(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE108

ASFUM1_4.PE108       Location/Qualifiers
FT   CDS_pept        join(322040..322436,322483..322961)
FT                   /codon_start=1
FT                   /gene_family="HOG000216747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210310"
FT                   /orf_name="AFUA_4G01210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84299.2"
FT                   /db_xref="HOGENOM:HBG054525"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI0000F51C49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E2"
FT                   /transl_table=1
FT                   /translation="MGKDNFIRQVENSAEFKLLDKVVKDQVTVQDAVQEVIDMTMTALS
FT                   VHGPSKQGGIGVPDYNISLAVMELAQRREPAEHTKLAKFVSHLQKQIAIDPSTNEPLTV
FT                   QRDILWTDMPSFGYTELETWSEFGGDYKDPCDITLASEQRDRWTKLNAFLAQLTQAADI
FT                   HYPPPGEEVRFFPLDKSLRAIWVMAMAFENERPPSSLGDTAAMEAACLWFIYAAKRLWA
FT                   NVVNNRTYPAVAGAGPGKRYEAAGWTGYTRERWGIWEDALKEARAACKIERMRVLINNA
FT                   LASMRDAVNQ"
     atgggaaagg ataacttcat ccgacaagtc gaaaactcgg ctgagttcaa actccttgac        60
     aaagtagtta aggaccaagt cacagtgcaa gatgcggtcc aagaagtcat tgatatgact       120
     atgaccgcac tctccgtcca tggcccaagc aaacaaggcg gtatcggcgt gcctgactac       180
     aatatctctc ttgcggtgat ggagctcgcg caacgccggg agccagcaga gcacactaag       240
     cttgccaagt ttgtatctca tctccagaag cagattgcca ttgatccatc tacaaacgaa       300
     cccctcacgg tccaacgaga tatcctctgg actgatatgc cgtcattcgg ctatacagag       360
     ctggagacgt ggtccgagtt tggtggtgat tacaaagatc cctgtgatat aacactagct       420
     tctgagcaac gtgatcgctg gacaaaactc aacgctttcc tcgcgcagct cactcaagct       480
     gcagacattc actatccccc tcccggggag gaggtgcgat tctttccctt ggacaaatcg       540
     ctgcgggcca tctgggtcat ggcgatggct tttgaaaacg agcgtccccc ttcgtctttg       600
     ggagatactg cggcgatgga ggccgcttgc ctgtggttca tttatgctgc gaagcgacta       660
     tgggcgaatg tggtcaataa tcgcacgtat cctgcggtgg ctggcgctgg tccagggaag       720
     aggtatgaag cggcgggctg gacgggttat acgcgggagc gatgggggat atgggaggat       780
     gcgctgaagg aggccagggc tgcttgcaag attgagcgga tgcgggtgct gattaacaat       840
     gctctggcga gtatgaggga cgccgtaaat cagtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page