(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE105

ASFUM1_4.PE105       Location/Qualifiers
FT   CDS_pept        join(315609..316060,316915..317107)
FT                   /codon_start=1
FT                   /gene_family="HOG000048694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753595"
FT                   /orf_name="AFUA_4G01170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84302.1"
FT                   /db_xref="HOGENOM:HBG054557"
FT                   /db_xref="UniParc:UPI000051ED60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D9"
FT                   /transl_table=1
FT                   /translation="MAFQISIGDVLMLSKLAWDITQAFTSGRKSAPAEFQEVQNQLSSL
FT                   THALESLKSLSGESPGLDDGASASSITPILQNCRFTLEHLDALVKKYMIIENDGTGGPE
FT                   KKRWRDEIRKNWKKVRWTREGGDLTRLQHNLGVHINSLNLTIAVLNSYSTGPIEAVQLV
FT                   HYRNLTGDGAWVFNESADAILAARLDPIPIDSTEHEASEFTVTGELPQLHN"
     atggcgtttc agatatcgat cggcgatgta ttaatgctgt cgaagctcgc ctgggatatc        60
     acgcaggcgt tcacatcagg caggaagtcg gcacctgctg agtttcaaga agtgcagaat       120
     cagctcagct cactcaccca tgcactagaa tcattgaagt cgctatccgg ggagtcgcca       180
     ggactggacg atggggcctc ggccagtagt atcacgccga tcctgcagaa ctgccgcttc       240
     actctggaac acctcgacgc tctcgtaaag aagtatatga tcatcgagaa cgatggaacg       300
     ggtggtccag aaaaaaagcg atggcgagac gagatccgga agaactggaa gaaagtgcgg       360
     tggacaaggg agggaggtga tttgacgagg ctgcaacata atctcggagt ccatatcaat       420
     agcctcaacc ttacaatcgc agtcctaaac agttactcca cgggtcccat cgaagctgtc       480
     cagctggtcc actatcgaaa cttgactggc gatggagcgt gggtgttcaa cgaatcggca       540
     gacgcgatat tggctgctcg cttggatccg atccccatcg actcgacgga gcacgaagca       600
     tccgaattta ccgtcactgg tgagctcccg caactccaca actag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page