(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE109

ASFUM1_4.PE109       Location/Qualifiers
FT   CDS_pept        join(complement(325710..325877),complement(325407..325654),
FT                   complement(325259..325358))
FT                   /codon_start=1
FT                   /gene_family="HOG000199989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274678"
FT                   /orf_name="AFUA_4G01220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84298.2"
FT                   /db_xref="HOGENOM:HBG054514"
FT                   /db_xref="UniParc:UPI0000F51C4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E3"
FT                   /transl_table=1
FT                   /translation="MSPTSVSDSHPAVLSLRTAALVTSAAGFISLAWSITHHKDISDDG
FT                   AGGINSIVLGTIAYAFLWSLVALTIRLTPRRIHPGIYLAFDLIAFLANVIAGSIGLAVL
FT                   APAMEGGYNCYSAGCDGDAVLRVEIFAYVIVFVNVVVHVMLVVWASWACHVERARRMEK
FT                   NGFEEVEL"
     atgtctccaa cgtccgtctc agatagtcac cccgccgtcc tctccctccg caccgcagcc        60
     ctcgtcacct ccgctgcggg cttcatttcc ctcgcctggt ccatcacaca tcacaaggac       120
     atttcggatg acggagcggg gggcatcaac tccatcgttt tgggaaccat cgcatatgca       180
     ttcctctggt ccctggtcgc cctgacgata cgactgaccc cccgccgcat ccacccgggt       240
     atatacctcg cgtttgacct gattgcgttc ctggcgaatg tgatcgcggg gagcatcggg       300
     ctggcggtgc tggcgccggc gatggagggg gggtataact gttactcagc gggttgtgat       360
     ggggatgcag tgctccgagt ggagatattt gcgtatgtga ttgtgtttgt gaatgtggtg       420
     gttcatgtga tgcttgtggt ttgggcttcg tgggcttgtc atgttgagag ggcgaggagg       480
     atggaaaaga atggatttga agaggttgag ttgtag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page