRWTAFELSRIGMDGTQSAGATTPDVSAC
FT                   LPRIHATTFLSNLQQQISPLVKAHYHLVRSSSLPLSFLRILVTSSPYQNPRQPPEALMD
FT                   SSRVMYVAFPDSCPFIYTSIATSPVAKSNTTTNHAVATDARSLQRIVRDALPKALSRPQ
FT                   ERYALKATSLTAKNLQALLALRGPGRSNVAHGAFSIFADAVLEGSPLDPRPSDTISPRE
FT                   HFYQDLDKENENQEDGNTSKETEPSSHVAKKRKLAVHSRFGTTGTLSSAPLDRLDVRLL
FT                   DPADDEDDEHEVDHTQPSVSLTFVGSDVISGIRKLAELGVVDPERMPSWMTGEEAVSVA
FT                   VVHRGKRVVKAG"
FT   CDS_pept        join(complement(1680230..1680554),
FT                   complement(1679979..1680170),complement(1679774..1679835),
FT                   complement(1679482..1679717),complement(1679274..1679427))
FT                   /codon_start=1
FT                   /gene_family="HOG000188089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055581"
FT                   /orf_name="AFUA_4G06550"
FT                   /product="RING finger domain protein (Znf1), putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL90133.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054216"
FT                   /db_xref="HOGENOM:HBG324335"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000051F019"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ1"
FT                   /transl_table=1
FT                   /translation="MGSTRTTASCQIITGSSPARGRMYSVAPGNTRSATKRKRDADDDI
FT                   KFLATPVKNARRRVNPTSAASAGSTEVIDLTADSPATTPTKKTRSPKKRLPGQPAPERR
FT                   ARPFRFGLAVPLFVRCSLTRPLSRMCVVEHCVTEVDDAPEVVFTMAGTTGNLYKVVIGK
FT                   VPSCDCPDGVLINALKAPAHLQYQLAFLSSELREMYQSSPLSSQKEQSEDNNGKRKPIE
FT                   GDCPICFMELEPEKDEIVWCRAACGNNVHKACFRQWAATQNAQGVRCVYCRSAWETGSS
FT                   ELDLKQLTKDGYVNEEGYVNVGHLLGMPGERGTRPSLYLSP"
FT   CDS_pept        join(1681727..1682116,1682170..1682463)
FT                   /codon_start=1
FT                   /gene_family="HOG000188078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902270"
FT                   /orf_name="AFUA_4G06560"
FT                   /product="DUF974 domain protein"
FT                   /protein_id="EAL90132.1"
FT                   /db_xref="HOGENOM:HBG054213"
FT                   /db_xref="InterPro:IPR010378"
FT                   /db_xref="UniParc:UPI000051E6CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ2"
FT                   /transl_table=1
FT                   /translation="MQTPSQVASLDLEPANDPAQTEGLQRGQSLQKIVRFDLKEEGNHI
FT                   LAVSISYTETLIGSDAQAASGRVRTFRKLYQFVAQPCLSVRTKSSELAPLEVENKSLGP
FT                   YGKTRLLRFALEAQLENVGDGTVVVKQTKLNPKPPFKALSLNWDLERPDKADSQPPTLN
FT                   PRDVLQVAFLVEQEEGQQEGLEALQKDLRRDGRAVLGQLSIEWRSAMGDKGFLTTGNLL
FT                   TRRRS"
FT   CDS_pept        join(complement(1686422..1686967),
FT                   complement(1683411..1686368))
FT                   /codon_start=1
FT                   /gene_family="HOG000188111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902271"
FT                   /orf_name="AFUA_4G06570"
FT                   /product="Ras guanine-nucleotide exchange protein, putative"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL90131.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG324332"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="UniParc:UPI000051FC5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ3"
FT                   /transl_table=1
FT                   /translation="MEPMKRHIAPLKVEKTITNPCGSTTSESGDPSSNHHYSTQHSLQL
FT                   SPPLTPYCATSSKDNSMDRTEAPRAVFHNYLRAFYPFHPPGDVSPDTITLPLDQGDIIL
FT                   VHSVHTNGWADGTLLDTGARGWLPTNYCEAYDQLPMRPLLKALTDFWDIIRGGCGSSLR
FT                   DFGNQDLVRGLIAGVRFLLEKSECLTRDSFLVRRHEGLRRNRKALLSDLTALVRTTKSF
FT                   QVIASGNPLQDEVEYMVDEMLLKAFRVVTRGVRFLDIWNEEVGLSRTIAELEQSKDHTS
FT                   PLTPASETFVMSEKAPSEAETERNESRVLNSSRMSMSRCSTRVDMSEQPRPVSVATKRI
FT                   SISHRVSYSGPAAASRNPNLASERLNATYDAFLGVLGSFIGLHLQSRSSTELVVTTEQA
FT                   VRSCRGLLTVVEAVCEHDSQGSSLLESAKDAMYERLSELVFAARDAFRPAQSPDDELVF
FT                   MPDEGKRLVDAATDCVRAAGNCLAKARLVLEQVGDFELEALPQDVATPLVGAGPESQSQ
FT                   QQKGDQPELSMRLPPPPLQIPQNADLDSSPPTPGLTDDTTPSSSFNSRNLSNPTIAATD
FT                   EASLPSANIPPPSPAKSSFSSSCDAAAGVKVLENRISHPKSEIGESFGRGVTSTGSSFT
FT                   YHSHLRDSEMSGVSQTSTRATSPDIGSCYQAPSLKSCVSHSTLAEEGEETEVNILEKTY
FT                   AHELIFKDGQVMGGSLRALIERLTSHGSTPDAMFVSTFYLTFRLFATPLEFAEALVERF
FT                   NYIGDTPHAAGPVRLRVYNVFKGWLESHWRHDCDDSALDFIVNFAKTTLMQSLPSAGKR
FT                   LLELTDKVSTLQGPVVPRLISSIGKTNTATAQYVHPDTPLPPPILSKKEVNLLKQWKNG
FT                   EAAISILDFDPLELARQLTIKESRIFCAILPEELLATEWMKKSASLAVNVRAMSTLSTD
FT                   LAHLVADSILQLEEPKKRAAIIKQWVKIANKCLELNNYDTLMAIICSLNSSMISRLKRT
FT                   WEVVSQKTKATLETLRGIVDVSRNYAVLRQRLQTHVPPCLPFVGTYLTDLTFVDHGNQP
FT                   LRSLPTDDGEMTVINFDKHMKTAKIISELQRFQVPYRLTEVPELQTWMQNELVRVRSNG
FT                   EKSLQTFYRRSLILEPREITPRPNLQPESSASSIMENARDKFDLFAWTHPSKAKSVATN
FT                   S"
FT   CDS_pept        1687849..1688088
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261069"
FT                   /orf_name="AFUA_4G06580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90130.1"
FT                   /db_xref="HOGENOM:HBG054212"
FT                   /db_xref="UniParc:UPI000051FC6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ4"
FT                   /transl_table=1
FT                   /translation="MVVGLQGPPPLGPSNLGGKDYGDGRENSSNRVEAVDKILVPIDST
FT                   LDRPTMRGKVVGFVDSGPPQTHKQGLTNTNSREE"
FT   CDS_pept        join(1695939..1696197,1696268..1696308)
FT                   /codon_start=1
FT                   /gene_family="HOG000216893" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261070"
FT                   /orf_name="AFUA_4G06590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90129.2"
FT                   /db_xref="HOGENOM:HBG054211"
FT                   /db_xref="UniParc:UPI0000F51C21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ5"
FT                   /transl_table=1
FT                   /translation="MGPKAYLSLLLLLTVAIACAAPIRRPISALHTRRDPGPDAAAESL
FT                   DSLLPSPLDLPLPKPEPLDVDSMLAHSPLSDFYKIIKEEVKVDMPNMRHKNRPV"
FT   CDS_pept        join(complement(1699266..1699872),
FT                   complement(1698964..1699214),complement(1698857..1698919),
FT                   complement(1698308..1698808),complement(1697724..1698255),
FT                   complement(1696607..1697676))
FT                   /codon_start=1
FT                   /gene_family="HOG000234637" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902272"
FT                   /gene_name="nut1"
FT                   /gene_synonym="med5"
FT                   /orf_name="AFUA_4G06600"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 5"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="EAL90128.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG054210"
FT                   /db_xref="HOGENOM:HBG324329"
FT                   /db_xref="InterPro:IPR014801"
FT                   /db_xref="UniParc:UPI0000F51BDF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNQ6"
FT                   /transl_table=1
FT                   /translation="MTSPVQWGTFFHQCLLHRIDANEFRNLSKLLLQKCPIAETALLDA
FT                   LLQTRSESRIKWDPLLPLYIDCLCRTGRVRTSTVLTSLLKYSSIHDKPQLSTSEGKDGS
FT                   KCYTLMTDIRVIQDTMLSVSTGSTPKTNAEAVAIFFAIIDWIHAVASWHNSHFDPGQHS
FT                   SGIMSSPDVVSLFESLGILLAALSGTGKGLEVLSADSHEGLKVKLGQALSAYLPLCVEV
FT                   SLPLRNRLDGLQKEFNLYGERVPKSLDVPMMENMNVNALQFEASVMDGPVINSRAGLYV
FT                   FINAMLVGRPLVDDGMLINYLANRYGGHYEALVEEILTASFDVLSNGMYRNESSRMMFV
FT                   FRSFLVNKLPPFFAAMLASTMVSIPMEMCISHALSRLDPNTFPSFSQMFEMQGNTVLSD
FT                   VRQEFLFACASHKLIPESSIERLLGENPMQTLPVGYNKDELVSQINANPERAEQLINEI
FT                   ESMEGNAGAIIGAITEVMHNLCNQKETMTLKNICNSLSRRPQALDVVLIFRNPKQVLQP
FT                   LCALLDSWHWDEDQGEYQPVYDEFGSILLLVLAFKYRFDLRPADLGISSSDSFVLRLLE
FT                   RGSCSQKLDALDEKQNKNLGSWIAALFIAEGISEETMSACSPQEFYLLVATLFSQSLEA
FT                   CETGKLEFDTLKGGFEYLLEPFLLPSLIFALTWLGDHIWEMELDPSIPLKVLHSLVNPS
FT                   SISGEAREIHRTVLNIAARTLEEQLKDVRTRHPSRTDIKPILDSLEPCLSFQLVGSSHR
FT                   SELEGWTTHSSGGLLGSIRSTFQSLVLWSTNPEVSMAPPPYTHRQLIAGVRMLGASRVL
FT                   PALIEELKLQTEAGNGPLALDLAATLICAPMAETFSVEQNSHQPVDPNKEALPRCGILT
FT                   LRDVLALQHENVPKISEKDPLRAEVLVRLYRRVNALLAPPSQVPNLDVNNIIQNMQLGG
FT                   VGVGAGQMELDATGAADHGVGPDDAENIHRMIDNAAAAAGLDSSGTGLDTSIDDVLNAA
FT                   DMAVGNPEFLDLDMEGMF"
FT   CDS_pept        complement(1702474..1703148)
FT                   /codon_start=1
FT                   /gene_family="HOG000188122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261071"
FT                   /orf_name="AFUA_4G06610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90127.1"
FT                   /db_xref="HOGENOM:HBG054209"
FT                   /db_xref="HOGENOM:HBG324328"
FT                   /db_xref="UniParc:UPI000051E6C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ7"
FT                   /transl_table=1
FT                   /translation="MASAQHFEPDTIINLSGSSQEAAHGTIDIFEWYPHYQSCQRYLLD
FT                   HAQHSVTVQALCAFLNIRLPFQRIPHPVSSSSSKTSTPSAGLTSSVSESSPHPAPFVSL
FT                   IPYIRRLVATGMDSPGVLQGFFGDDWTAGVGYLHEQERRNYLFAAKSGGWAAVKRDYDM
FT                   PPLETIPFLRPLQGTVDSEIEAAERSWSEWLAMEDWMVGPRAPDALRGSSSHMSCPRSS
FT                   GG"
FT   CDS_pept        join(1708834..1708879,1708941..1710271)
FT                   /codon_start=1
FT                   /gene_family="HOG000243799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16261072"
FT                   /orf_name="AFUA_4G06620"
FT                   /product="Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase, putative"
FT                   /EC_number="1.4.1.4"
FT                   /function="binding"
FT                   /function="glutamate dehydrogenase (NADP+) activity "
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL90126.1"
FT                   /db_xref="GO:0004354"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054208"
FT                   /db_xref="HOGENOM:HBG590661"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EDB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ8"
FT                   /transl_table=1
FT                   /translation="MSNLPHEPEFEQAYKELASTLENSTLFEKNPEYRKALAVVSVPER
FT                   VVQFRVVWEDDNHQVQINRGYRVQFNSALGPYKGGLRFHPSVNLSILKFLGFEQIFKNA
FT                   LTGLNMGGGKGGSDFDPKGKSDNEIRRFCVAFMTELCKHIGADTDVPAGDIGVTGREIG
FT                   FLFGQYRKIRNQWEGVLTGKGGSWGGSLIRPEATGYGLVYYVDHMIKYVTKGAESFAGK
FT                   RVAISGSGNVAQFAALKVIELGGSVVSLSDSKGSLVVNGEGSFTPAEIDIIAQLKVDRK
FT                   QLSEVATTEAFATKFKYIEGARPWVHVGKVDVALPSATQNEVSGEEAQALIDAGCKFIA
FT                   EGSNMGCTQAAIDIFEAHRQANPGAAAIWYAPGKAANAGGVAVSGLEMAQNSARISWTA
FT                   EEVDSRLKDIMESCFRNGLDTAVKYATPAEGVLPSLVTGSNIAGFTKVAEAMKEQGDWW
FT                   "
FT   CDS_pept        join(complement(1713735..1713878),
FT                   complement(1713522..1713653),complement(1712998..1713466),
FT                   complement(1711685..1712942),complement(1710884..1711622))
FT                   /codon_start=1
FT                   /gene_family="HOG000188134" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206877"
FT                   /orf_name="AFUA_4G06630"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL90125.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054207"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00005207BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ9"
FT                   /transl_table=1
FT                   /translation="MADRRPEVLVVSVIFFALATVFVALRFVSRIFVVRRVGLHDYLML
FT                   LAWLIDFGFSFSLFYATSKGLGLHDHDIPLDDRPGLNRADYAFTVLYNPALMAVKTSIL
FT                   VFYLTLTKGEKVFRWANYVTLFAVNAAGLALTLVNVFQCRPVHAAYSYPLPPDAHCIDI
FT                   LTLYLSSSPVNIITDLAILFIPNPILTQMRLPRKQKIILVITFSFGFFVAVVDVIRIAY
FT                   IQDAATSRQIAVKDFHYQSASVDDFNWYASLSFMWSVVEVNVSVMCACVPSLKPLVARL
FT                   IPKLIRDTDESTPNTADLNHPPSVEPPTALPQGAVAVPVNVPPSPSKSGSPRTRNKPSQ
FT                   SGSRSSGSVADTRGTQPGSMDMLEFLTSPEPARHDAEANTATLTSTSSPHSITFFDFVN
FT                   MNNPPSMLKLTNKESIAPNALTTILFFMWGVAYGLLDILNTQFQQIVRLDSWRSLGLHA
FT                   VYFGGYLVGPPLVGRTVLKRWGFKSTFITGLCIYACGTLVFWPSAVLTSYSAFTISNFI
FT                   VGFGLAVLETAANPFIALCGPLENSEIRLNISQGVQAIGSVVSPLLAKKVLFKRVTDVG
FT                   SLVDVQWTYLGIALFDVLLAVAFYYLPIPEASDEDLEELANRRREDNMTKVLGVPVVWL
FT                   TLGLGVFSQFFYVAGQEVLSRSFDSFVVAANPSLGAFEYLTIGHTVFAIGRFLTAFMQW
FT                   FLKPRWVLMLSYIGMIVFAVLCMKTTGSTAVAMSLMVYLFESGAFSTIFALSLRGTARH
FT                   TKTAASLLATAISGGAFFPFAQYAAELSGGVSYSYSVLVALFCAGAIFPLYLNFVPAAK
FT                   KQVDPVPDEYLRRHRRRRSCVAANKTLAPVPREKDNPSVGGVLSRRRSVLSDPLPTINL
FT                   PETTYNPMSSPSRTNLPEKQSSSSSARSGGGLMHDLAPWPES"
FT   CDS_pept        join(1716178..1716303,1716359..1716445,1716512..1718182)
FT                   /codon_start=1
FT                   /gene_family="HOG000216889" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902273"
FT                   /orf_name="AFUA_4G06640"
FT                   /product="Acid sphingomyelinase, putative "
FT                   /EC_number="3.1.4.12"
FT                   /function="sphingomyelin phosphodiesterase activity "
FT                   /biological_process="sphingomyelin catabolic process "
FT                   /protein_id="EAL90124.1"
FT                   /db_xref="GO:0004767"
FT                   /db_xref="GO:0006685"
FT                   /db_xref="HOGENOM:HBG054206"
FT                   /db_xref="HOGENOM:HBG324326"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR011160"
FT                   /db_xref="UniParc:UPI000051FEB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR0"
FT                   /transl_table=1
FT                   /translation="MRLTTFVAALASLATIHGASSENWASTIWDDIKETITCAGCEGLL
FT                   GTLKLVAGLGENVLINVLTDVCKLAKVEDPDVCAGIIRAEGPAAYYVLKQLKVGSHTSK
FT                   SFCSQMVGLCDYPEVRPYKISFPVPKPSTHRPPPSGQPPIRVAHISDTHVDRAYETGAN
FT                   YECSKPICCRVYTENDAPGKTSFPCGPYGHPKCDPPLRLEESMVAAIAAMDPAFSIYTG
FT                   DVVPHDVWSVNQTEVLHDLNATYSLLDQLGLVYAALGNHDTAPVNLFPSERIPLSHNPQ
FT                   WAYDALAEDWTNLVGGPLSAPVVHATDQFGSYSAVHPGGKLRIISYNSVFYYTYNFYAY
FT                   QEPMEYDPNGQLAWLISELQAAETAGQRVWLIAHIPTGGTDTLHDYSHYLDQIIQRYDA
FT                   TIAALFFGHTHTDLFQVSYADPAHPSADSASAVGYITPSLTPTSGPPAFRIYDIDPVTF
FT                   AVLDYTVYTANVSTEATPQWTKYYSAKESYGSLITPPVTDPTAELTPAFWHNVTVLMET
FT                   DNSVFQAWWARTTRGFKVRECNAQCARDQICSLRAADAQYGCVRGTLSITKRDGLNLAG
FT                   VAPASASGPQVHVHSTRPQCEEGGLARVLAAVIRETDDLQGLLLQRAELYI"
FT   CDS_pept        join(complement(1722248..1722463),
FT                   complement(1721926..1722084))
FT                   /codon_start=1
FT                   /gene_family="HOG000048510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055582"
FT                   /orf_name="AFUA_4G06660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90122.1"
FT                   /db_xref="HOGENOM:HBG054203"
FT                   /db_xref="UniParc:UPI00005207D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR2"
FT                   /transl_table=1
FT                   /translation="MTFADRLAKDAARLGKTHPFPLLSRESACLPGNILHQWEQEMEGW
FT                   SPIERSKASFQKHTKEKAIWKPSQELSREVGDVFSSVSSLLGGLTKDKKGKPDTVSREK
FT                   TVKAALDFAEASQWFWSRAP"
FT   CDS_pept        complement(1724024..1724836)
FT                   /codon_start=1
FT                   /gene_family="HOG000188145" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19055583"
FT                   /orf_name="AFUA_4G06670"
FT                   /product="Allergen Asp f 7"
FT                   /protein_id="EAL90121.1"
FT                   /db_xref="EMBL:CAA11255.1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000051EB74"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42799"
FT                   /transl_table=1
FT                   /translation="MAPIFKSLALVSALFAAISSAAPVNLDKREVDVVWTTVTTVVWTT
FT                   IDVTTTIYPTPQAPTPPVVESTPTPTPSAAPEQAEPIETSTQPETTKSQPTQPSVATFI
FT                   PVAAAAAAADSAAPIPEEPAPQPATTAAPSTSTTTQAAPSAPPAANSGSTEKAASSGYS
FT                   GPCSKGSPCVGQLTYYDTATSASAPSSCGLTNDGFSENVVALPVGIMTDADCGKTVTIT
FT                   YNGITKTATVVDKCMGCKPTDLDASRHLFGELADFSAGRIDGMSWYFN"
FT   mat_peptide     complement(1724027..1724773)
FT                   /product="Allergen Asp f 7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42799 "
FT   sig_peptide     complement(1724774..1724836)
FT                   /db_xref="UniProtKB/Swiss-Prot:O42799 "
FT   CDS_pept        join(complement(1730423..1730441),
FT                   complement(1730142..1730299),complement(1729139..1730079),
FT                   complement(1727623..1729084))
FT                   /codon_start=1
FT                   /gene_family="HOG000057035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16261073"
FT                   /orf_name="AFUA_4G06690"
FT                   /product="Ribonucleotide reductase large subunit Rnr1,
FT                   putative"
FT                   /EC_number="1.17.4.1"
FT                   /function="ATP binding"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /biological_process="DNA replication"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="ribonucleoside-diphosphate reductase
FT                   complex"
FT                   /protein_id="EAL90119.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005971"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054200"
FT                   /db_xref="HOGENOM:HBG296647"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniParc:UPI000051E6E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR5"
FT                   /transl_table=1
FT                   /translation="MFVYKRDGRKERVQFDKITARVSRLCYGLDPEHVDAAAITQKVIS
FT                   GVYQGVTTVELDNLAAETAAYMTVTHPDYAILAARIAVSNLHKQTKKQFSLVISDLYHY
FT                   VNPKNKQPAPMISKETYEIVMKHADELNSAIVYDRDFNYNFFGFKTLERSYLLRINGKV
FT                   AERPQHLLMRVAVGIHGNNIEKAIETYHLMSQKYFTHASPTLFNAGTPQPQLASCFLVD
FT                   MKEDSIEGIYDTLKTCAMISKTAGGIGLNVHRIRATGSYIGGTNGSSNGIVPMLRVFNN
FT                   TARYVDQGGNKRPGAFAIYLEPWHADIFEFLDLRKNHGKEEVRARDLFYALWTPDLFMK
FT                   RVESNGDWTLFCPNEAPGLADVYGDEFDALYERYEKEGRGRKTIKAQKLWYAILEAQTE
FT                   TGNPFMLYKDACNKKSNQKNLGTIRSSNLCTEIIEYSAPDEVAVCNLASLALPTFVDAA
FT                   RGEYDFGKLHEVVQVLVRNLNKIIDVNYYPVPEAKKSNMRHRPIALGVNGLADAFLALR
FT                   LPFDSAEARQLNIQIFETIYHGALTASCELAKEFGPYETYEGSPVSQGILQYDMWDRTP
FT                   TDLWDWDSLKAKIAQHGVRNSLLVAPMPTASTSQILGFNECFEPYTSNIYSRRVLAGEF
FT                   QVVNPWLLKDLVDLGLWSDNMKNRIIADGGSVQNIPNIPADIKALYKTVWEISQRTILQ
FT                   MAADRGAFIDQSQSLNIHLKEPTMGKLTSMHFAGWKMGLKTGMYYLRTMAASAPIQFTV
FT                   DQEQLKVADTNVARANAAYKKRAAGSVPTTYSAVPRTTSAPLNGHSEDGSPRALAADVT
FT                   ADSETGVNGSQEEDDERESGERESDIYSQKVLQCSIENKEACLMCQG"
FT   CDS_pept        join(complement(1731674..1731771),
FT                   complement(1731456..1731604),complement(1731125..1731372))
FT                   /codon_start=1
FT                   /gene_family="HOG000188156" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261074"
FT                   /orf_name="AFUA_4G06700"
FT                   /product="GPI anchored cell wall protein, putative "
FT                   /protein_id="EAL90118.2"
FT                   /db_xref="HOGENOM:HBG054199"
FT                   /db_xref="UniParc:UPI0000F51C47"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR6"
FT                   /transl_table=1
FT                   /translation="MFFSKSTFVLSFLALGNIVAAAQTPACLLSVVGAEKNPADLKAVC
FT                   VTNGDDVQKKIANTCGDSEQAALSWFADTCDAAGYKVDIKSSTTTSESATGTSTKGSAS
FT                   NTGFVTATATGSSSSGENKSGTSSSSATSTSQTVSAGSSDRQVSAAAFAAVVFFGFAAT
FT                   L"
FT   CDS_pept        join(complement(1733275..1733314),
FT                   complement(1732497..1733167))
FT                   /codon_start=1
FT                   /gene_family="HOG000251927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261075"
FT                   /orf_name="AFUA_4G06710"
FT                   /product="Kinase-related protein"
FT                   /function="kinase activity"
FT                   /protein_id="EAL90117.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG054198"
FT                   /db_xref="HOGENOM:HBG659267"
FT                   /db_xref="UniParc:UPI000051F289"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR7"
FT                   /transl_table=1
FT                   /translation="MEEQVDRLVDKVWKKFHPLPENARLMIAISGIPGSGKTGLASIMA
FT                   NRINQLYSDQYASQPPIAADIPMDGYHLTRAQLAQMPDPEYAAARRGAAFTFDGEKFLR
FT                   LVQALREPITSETRILYAPSFDHAVKDPVDDDIPIAPTSRIIFFEGNYLSLNKEPWSSA
FT                   AKLMDELWFVEVDFETARKRLVRRHVQAGIAKDEAEADKRAMENDLVNGQEIVDNRMDV
FT                   QEIITSYYDTRWDR"
FT   CDS_pept        complement(1734173..1735450)
FT                   /codon_start=1
FT                   /gene_family="HOG000188167" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055584"
FT                   /orf_name="AFUA_4G06730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90115.2"
FT                   /db_xref="HOGENOM:HBG054196"
FT                   /db_xref="HOGENOM:HBG324321"
FT                   /db_xref="UniParc:UPI0000F51C30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR9"
FT                   /transl_table=1
FT                   /translation="MYRESSPEASKNKPIKDPSAAARSSIRRQAAIRRPSRHNTSTLRS
FT                   ASLHSPFPREIVDEIEREAHGLQRHIRSPVPNTTSGEDPFDLTSMISDANRREAGQRLL
FT                   HEALRHGRPGQRLRIPRNTFNLDSYRRASPGVDSGRRQSSEHAVAFTPSFAPAIAYHRR
FT                   VSPPPQTRPSLSSFPPEGFEVVGSTVPLLRRVGRRSVNEANRTMHHDTTVDGLGDRQRS
FT                   MSPDDDASNDAWETLLTTITPDDNLPSADSSFASASASGLNVSGSAGSRNQGRSFQTLP
FT                   SSLDSSTATVRMVLDPYPEYINPCDYPSSTDSDSASEGDSNQLSLWRRYRRRMHQMSTS
FT                   RRSDDLHSTMSSHPPIPAFSFAFSNSSTDPELQQMQAILDRLARREVIPDDWWAAAGLS
FT                   PTIGHRLGTNNGSNDTETTDASARPL"
FT   CDS_pept        1736250..1737515
FT                   /codon_start=1
FT                   /gene_family="HOG000019981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261076"
FT                   /orf_name="AFUA_4G06740"
FT                   /product="Dihydrofolate synthetase Fol3 "
FT                   /EC_number="6.3.2.17"
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="EAL90114.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG054195"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI000051EB66"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS0"
FT                   /transl_table=1
FT                   /translation="MIELGLGRISRLLQQTPLSWKAIHIAGTNGKGSISAYLSHMLTAG
FT                   GVRCGRFTSPHLIDRWDCITIGESVVQESLFRQIEERVRLRDQSLGIGASEFELLTATA
FT                   FEIFNHEHVEVGVVEVGMGGRLDATNVLSDVLVSVIAKIGLDHQAFLGDTLELITREKA
FT                   GIMKPGVPCVVDGTNAPEVIRTLENRVNELKIDAVYAHPDTICSQSPCLGRIFRELDLQ
FT                   RHQRANMSCAVSALRLALAKVRPGLEVDMLLPSLKNVEWPGRLQKISLSPLTARTEPVL
FT                   LDGAHNSQSAEVLGEYVNKNLRPQGKITWVIAASRGKDVTALFHSIIKSGDKVAITAFG
FT                   PVDGMPWVKAADTEDLALCIQSIPGVQDVRTFDGDVLAAINWACTEAGDCPLVIAGSLY
FT                   LVSDVHRLLREARKSAEIYRGH"
FT   CDS_pept        join(1738301..1738480,1738614..1738676,1738743..1739381,
FT                   1739434..1741212,1741263..1741467,1741523..1741973,
FT                   1742024..1742724,1743085..1743170)
FT                   /codon_start=1
FT                   /gene_family="HOG000188178" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206878"
FT                   /orf_name="AFUA_4G06750"
FT                   /product="Serine-threonine kinase SepH "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL90113.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG054194"
FT                   /db_xref="HOGENOM:HBG756758"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005207E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS1"
FT                   /transl_table=1
FT                   /translation="MVSRSSEGNEGPHPSSRTPGTPAKTRVSKLGSSPSKRDEKSGEGR
FT                   VVKSSAKDVAELKDYTVAVKQIKLADLPKSELRVIMLEIDLLKNLDVRLRYNKHSRPTE
FT                   LTEWLQHPNIVKYHGFVKSAETLNIILEYVSSSTDRLSIGGANKRRYCENGSLHSISKN
FT                   FGRFPENLVGLYMSQVLHGLLYLHEQGVIHRDIKGANILTTKEGLVKLADFGVASRTTG
FT                   LSESSVVGTPYWMAPEVIELSGATTASDIWSLGCTVIELLEGKPPYYNLQPMPALFRIV
FT                   NDDHPPLPQGASPAVKDFLMQCFQKDPNLRVSARKLLKHPWIVNARRSDSVVPKKSTEY
FT                   EEAVRSVQEWNEALRSPGAGTLRKPFRHDRQSPSPLRRNQLPSRNTPTKDALPAPVVSN
FT                   AKDQSLLSNATAEDNWDDDFATAISPSALQLPHLRPHDNFGGMLSSEKLKAFASLDGTV
FT                   IKSENSFGDFNDSFRTTLHCGESDPLQTIRPFPFKQTGTDDGFAQKSPLQMEPKRSTPF
FT                   VHNVPILTQNPVPPSRQARPASFYKENSVEDYSDIIITDEDVLGRKLNGVKVRMEANIY
FT                   PNVDDCLSDLFQETDEERYISNSADLPPSKEIVRYHTPSRDDEQEPHLRRQLSTKRHRS
FT                   AVEIHRFAENERDEDFSDILGPEEVALDKPDSDGSSDRSTLMLNSRHSNNSWLGDQDDE
FT                   DDPFAQLEEGLDEMDLEANIARDKYARLRGQVEGLVSSLKTSQDEDVLEDISEQLLTIF
FT                   CDLPETKNIIMSAHGMLPILEILDTCRRRNVVSCLLKIVNAIIYEDYEIQENLCFVGGI
FT                   PIINEFASKKYPREIRLEAAAFVQQMYQTSTLTLQMFVSAGGLNVLVEFLEDDYEDERD
FT                   LVLIGVNGIWSVFELQGSTPKNDFCRILSRSSVLDPLSLVLSRVLDEGGELAEIVEGRI
FT                   ASIFFVFSQAENHVKEMVAERTVLHRVLKELKRMTPAHQITMLKFIKNLSMLSTTLDSL
FT                   QNSNAIDVLTDLLRSTIKRPHFREVSNQILNTIYNMCRLNKSRQEDAALNGIVPLLQKI
FT                   VKTERPLKEFALPILCDMAHSGKVGRRELWRNRGLPFYISLLSDPYWQVTALDAIFTWL
FT                   QEETAKVEEHLLSYHPDQPSFTESIIRCLTVSKANAFENLLEPLQKLLRLSPPIALTFA
FT                   REDMFVRIRQKLHHNKAAVRLNLLRIISSICEASEDHGGLLAEYGLLEAIRELEHDPAI
FT                   LVRDMAGKLIQANERSESYGLGKRRPGVRRGSTATTPPGLLTNQSAPSTPSVPRTNQSK
FT                   SYFDGREVQRHPRNALSGSALALRPASRDGASPALAVGGSKGSNASSASRNRLPRVILL
FT                   ALVELLNNTKMVFLSFGVCISGYP"
FT   CDS_pept        join(1743575..1744023,1744085..1744689,1744753..1745325,
FT                   1745416..1745663)
FT                   /codon_start=1
FT                   /gene_family="HOG000188189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261077"
FT                   /orf_name="AFUA_4G06760"
FT                   /product="Ubiquinone biosynthesis protein, putative "
FT                   /protein_id="EAL90112.1"
FT                   /db_xref="HOGENOM:HBG054192"
FT                   /db_xref="HOGENOM:HBG324320"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000520313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS2"
FT                   /transl_table=1
FT                   /translation="MRVALRTPLRASDFDPAAVFRYNPNGFFLSQASKRNYSSTSSLRS
FT                   PASIQSSWRGISRHHSHARSSFRTCPSSRFYSTKTPILPEDIKSRDNRSGHSGSQRSRR
FT                   RLLKYAIIAGVVGATTVTLSDDVRHLYRAAQRTGRVVGTLAVCINDYRVTLKQDTPTEE
FT                   ERQEAIRACHKRCAERTLRVLEKNGSIFIKLGQHLSSMGYLLPLEWTTTFVPLQDKCPV
FT                   SSIESVEEMFVTDTGHRIDELFSSFEPLPIGAASLAQVHIGTLKETGQKVAVKVQHPAL
FT                   AEWVPLDLALTRFTFSMLKRFFPEYDLEWLSNEMDFSLPQELDFRMEAENARRASEYFK
FT                   NHSDAPLVIPEVMWAQKRILVMEFLSGHRPDDLEYLDSNHIDRDEVSAAFAHIFNEMIF
FT                   GDNAPLHCDPHGGNIAIRKNPNRRRHNFDIILYDHGLYRDIPRDLRRNYAKLWLAVIEA
FT                   DEGRMREYARKVAGITDEQFPLFASAITGRDYTVLANKDVASPRTAAEKENISGALGEG
FT                   MLQQLVELLGQVPRIILLILKTNDLTRSLDENLHTRQGPIRTFLILARYATRTVFEEKM
FT                   ENINETGGMLRPLNFLRFLWAWTGYLRVELKLSIYETLLSMKSQFGLI"
FT   CDS_pept        join(complement(1747149..1747377),
FT                   complement(1746368..1746906))
FT                   /codon_start=1
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206879"
FT                   /orf_name="AFUA_4G06770"
FT                   /product="Iron-sulfur cofactor synthesis protein (Isu1),
FT                   putative"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="EAL90111.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG054191"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniParc:UPI000051E6C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS3"
FT                   /transl_table=1
FT                   /translation="MFRRLATVAPRSVGAVASPRIAPAISGIQSQPINRASPTPQRRNY
FT                   HEKDKYIDQSGMTSQMLTFFALLDHYNNPRNEDCYDQSTSICLLCARGESRVSAFFKLL
FT                   TNHVHASETDISIVGSLPKDAPDVGLGLVGAPACGDVMKLQIRVDKDTSKITDVKFKTF
FT                   GCGSAIASSSYLTELVRGMTLDEAAKIRNTDIAKELCLPPVKLHCSMLAEDAIKSAIND
FT                   YYTKNPKAAKTDLSGTAASISNVEKTDGSTASL"
FT   CDS_pept        join(complement(1750474..1750945),
FT                   complement(1749623..1750344))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902274"
FT                   /orf_name="AFUA_4G06780"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90110.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054190"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051FC50"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS4"
FT                   /transl_table=1
FT                   /translation="MFSDGHGNSGATSSSEEQQISQSNNLASSDIQVPPEAASSPKFVT
FT                   NLEIWSTKIPDYYVAPFCGASAGVASGIVTCPLDVIKTKLQAQGGFLRRGGGVVEAKTL
FT                   YRGMLGTGRIIWRQDGIRGLYQGLGPMLLGYLPTWAVYLAVYDRSREYFYETTVTNPIW
FT                   VIKTRLMSQSLKSNSEGYTAPWQYSSTWDAARKMYRIEGIRSFYSGLTPALLGLTHVAI
FT                   QFPLYEYLKMAFTGYGIGEHPDNGGSHWIGISCATFLSKVCASTLTYPHEVLRTRLQTQ
FT                   QRTSPAPSPEGISFRGGLDHPQDRGRPPGAASSDGMPNRPRYTGVIRTCQTILREEGWR
FT                   AFYSGIGVNLFRAVPAAMTTMLTYEYLRKLIGHLQHEGEMKLRMANDREIALLQQDE"
FT   CDS_pept        join(1751971..1752108,1752166..1752219,1752408..1752497)
FT                   /codon_start=1
FT                   /gene_family="HOG000188221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206880"
FT                   /orf_name="AFUA_4G06790"
FT                   /product="Ubiquinol-cytochrome c reductase complex 14 kDa
FT                   protein"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="EAL90109.2"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG054189"
FT                   /db_xref="HOGENOM:HBG324319"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="UniParc:UPI0000F51C05"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS5"
FT                   /transl_table=1
FT                   /translation="MQAVKLIILRFDDLIPEESDVVQTALKRLPPKEAYDRVFRIRRAF
FT                   QCSVSHTLLPAHEHTKPEEDVEYLSPIIREIERENKERVDLDTLVVRR"
FT   CDS_pept        join(complement(1753316..1754277