(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE110

ASFUM1_4.PE110       Location/Qualifiers
FT   CDS_pept        join(complement(327752..327892),complement(327636..327706),
FT                   complement(327472..327585),complement(326956..327416),
FT                   complement(326133..326914))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210311"
FT                   /orf_name="AFUA_4G01230"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84297.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054503"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51BF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E4"
FT                   /transl_table=1
FT                   /translation="MTTGTKAPEMASLQMEAGHHASTDAKHSGTVYDDHDMQRMGKVQE
FT                   LKRNLRPLAALSFASVLQATWEFILISNTQGLENGGLAGMVWSYLWTFVGFGFIIASLS
FT                   EMASMAPTSGGQYHWVSEFASPRYQKFLSYLTGWMSVLAWQAGSASGSFLTGTIIQGLI
FT                   SVRYPDYQPERWQGTLFVFAMIVVIYVFNVYAADMMPLFNNLLMILHILSWTVVVIVLW
FT                   AMAPHQSAKAVFTEWTNGGGWSSIGLSALIGQISAIYASLSSDATAHMSEEVKDAGRYV
FT                   PIAIAWGYFSNGVMAIVVVISFLFAIPSVEDALDDATGFPFIYVFKNATSVAGVNGLTA
FT                   IILIPVIFSNILFNASTSRQTFAFARDKGLPFARWIAKVDPRRKIPVNAIALSCIISCL
FT                   LSLINIGSLTAFNAIISLNVAALMYTYIISISCIIYRKIWHPDTLPPRRWDLGRWGLTV
FT                   NIVGLLYCMFALFWALWPSETPVTVDNFNWSVVIFGVVFVLSLVMYAVKGRREYHGPVV
FT                   IVRRD"
     atgacgacgg gaaccaaggc gccggagatg gcctcccttc agatggaagc aggacaccac        60
     gcgtccacag acgccaaaca ttcggggacg gtatatgatg atcatgatat gcagcgcatg       120
     ggaaaggtcc aggagctaaa gagaaacctc cgccctttgg cggcattgag cttcgcgtcg       180
     gtccttcagg caacatggga gtttattctc atatccaaca cgcaggggct agaaaatggc       240
     gggctcgcag ggatggtgtg gtcgtatctg tggacgtttg tcgggttcgg ctttatcatt       300
     gcatcgttgt cggagatggc ttccatggcc ccgacctctg gcggacaata ccactgggtg       360
     tccgagtttg cttcgccgcg atatcagaaa ttcctgagct acctcactgg ctggatgtcc       420
     gttctagcat ggcaggccgg ctctgcatcg ggctctttcc tgaccggtac aattatccaa       480
     gggctcatca gtgttcgcta tcccgactac caaccggaac ggtggcaagg aaccttgttc       540
     gtttttgcca tgattgtggt catctacgtg ttcaacgtct acgccgcgga catgatgccg       600
     ttgttcaata acctgctgat gatcctgcat atcctgtcct ggaccgtcgt cgtgattgta       660
     ctgtgggcca tggctccgca ccaatccgcc aaggccgtgt tcacagagtg gacgaacggt       720
     ggaggctggt ctagtatcgg gctgagcgcc ttgatcgggc agatttctgc catctatgct       780
     tcgctgagct ccgatgcgac agcacacatg tctgaagaag tcaaagacgc aggacgctac       840
     gtcccgatag cgattgcgtg gggatatttt agcaacgggg tgatggccat tgtggtggtc       900
     atttccttcc tttttgccat tccctccgtc gaagacgcac tggatgacgc caccggattc       960
     ccgttcatct acgtgttcaa gaacgccacg tcggtcgcgg gggtcaatgg gctgacggca      1020
     attatcctca ttcccgtcat cttcagcaac atcctcttca atgcttccac atcccggcag      1080
     accttcgcct ttgcccgaga taaaggactg cccttcgccc gctggatcgc caaagtcgac      1140
     cccagacgca aaataccggt gaatgcgatc gctctatcgt gcataatcag ctgcctcctc      1200
     tctctcatca acatcggctc gctaaccgcc ttcaacgcca tcatttctct gaatgtagca      1260
     gctctcatgt acacctacat catctccatt agctgtatta tctaccgcaa gatctggcat      1320
     ccggataccc tgcccccgcg gcggtgggac ctaggccgat gggggttgac cgttaatatc      1380
     gtcggtttgc tgtactgcat gttcgcactg ttctgggcgt tgtggccgag tgagacccca      1440
     gtcacagtgg acaattttaa ctggagcgtg gtaatctttg gggttgtgtt cgtcctcagt      1500
     ttggtcatgt atgccgtcaa gggacggagg gagtaccatg ggccagtggt gatcgtccgg      1560
     agagattag                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page