(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE100

ASFUM1_4.PE100       Location/Qualifiers
FT   CDS_pept        complement(302121..302735)
FT                   /codon_start=1
FT                   /gene_family="HOG000216752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210309"
FT                   /orf_name="AFUA_4G01120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27172.1"
FT                   /db_xref="HOGENOM:HBG324516"
FT                   /db_xref="UniParc:UPI0000F51BB1"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA89"
FT                   /transl_table=1
FT                   /translation="MRASFLLPVAIYVLTAYADDKTTTVGYFIPSWSVTLLSYGVWTST
FT                   GASVAGINAAATTYHLGCLKDAPKTDCNIKNSWTIIQGPETVSATGVYTASTSGKETSY
FT                   DITVTESYECKIRSRTESASCTMSVGMTGSVGGAAITSSTSTSATYSPATSSYYELVVT
FT                   AGVDKFTVPEATKTPGVAAAGPAGALITAGPVVAAAVAALL"
     atgcgtgcct cgttcctcct ccctgtcgcc atctatgttc tgacagccta tgccgacgac        60
     aagaccacta cggtcggcta cttcattccc tcctggtccg tcaccctgtt aagctacggc       120
     gtttggacta gcactggcgc cagcgttgca ggaatcaacg ccgccgcaac aacctaccac       180
     ctgggctgtc tgaaagatgc gcccaagacc gactgcaaca tcaagaactc ctggacgatc       240
     atccaaggcc cagagacagt cagtgccaca ggcgtgtaca ccgcctcgac gtcaggcaag       300
     gaaaccagct acgacatcac cgtcacggag tcctacgagt gcaagattcg gtcccgcacg       360
     gagtccgcca gttgcacgat gagtgttggc atgacggggt cggtgggtgg tgccgctatc       420
     acgtcgtcaa catcgactag cgcgacgtat tcgcccgcga cgagctccta ctacgagttg       480
     gttgtcacgg cgggagtgga caagttcact gtccccgagg cgacgaagac gcctggggtt       540
     gctgctgccg ggccggcggg ggcgttgatc acggctggtc ctgttgttgc ggctgcggtt       600
     gctgctcttc tttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page