(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE101

ASFUM1_4.PE101       Location/Qualifiers
FT   CDS_pept        join(305348..305704,305775..305904,305965..306179)
FT                   /codon_start=1
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274674"
FT                   /orf_name="AFUA_4G01130"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84306.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054601"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000051EB27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D5"
FT                   /transl_table=1
FT                   /translation="MYTKYYEFSSPSLVETYFSYPEDRSTTHGVLILTDVIGHRFINSQ
FT                   LIADQFAANGYIVAMPDLFHGDSVKLNRPETFNLMSWLEGHPIERVDPVVDSVLKYMRT
FT                   RLGCEKIGAVGYCFGAKYVVRFLRPEEGKVDVGYIAHPGFVELDELSAITGPLSIAAAE
FT                   TDDVFPTSKRHQSEGILRDSGLPYQINLYGRVEHGFAIRADLTDKAKKFAKEQAFLQAV
FT                   QWFDEFVKGQN"
     atgtacacca agtactatga atttagctca ccgtcactag ttgagacgta tttctcatat        60
     cctgaggaca gatcgaccac gcatggagtt ctcatcctca ctgatgtcat cggtcaccgc       120
     ttcatcaact cacagctcat tgctgaccag tttgccgcca acgggtacat tgtagccatg       180
     cctgatctgt ttcacggcga ctcggtcaag cttaataggc ccgagacttt taacctgatg       240
     agttggctgg agggacaccc gattgagagg gtggatcctg ttgtcgactc ggtgcttaag       300
     tatatgcgta cacgcctcgg atgcgagaaa ataggggcag tcgggtactg ctttggggca       360
     aaatacgtgg tccgatttct gaggcccgaa gaaggcaagg tcgacgtcgg atatatcgcg       420
     catcccggat tcgttgagct tgacgagctc agcgcaatca ccggcccctt gagcattgca       480
     gctgcagaga ctgatgacgt ctttccaacg tcaaaacgtc accagtcaga aggcatcctt       540
     cgtgattctg gcctgccata tcagattaat ctctatggca gagtcgagca cgggttcgcc       600
     attcgtgcag acctgaccga taaggcgaag aagtttgcaa aggaacaggc attcctccaa       660
     gcagttcaat ggttcgatga attcgtcaag ggtcaaaatt ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page