(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE113

ASFUM1_4.PE113       Location/Qualifiers
FT   CDS_pept        join(complement(334517..334801),complement(333665..334412),
FT                   complement(333436..333605))
FT                   /codon_start=1
FT                   /gene_family="HOG000216745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753597"
FT                   /orf_name="AFUA_4G01270"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84293.1"
FT                   /db_xref="HOGENOM:HBG054465"
FT                   /db_xref="UniParc:UPI00005202DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E8"
FT                   /transl_table=1
FT                   /translation="MRPLLHYLAAYALLYLQGAGALPQRVSPSEVSSALTATSTGTSIR
FT                   ENRTCDFGTINEFFDYANKNGLNITVEVQNCQNLCLLTYGVGNPDLSGIGTGLTILIGP
FT                   VYRIFYLTLAPASAFIQDFKDVQTNFFSSNAFFVCSSALATIANLSLNPPTFEIAEMQA
FT                   LAFLQVNSILVTFFCLVIAQPRSRWGARVLLYFVVFVLVIVALGQSHLGSDSRADWRLA
FT                   SDGCAHSSNDYSVIKPVPYPSWAVAIFAVAGTVGFWLESLKKRFQADKLHKSLFRILMV
FT                   LWVLLIGLLTAGMVLGLTMMWRQRRHLRSLARDEFEDDQWGFGQIAALTIWVPVLVELL
FT                   YILNDLAQRKSKGWSDINQTISVFFSPKAVQQEMTPPSSCLEAEIKGQDKSGRVAEVAS
FT                   S"
     atgcgaccac ttctccacta cctcgcagcg tacgccctgt tatacttaca gggtgctgga        60
     gcattgccac agagagtaag cccatccgaa gtctcgagcg ccttaacagc tacatccaca       120
     ggaacatcca tcagagagaa taggacatgt gactttggca ccatcaacga attcttcgat       180
     tacgccaaca agaacgggct aaacatcact gtggaggtcc agaactgcca gaatctgtgc       240
     ctgctcacat acggggtggg caaccccgat ctttctggga ttgggaccgg gcttaccatc       300
     ctcatcggtc ctgtataccg tatcttctat ctcactttag cgccagcgag cgccttcatc       360
     caagacttca aagacgttca aacgaatttc ttctcctcga atgccttctt tgtctgttcc       420
     tccgctctag ctacgattgc aaacctgtca ctgaacccac ccacctttga gattgctgag       480
     atgcaggcct tggcattcct gcaagtgaac agcatccttg tgaccttctt ctgcctggtc       540
     atcgcgcaac cacggtcgcg ctggggcgcg cgagtgctgc tttattttgt agtgttcgtc       600
     ctcgttattg ttgccctagg ccagagccac ctgggcagtg acagtagggc agactggagg       660
     cttgcctccg atggctgcgc gcacagctca aacgactaca gcgtcatcaa gcctgtccca       720
     tatccgtcat gggctgttgc tatctttgct gtcgctggta ccgttggatt ctggttagag       780
     tctctgaaga agagatttca ggcagacaaa ttacacaagt cgctgttcag gattttaatg       840
     gtgctttggg tcttactgat tggactcctg actgcaggca tggttctcgg cctgacaatg       900
     atgtggcgac aacgaaggca tctgcgaagc ctggcgcgag acgaatttga agacgatcag       960
     tgggggttcg ggcagattgc tgctttgaca atctgggtgc cggttttggt tgaattactc      1020
     tatatcctca atgacttggc gcaacggaag tcaaaaggat ggagtgacat aaatcagacc      1080
     atcagcgtgt tcttctcccc gaaagctgtg cagcaggaga tgactccacc aagctcatgt      1140
     ttggaagccg aaatcaaggg acaggacaaa agtggaaggg tggccgaggt tgctagtagc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page